2PP8A

Formate bound to oxidized wild type afnir
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Conserved active site residues limit inhibition of a copper-containing nitrite reductase by small molecules.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 89
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2007-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2pp8A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2pp8A02
1AZBA 2JFCA 5TK4A 1WS7A 2BZ7A 2YQBA 4N4YB 3CDZB 2N0MA 1E5ZA 4YSOA 1X9UA 4YSEA 2QDVA 1JZJA 3FQ2A 1M56B 2UXVA 4BXVA 1PLAA 4DP8X 1PY0A 1TKWA 2VW7A 1V54B 3NJFA 4WKXA 4A2DA 3TASA 4E9SA 2BZCA 1DZ0A 3TU6A 2WSDA 4W1TA 2IDFA 4Q8BA 5I6NA 4DP6X 3ABMB 2GB2A 2UXFA 3OMAB 2PCFA 3CVDA 3GYRA 4BWTA 2WO2B 3QJVB 1BAWA 1UATA 1N70A 2VSMB 1ZV2A 2XXFA 1KYAA 5ANHA 2YAMA 1OCCB 2PPAA 3FU9A 3ASNB 1SDDB 3NSDA 3NSCA 2P80A 2FQDA 3SBRA 1NWPA 4E9TA 4HALA 3FSWA 5I6OA 2BP8A 4UANA 2AFNA 1NINA 1OOWA 4E9YA 3OM3B 3PPSA 5I6LA 2GHZA 1PLBA 5I28A 3AG4B 1WA0X 4HHWA 1R1CA 2BP0B 4NB7A 1B3IA 1ILUA 1RZQA 4ENZA 1NIEA 1JZFA 1MG3C 2CJ3A 1V55B 1SFDA 3QJSB 1MG2C 3OD3A 1PZAA 1JZEA 4NAJA 1J9SA 4EF3A 2HX9A 2TSAA 3FT0A 5B1KA 3QQXA 5PCYA 1A4BA 1XB3A 1KCWA 1BYOA 2ZXWB 1FWXA 4DP9X 1AR1B 1CUOA 3FSAA 1FA4A 4F2FA 3PXLA 2BO0A 3CG8A 2RACA 1GS7A 3NJGA 3NP3A 2IDTA 2P80D 3FSVA 2PPCA 1HFUA 4AKPA 4G7RB 2HX7A 2AANA 1FFTB 3OQRA 4CSPA 3SBQA 3H4HA 4YSTA 3OMIB 2Q9OA 2XLLA 3NJNA 3FS9A 1KGYE 3SBPA 2HX8A 3IE9A 1KBVA 3X1FA 4F7KA 3X1GA 4YSUA 1L9QA 4FA7B 3FU8A 1A3ZA 4YSQA 1GW0A 2EIKB 2Q5BA 1I53A 3X1BA 3FQ1A 2PP9A 4GP5B 4W9ZA 2GI0A 1SF5A 4A2FA 1KV7A 1BXUA 1SF3A 3T71A 3BQVA 2ZONA 4JHVA 3BVDB 1N68A 1AIZA 2BW4A 4YL4A 3UGEA 1GR7A 3V9EA 4QLWA 4YSDA 2XX0A 1AZUA 2OJ1A 1QHQA 5D4HA 1OCOB 5B1AB 2GIMA 3UAEA 2I7SA 2PP8A 2VM4A 3D12B 3FU7B 4UF7C 2H47C 4E9RA 2QPEB 4HZ1A 1ZIBA 3WNIA 3FSZA 4JHUA 1TEGA 2BW5A 1JXDA 2XUWA 1J9TA 2FNWA 2VSKB 2E86A 2XYBA 4ZK8A 2ZOOA 2XXGA 3T9WA 3V9CA 1ZDQA 1AANA 5FC9A 4YVUA 2OCCB 4A2EA 3GDCA 4DPBX 2DV6A 2FT6A 2VW6A 2Y69B 3QPKA 4HHGA 1JZGA 5I6KA 1OF0A 4YSPA 4A68A 2JXMA 3AG2B 5TK2A 1J9QA 2VW4A 1XB6A 3N2JA 3ZIYA 1CYXA 3C75A 4AI7A 4E9XA 1SFHA 1KDJA 4P5SA 1QLEB 3PCYA 5A7EA 4BWWA 3WIAA 4DP1X 5B1JC 4DPCX 3DTUB 3H56A 1QNIA 5AZUA 1WA2X 2GC4C 2VN3A 3AZUA 2FQGA 2EIJB 4HCGA 2MRYA 3FPYA 4GY4A 1BQRA 2PCYA 4QKTA 4CSZA 3ASOB 3UABA 4BXSV 1ILSA 1CC3A 3G5WA 3FPXA 1BXAA 4MFHA 5B7FA 3QJTB 1L9PA 1AZRA 4HIPA 2I85A 4AZUA 3NJMA 1JXFA 2IDQA 1ASPA 2BWDA 3EH5B 1NZRA 3ABKB 2EINB 3IN0A 3NJKA 4G7SB 4HAKA 2UXTA 1OCZB 1NIBA 1PAZA 4YSAA 1J5CA 1NDTA 3UACA 1ID2A 3TA4D 4L0PB 3UADA 3DIVA 1NPNA 4AX3A 4M3HA 1JZIA 1PCSA 1MZYA 2GSMB 3NSFA 2XVBA 3JTBA 1PLCA 2H3XC 4F2EA 2BP0A 4BDVA 5I6PA 1E67A 1WAEA 1J5DA 4DP7X 1NIDA 1M57B 4A2HA 3IEAA 4YSCA 2DY2A 2VMJA 3NJHA 7PAZA 2X88A 3NJLA 1OE2A 1NICA 2TSBA 4RH4A 1NPJA 2YAQA 4A66A 2WO3B 1BEXA 4KO7A 4A2GA 1KCBA 2XV2A 3PAZA 1CURA 1RKRA 2IWKA 8PAZA 6PCYA 4KO9A 1DYZA 2AZAA 3FYEB 3WKQA 1GYCA 2A3TA 2FT8A 3CVBA 5I6MA 1E65A 1SJMA 2B3IA 2ZWNA 3JT2A 3NT0A 4P5RA 2XV3A 1JVOA 4YVNA 5E9NA 2VM3A 5I5MA 2FQEA 1MDAA 1CYWA 1VLXA 5D4JA 3N55A 3ABLB 3NJIA 1BQKA 3IBOA 2BWIA 2DYRB 1J9RA 1EHKB 3QJQB 6PAZA 2CCWA 2QDWA 5B7EA 4AKQA 3EH4B 3MX0B 2PPDA 3S3BB 2IAAC 5PAZA 1OE1A 1JOIA 1A65A 2IWFA 5B1JA 3AG3B 2OV0A 2GC7C 5I5JA 1JVLA 1SNRA 1ZPUA 2UX6A 3KW7A 2J5WA 3OMNB 1IBZA 5LDUA 3L45A 3T6XA 2R7EA 2H5UA 1PNDA 1W6LA 4KNUA 3NJJA 2YXWA 2W8CA 2HRGA 4GXFA 2LLNA 4FAAB 1PMYA 3SQRA 4GYBA 1TU2A 3FYIB 2CBPA 1AZNA 1PZBA 4GP4B 3QJRB 3NP4A 4K9JA 4KOBA 1ZDSA 2DWSA 1A8ZA 9PCYA 4DPAX 1ET7A 2YXVA 1MZZA 1L9SA 2CAKA 2PPEA 1OE3A 5F7AA 4JKNA 3CDZA 3CZUB 3WI9A 4PCYA 2XWZA 4DP0X 2J55A 4HCIA 1ADWA 4G7QB 1A4AA 2QT6A 1AOZA 3S3DB 1HAWA 4BK5C 1XMEB 1HAUA 1YLBB 1RCYA 1AAJA 1L9OA 3FQYA 1AACA 1E30A 2FJSA 3ZBMA 1PNCA 1AS7A 1ZIAA 1EZLA 2J57A 1NTDA 4GP8B 1NIFA 1ASQA 4KNTA 3UAAA 1ASOA 1IC0A 4A67A 2BP8B 3AG1B 3T6WA 3X1EA 3T6ZA 2FT7A 2J56A 3EF4A 1SHXA 3RYMA 3ZX1A 2HZHA 1IBYA 1SDDA 1L9TA 2DYSB 2YAHA 3HEIB 1AZCA 4E9QA 1XB8A 2CUAA 2YAOA 4PAZA 2I7OA 2XU9A 2FQFA 2YAFA 5I26A 2MTAA 2AVFA 2DWTA 2UXGA 3PAVA 3KW8A 2IH8A 4N8UA 1AS6A 3CVCA 3GXUB 3H4FA 2PPFA 1BYPA 4G72B 1A4CA 5AFAA 3AY2A 1WS8A 4DP5X 4KO5A 1OCRB 3NYKA 3TBCA 5EHFA 4DP4X 3T6VA 2YAPA 2IDSA 4BDVB 2EIMB 2JKWA 4UAHA 5AKRA 2AZUA 5B3SB 2XX1A 3S8FB 2PP7A 2BHFA 2Y1AA 1ET8A 1WA1X 2FTAA 3S8GB 3MBWB 2QPDB 4NERA 5F7BA 3S3CB 2XV0A 1GY1A 1AQ8A 5IY5B 1BXVA 2IH9A 1KDIA 1ETJA 1OV8A 2FWLB 2UX7A 1V10A 3WKPA 1E5YA 1GS6X 3PLYA 2PLTA 3NSYA 3HB3B 4E9WA 4YSSA 5I5IA 1TEFA 2EILB 7PCYA 4E9VA 1W8EA 2YARA 4HCFA 4X4KA 1IKOP 2CALA 1RZPA 1M9WA 1GS8A 1IUZA 2HXAA 1AG0A 4KOCA 4TXVB 1X9RA 4AKOA 3TBBA 3QJUB 5B1BB 1GSKA 1L9RA 4WTQA 3EH3B 5B7MA 3ZDWA 4KNSA 3DKHA 1NWOA 4G71B 1AS8A 3IN2A 1W6WA 3PAUA 2HRHA 2B08A 2GBAA 4G70B 4YSRA 2R7EB 1PZCA 3AW5A 3ERXA 1BQ5A 2IWEA 3U25A 2W88A 3X1NA 1NIAA 1KBWA 4DP2X 4KO6A 3X2QB 1JXGA 1ET5A 2X87A 1JERA 1GY2A 4M4RB 3WG7B 1SHWA 2YAEA 2IDUA 3EHBB 2HLEB 5D4IA 3FU7A 4Q89A 3WNJA 3ABGA 1PF3A 4BWUA 1F56A 1URIA 1T5KA 1AG6A 1JZHA 2NRDA
chains in the Genus database with same CATH superfamily
1DQJA 3CHXA 3TWCH 3E6FB 4JM4H 2BSED 3CN1A 2B5IB 2N0MA 2OSXA 1GJIA 2VERA 5LCVA 3WS6C 1ADQH 1BJ1J 4J3OH 2Z34A 5EBMA 1LK2A 2R23A 3D25A 5AW2B 3P9MA 5A2CA 1ZJBA 3GB7B 5IHHA 4O5LL 4Y2DC 3TNNB 5J11B 4FFZH 1HN1A 1A4KA 4ORGA 2VLLA 3M1BA 1KTDB 4IOSA 2WLMA 1OT2A 1YN7A 3MO1A 1ZSHA 3L5XH 4LCWA 2E9GA 3LVEA 3EFOA 4FQQB 3C09B 1D5BB 3QQ9D 1TO5A 2DQDH 2VITA 4YNYA 5EZJB 2VNCA 2WO2B 4ZUUB 3O3EA 4OGZA 3HUJE 1B2YA 3QIBA 1BFOB 1DVSA 4JR9H 3MNVA 4TUOA 1E9OB 3QIUC 4LRNH 3MJ7A 4ODBD 2KLSA 5HGAB 3ZDYB 4RAUA 3IRZA 4RDQG 3BPLC 3NJXA 3Q06A 2MH4A 5BO0D 3ARBA 1KXVA 4WCYL 1Z0MA 1IE4A 1MHCA 1T0NB 3PJSB 1E3ZA 4HUVB 1FNGB 3O0RH 5EZPA 3SE6A 4Z5RA 5IBUG 5IEHB 4R9HA 1FHGA 2GHZA 3THMH 2YK1L 1BAFH 5F1NA 4KPHL 1B3JA 5BRZE 1ITBB 2FBRA 4FE9A 35C8L 4X99A 3P73A 3U1QA 3ME0B 1MCPH 2GKIA 3GZPA 4KJPC 4LDCA 5KG9A 2GFBB 2P1YA 1A1MA 1UUNA 1JZEA 1NCDH 3GJFH 4KY1H 5LGJA 5EU4A 2A38A 1IGFH 3L5WA 1A4JB 2ZUQB 3BP6B 4OGYH 4X80L 5FGCB 4XBGB 5BS0B 5KN5B 2HT4D 3VGAB 1GVIA 3DA0A 4FXTA 4OFQA 2J8UE 2X1QA 5I1CH 3ZDYF 5C3LD 3WV0A 3C2AL 1XFPA 3G6AA 4APXB 4S0SD 1RQ5A 2XVLA 4I1NB 4XCCL 1UADC 3QNXB 4G7RB 4GUPB 5I75C 4JPSA 3ZZLA 5HHVH 1KLGB 4M48L 3V7AG 2LFGA 3S7GA 3GTTA 3H4HA 5BZWA 2F53E 3FB7A 5EZOH 2AJUH 4U6HA 2D8KA 4XNMA 4F7KA 3FHEA 3CFBA 4OCWL 5C0JA 3RWEA 1A7NH 1E3FA 1HL8A 5IW3A 1YUHB 2DICA 2F58L 3R4RA 4HJ0D 4JO1L 4WFGD 3TA3B 5JHLA 5JW5A 4MNQA 1IEAB 4JANB 1EWHA 3WJJC 3WTTA 5AOJA 2X2UA 4QXGL 2JV6A 2PO6D 2X9ZA 3FTVA 1GGYA 1DVTA 5DVNA 5D7JC 1N59A 3MJ9L 2HT2D 2FRGP 2BVYA 1N68A 2F5AH 4KH2A 2VXQA 4XB7A 5E6IB 5JHBA 2OA9A 1DQVA 2BRQA 1AZUA 1BPLB 1WUNT 1G6VK 5B1AB 4H8PA 1MDTA 3FHQA 3IFLH 4N26A 3FU7B 2F74B 2FSDA 1QKZL 1OALA 2OMTB 3MCKA 3QNYA 5ALCL 2RB8A 1JK8B 3VTTA 2XYBA 4LSPL 5FV2A 4CVXB 1ZDQA 3QI9B 3CXHK 3D3VD 1QTSA 3GSRB 3OMZA 2NZIA 2BSCA 4YLCA 5JXEC 1D5ZB 4Y5YA 1R3KB 2YC1B 3LZLA 3K72B 3CLWA 4EQ3A 2B0SH 2QMKA 1BM3H 1Y1UA 4DW2L 3W9EB 2JXMA 2AVGA 5AKVA 2OS7A 4HWBL 1SFHA 1I7ZA 2LU7A 3EO0B 4FNUA 1T4WA 4H8WL 3T1FA 4F20A 4K7FA 4Z7WF 3FT3B 4I85A 5I16B 5I1JH 4H2AA 4IRZL 1KXTB 2ZD0A 4WU7A 5I2IB 3VAEA 4XNYH 4HCGA 2P45B 3SOBH 2YJLA 2V3EA 3OJVC 3H3PL 3NQIA 4FTVE 1S2EA 4XMZA 2EDOA 32C2A 4FN0A 5E9AA 3PQYE 5E1IA 4CSZA 4BH8B 2HVKB 1OP3K 4NKOB 3HN8A 1YMMB 2NZ1A 1DBAL 1J8HA 3V5KA 3ZXAC 3ARDB 2X4RA 3PNRB 2I24N 3TESA 2C3VA 3HRPA 2BS71 3OKNB 5FWQA 2F7QA 5D7IB 3SDAD 1CDCA 3AADB 1L9PA 2V2WA 3EO1B 5CUSL 3KPSE 2Q86B 3GBEA 3IF1B 3MLZL 4ZYKB 4B9GA 2X53A 4WFEE 4X9BA 5B38B 4O51B 4I3SL 4KTDH 3UADA 4L0PB 4OLYL 5L2JA 1A6VL 2VKWA 4AX3A 4M3HA 4DGUA 1OARH 1SUJA 1YYLH 3FRPG 3VI4B 2ZUSA 4YHLL 3TT1L 4JQIA 1WAPA 5FW6A 1LJMA 3C6LD 1IJNA 2LU5A 1HCFX 3CSFA 2BSRB 2CKBL 3T2NH 5C0RL 5C09E 3ROLB 1H8SA 3STBA 4WV1A 4LHUA 3ULVC 4LAJH 1KCVL 4A66A 3LHPH 4EQ2A 3RVXD 1CURA 3ULVD 3L1FA 1N10A 4U6VH 3I9AA 1AI1L 1WCBB 3RIAK 4HUNB 2AV7A 2AZAA 5HI4C 5J12B 1JNHA 3QIWA 2JQAA 1G6RB 5CJXC 5ITFA 2V17L 5D7IF 1Z9SB 2JLPA 3FU5A 4QRPA 3GLZA 3QZMA 3KCWA 1UWXK 4GS7B 1WBXA 5HPOA 2HJKA 3OB0H 3IMTA 4YUEH 1C9SA 1BCIA 4XPHL 4IU3B 3T2OA 5I5MA 1F02I 3SGEI 1A3RL 1DBML 3GSXB 4TLKA 5IJKC 2VT0A 4DEWA 2XIBA 4PJHB 2ID5A 4JZNA 3N55A 1UUSA 2QSTA 2J2ZA 2CLZB 1EHKB 3WO4B 2CCWA 1GTNA 3MZTA 4EO5A 5I19L 1NEZA 1M1XB 1RZGA 1TQCB 1E50A 4ZW6A 3ULAB 3NUKA 1AQKH 4HSQA 4Y2OA 4AGPA 4IJ3C 4NFCA 1RZKL 4DQOL 5I5JA 5IROA 3TM6A 1JVLA 1TZIA 1ZPUA 5IV2B 1IAOB 4Z8FL 2H1PL 2YQ2A 2VN5A 4MCZB 3GT6A 3GSUB 1MCLA 4EPSA 5CGMA 2X3AA 3FMGH 5IR1B 3ULUH 5TE7H 4N2BA 5HI5C 1JFQL 4KVNH 4IOIA 1A6PA 1XCTB 2HWZL 2D4DA 1JVKA 2WY3B 5CHNA 5HI5D 1JSYA 3F7LA 4B9FA 3CH1B 3UBHA 4PVMA 3M45A 3SGEH 4LL1A 1ETA1 4UQ2A 2EIZB 1MXGA 4K9JA 4L5FE 5EN2A 5F1OB 2WUBH 4K94C 2HFGH 3VYPA 2RR3A 2X4UB 3SDDD 5C2BH 5JPNC 3UTTA 3VFWA 4YO0A 2CAKA 3WXWL 4R7VA 4MMXB 3U2SA 5DMIH 1UCBH 1WFUA 4NWUH 3J07A 4QHKJ 1IAKB 1UH2A 1II4E 3P0YL 1A4AA 1AKJB 1AOZA 5AOMA 2XZCL 3OXRA 2N0KA 1PG7L 4XCNB 3TYFA 3KM2A 3N6YA 2V5RA 1HHKB 2NY1B 1AACA 4XWGH 4YPGB 2VXSL 1AS7A 3W0WB 1IAII 3HC4H 3LKRB 4DK6A 3N3EA 3GJFK 4F7CA 4Y9EA 3WTVA 4EIBA 1OGAA 3X13B 1QACA 1OZUA 3BZFA 3HC0A 4Z7OB 5G4OA 3EBAA 5T5FA 3M8OH 4P3CL 4B3VA 2UY6B 2J1ZA 4B0MM 4OTXL 5E00A 1HXYA 4AQAA 2AGJH 2HLFD 1ZD6A 3D4YA 4KHXL 1G43A 1S7UA 3VD5A 5DR5L 2FQFA 1IBFA 2R1YA 5HVGB 4EIZC 3ZDYE 2C8NA 3PAVA 3EAKA 4CN1A 4YR6B 5IQNA 1AS6A 4L2LA 4MJ2A 1PQZA 3W11C 4PRNA 5HHQA 3BXNA 3FN0L 3OKDA 3W11D 3KDPB 2BIHA 2R0WL 4IMKC 5INDB 1A6TB 1CDYA 3APFA 4P9MH 3NMEA 1IAIH 4H5SA 3OJDA 3N06B 1KENL 5DUPH 2B1OA 2DJ4A 3BSGA 3SE4A 5BMFL 1NC2D 1V7NL 5B8CC 3LRMA 2ITFA 3MAWA 4L1LA 1I1AB 1TFHA 1XCXA 3NFNA 3HFMH 4M6NL 2P24B 1ZLWK 3NA9H 2DRUA 3DYMA 3PDDA 4MNGA 1N2RB 4ZO6A 2O5YL 4HMEA 3AT9A 1D6VH 5JPMB 1CR9L 3AVEA 1USQA 3KYOB 1OV8A 3S88H 3ZTEA 4XMLL 3AU1B 5JR1H 4YGAB 1OW0C 3DHUA 5BS0E 4PHXA 2APFA 3I2CH 2C1OB 3UH8A 1DSFH 3T65B 1MI5B 3BRGC 4G6JL 5F96H 5F44A 1CGWA 4Y2DB 3A6BH 4P06A 1B4JL 1I3VA 4HXAH 1CLZH 5GGSY 4JM0A 2ILLA 3LVTA 2YJQA 3V9FA 3BZ4A 1S3KH 4HAFA 3RIKA 2WIIA 1UXSA 2AJZA 4IRSC 4QNPF 3MLRL 1HCVA 1L9RA 3UTSA 3HC2A 1UWGH 3QK0A 4L9LB 3WFHA 4WTQA 1FNLA 2ALWA 4KNSA 4P9HL 2VZVA 3H9SD 2OYMA 4LRIA 5E8EB 4G71B 1AS8A 3QIUB 1BIIA 2JIXD 3DVGA 4F1ZA 3DOIA 4NZ8A 1MUJA 5DQ9B 2AQNA 3TO4D 2C9XA 4ADIA 5EG6C 3BPLB 1DFBH 4S2SA 2KMWA 3LJ3A 1SUHA 3CFTA 4AZ8B 3HAEG 4KO6A 2Y6SC 3F7VA 3GS7A 3HA0A 4FLQA 4Z7WE 1JXGA 1JNNH 2Y2YA 2YPKB 3O9WA 5IEKA 2F1BA 1H19A 4J1UB 1QSED 2WBJA 3RL2B 3AQZA 5AOLA 2F5BH 2QBWA 4M5ZH 4WV1C 4F7PA 4WEUD 1TXKA 4Z3FA 4BWUA 2A6DA 4CGTA 4DGYL 4XNUL 3WEOA 4AENB 3T3PF 5CS7A 1V05A 4QXUL 5MHSD 4APQB 2HRPH 4UQ3B 1FFNB 1NAML 5IESH 2ED7A 2D7PA 2QQLL 2X6UA 2ZJSL 1SOSA 4I2XA 1T04A 2EYSA 3FQ2A 3WSQH 4V33A 2J88H 4YDVA 2H26A 2AJYL 4QPEA 3WD5L 1H6TA 4ZTPH 43CAA 4I77H 4BXVA 4Y9FA 3L2NA 4A2DA 1GZQB 5FYLE 5BQ7B 2AJ3B 5D2NA 3TN0C 4AV0A 3PP4H 2ARJA 3QJHB 3TU6A 3VFMB 5H94A 2QHRL 3TV3H 2FATH 1VJSA 4JRYB 3ATEA 3V6ZB 4NPJA 4XPTH 2E9WA 1DLFH 5AVUB 3SDYL 2PCFA 3G5XB 3BKML 3HHRB 4TTDC 3WNLA 1ZA3B 1Y07A 2SEBB 2WQRA 1ZS2A 1KB9K 3L54A 4AJYV 4AQ1C 3V6OA 4HS6A 1DP0A 1KJ2L 4H44C 5D1ZI 3SO3C 3DXAA 4RWHA 1G6RH 2K7QA 1MRDH 5E8OB 4XI5C 1I8AA 5DQJB 2PXYB 1OQOA 1KPRA 1GC1L 3P0VH 5E03A 2OMWA 4UANA 2XNAB 2XBTA 3CFJA 1F58L 5CIPB 2DMKA 4X6DB 3PREA 1VF5C 3O11B 2GY7B 2DD8L 3NDZE 3S4SB 3MODH 2Y2TA 4NO0D 2EO1A 4OM1H 2FEDC 4TL5A 3FB6B 3PDOA 5D7IE 1R1CA 5HDWA 3VXRB 5JUEH 2YGNA 1UASA 4GAYA 5KJRH 5D7JB 4JFOA 4G5AA 2N7BA 2DI7A 3O6FC 4GG6A 2BS9A 2D3VA 3SQBA 1KZQA 4X7CC 3HZYB 4PVLA 2HG5A 1A14L 1GJWA 3OD3A 4JW3A 1JPTH 5T1DH 5EU6E 1JPGB 4OBSA 1J9SA 3QORA 1KBGH 4JQVA 5AENA 2C3GA 4UTCA 4L9DA 3WFEL 1MCDA 3MRQB 3VB8A 4RAVA 3JWOH 3WLWD 4NUGH 3UPRB 1Z5HA 2XZQL 1H15B 1BYOA 1GYUA 5CJOL 1D5MB 2UZXB 3EDKA 5K9QI 4NHUA 1ZHBB 3WN5B 4BFJA 1IBGH 2F8OA 4PGEB 1YVLA 2P52A 1HFUA 5CGYC 2CIKA 2XWDA 4OFIA 2K8MA 1KTLA 3K6SA 1CQYA 2Z93A 1U8CB 4M1CD 1MCJA 1T1XA 4X6DF 2G4GA 4LO9A 3TBTB 2YGVA 4MDJA 5BRZD 4KKPA 2NSQA 3GKWH 4ZNEE 2NX5D 4L1SA 2WB7A 5LNDA 3BN3B 1IKFH 2MCG1 5F7DB 4N0CD 4LK4A 3IDMA 2ZX8A 5T5NG 3U1SL 1UGNA 4NWTH 5I1DB 5BZXA 3X1BA 2IOMA 3OC5A 4PJHE 4J3VA 1RZJL 2BIQA 2EDXA 1D5XA 1PEZA 3MBEB 3MNDA 4LPXA 4O58H 3GBML 4OCXH 3OBAA 4ODTL 4PVBA 4OIBA 2VERN 3SBWC 1OHQA 1H8LA 2BW4A 3KH3A 1KCRH 2DTML 3L5JA 2Q3XA 3QWRD 1QHQA 3RWHB 4K0OA 5D8JL 1I7UA 3EG9A 4HT1L 2QGEA 5DRWA 2I7SA 2X4TB 3HC3H 2CRZA 3SE3C 4NT6B 1TTAA 4DKEH 4YXHH 5KVDE 1V3JA 1YJDL 3MUZ1 3RB7A 2UWEB 3D07A 3E8UL 2NY0B 1DQJB 2ZOOA 4GH7B 2QVTA 1QZNA 4XT1C 1KCSL 1ZANL 1YEDA 1BZ7B 5KOVC 1QPKA 4UOQA 3NAAL 3P9MB 5EEYA 4JS7A 3QDGB 3AG2B 3FQXB 1JAEA 1P1ZA 2G5BB 3C75A 3M1BB 2YOCA 3BE1L 2WBXA 1QLEB 5HY9A 1FG2B 2FJHB 1R3JA 1X5IA 1YN7B 2YRBA 4H26A 2OW6A 5GGTL 4LCWB 3EFOB 4K3GA 4YNYB 2VITB 2EIDA 4F92B 5LWYH 5T1LA 5HDQH 4KRPC 1NCGA 2R29H 4FULA 4LRIC 3QIBB 5DA4A 3MNVB 3GK8H 4KRPD 3ZPDA 4TUOB 1CF8H 1FORL 5LJYH 3ZKMC 4MJHA 4UQEA 1ND0A 3EDJA 3VGFA 3S34L 4RAUB 3D7PA 4Y4FC 4NN7B 1U91A 1MF2L 3W0WE 1CN4A 3WJMA 1ILSA 2KQMA 1HI6A 4TNWF 4FQJL 3WLBA 4BFFA 5DT1H 4OLUL 2GBTA 5K69A 2VMCA 2AK4D 3ARBB 3IMWA 3MZGB 1MHCB 3LS5H 1DHKA 4KUZH 4OZFA 4PJBB 4Z5RB 4R0LC 4NM4H 2DEXX 5JTWA 4GQ9L 4P5TC 1QRNA 1F3DH 2VABA 5JIMA 1O0VA 3DX6A 5HHOA 1IFHL 1FBIL 4Y5VC 3SPGA 2Z8SA 1NIBA 2AQSA 3FFCB 2O6CA 3A21A 4K73A 3WEAA 1CICA 3P73B 4PJEA 4IRJC 4UT7H 5LXGL 4N2KA 4PWFA 1A1MB 4IRJD 1TF4A 5LGJB 5EORL 2TRYA 1UA3A 3HHSB 1SHSA 2DWXA 3UJTL 3BLBA 2BSSA 3RJQB 3PQYD 3FTWA 4QNPE 2V37A 3QWNA 1NIDA 5KSBB 5K9OA 2Z1PA 5AB9A 1A6AA 2B3RA 1ACXA 2X2IA 3KBFA 4I0PA 4Z0BL 1S7WA 3U7AA 2QPUA 1C1EH 2CH8A 2X4OA 3U83A 3G6AB 3KPSD 4UU9A 1SXCA 2EVFA 4P2OD 3V0JA 1CT8A 1W16A 1Y18A 2JH2A 5IW1A 2JJTA 2Y22A 1BVNT 1SXBA 2W9DL 5K9KB 3C8KA 3V4VA 4WFED 4XHQA 1JZ5A 4CUCA 2XV3A 4CRPA 1J1PL 1S46A 2EACA 4G59C 2FIKA 5HI3C 1F4WL 2DYPD 4HISA 5AQ0A 1TVDA 5FEBA 1BQKA 5CEZL 3RWEB 4BHUA 3IU4H 4DETA 4PRHA 3DSFH 4MNQB 4Z7UB 5G4NA 1LO3L 3RGVD 5PAZA 4KDTC 2EZ0C 4CMMA 5C09D 3AG3B 4DQAA 3JTSA 4XXWA 4UNVA 1U8HB 2J1WA 4LP8A 3SPCA 1MWAA 3WNMA 2B39A 3LS4L 2OQJA 5I15H 3SCMC 3MDJA 4R90H 4YHKL 4DTGL 3PJLA 4OCSL 4M93B 3E0GA 2FECI 3HCVB 4EN2A 4PM1A 3RKDC 2LLNA 1EXGA 4FAAB 5F7FA 1B0RA 3B2MA 5HVHC 3CFKB 2P4AB 4U1SB 3MCKB 3QNYB 1PIGA 3QO1A 3H7BB 3UZVA 5KVEL 3AMLA 1DJZA 3VFVA 2FHCA 4F33B 1YYMH 1XF4A 3TPUB 4ZSOA 2OMYA 5FKPA 4JDEB 2WTRA 1SHMA 1DQDH 2CK0L 3EGXA 4RISL 1EA9C 1L9SA 3C08L 4FC3E 4AJWA 2OULB 1C16A 4WHCA 5E2VL 5F7AA 1WD9A 5DUJA 4QRSA 5J13C 1BSIA 2X1XR 5IVXA 3WUWG 2QT6A 4BFOA 3O2DA 3T1FB 4K7FB 4GW5A 4KZEL 4XC1H 1DBKL 1QHPA 1E8YA 3NCXA 5D1QE 2E7CA 1MW2A 4Y8DC 5I0WA 3VSUA 3RRQA 4FFYA 1AP2A 1VACA 5IHBA 2R69A 3TEXA 4DF9A 4MCNA 3OKMA 1C5DA 3N41F 1MLCB 4PLOB 4JRYE 1ASOA 4ZMTA 2FHFA 3V5KB 1J8HB 2X4RB 5TGBA 5ANMA 4LPVA 1K4CA 2C3VB 2X44D 2V5TA 5I8EB 3OZ9L 3ZR5A 1R0AL 4WHYG 3GMQA 2CGZA 2V2WB 3PGFL 3QWQB 1RUQL 1OTTC 1Y0LA 4MD5A 1RZ7L 4K9EL 4L0ZA 3QXWA 4IRSB 4DAGL 1BJ1H 4JFTA 5CZXC 3S96A 2X6VA 2X4SA 1VCBC 4KUCF 3KW8A 3QEGH 3K4AA 4EZMA 1AHWC 1G7PA 3T8XA 4OUUA 1BYPA 4G72B 1FH5H 3ET9F 5E6ZA 2FD6L 1M71A 3ATBA 4AYFB 4NQDA 5L2JB 3CX2A 4X6DE 1N5YH 5E7FA 3BCDA 2ZQKA 3U0WL 1E4XL 4L48A 4TVPH 4FFWC 3VXRE 3RLSA 4F37F 2B1AH 1QRKA 4LVNB 3EYUL 2FZ3A 3FQNB 2A83A 3Q8AA 2WWNA 2GTZA 2W9EH 3L9RA 4LHUB 4WV1B 2WYHA 1NFIA 4NCDA 5HYJA 2JI3A 4A2LA 3LXAA 3KVQA 4WWKA 3NCBB 2ZXGA 4HCRA 4S11A 2DQEL 3LRSB 4NQVA 4YWGL 1E8WA 3T0EA 1JNHB 3QIWB 1UM4L 3G5YB 5ITFB 2DLFH 4XNBA 4D0CB 4GNKB 2CHZA 3BIKA 2HJKB 2HN7A 3NCJL 5BZDB 1NCTA 1QTYT 4HCFA 1YNTA 3AS1A 3F01A 4UQBA 1H3VA 1EEQA 2Z1KA 3FH5A 1Y7VA 4JZNB 1IFRA 4LMQI 4WNSA 3TN0B 1D9KA 5LCVH 4QF1A 4FQLH 3AM8A 4K8RC 4LLUA 2EXWD 4NQTA 3VFNB 5L2KB 3TBBA 2BH0A 1NEZB 3FN3A 2XN0A 4OD3H 1RUAL 1RZGB 5JORA 1CTMA 4G1EA 4F8TA 5FOBB 2WXNA 4FQCL 4Y2OB 3GC3A 4U3CA 1Z9PA 4P4RB 4A6YB 3DKHA 3HI6H 1QLEH 3QB7C 1BF8A 4X6BA 4OIIH 5GZOA 2X4PA 4XP4H 4PTTA 2AJSH 4YC2C 5ENWA 1QQDB 4IOIB 2JMRA 5KSAD 4TVPE 5L88H 1Q90A 4F2MA 4MX7B 1CFVH 1KB3A 3EHBB 4X0KB 2HLEB 2WLIA 4YBQC 1Q0YL 2WTPA 4IW4C 2JI1A 2FX7H 1A6UH 3WIIL 5E9DD 3VFWB 1DVZA 4PRPA 3INOA 2EE6A 2O5XL 4YO0B 5D7SH 5IVZA 2R56H 4OZGA 4X7DC 1Q1PA 1JZ6A 3K3QA 3U2SB 1WIUA 4OKDA 4K15A 4MLSA 3OAUL 3FF7A 4ZTOL 4FYQA 2CSPA 4TRPH 4DP8X 2NNXA 3E2HB 4NNYA 4W9IC 3TYFB 4D0BB 5SWSA 3AUVA 4I9XA 3TA3D 5DJZA 4EN3A 5IOKA 3B5GA 2UV3A 2E27H 1NLDL 4MS8D 3L7FA 4GT0A 4DJMA 2DBJA 4RMWA 3NN8A 1HOCA 4F7CB 2GB2A 1F8TL 4CC0A 1CF1A 3KYNB 1OGAB 1ZHNA 3HC0B 3P4OA 4Z95L 3BT2H 1HWHB 2PYEA 2DTSA 4LCWE 3NRQA 5CJBA 1HXYB 4K94H 5E00B 2XXFA 4PWEA 2I5YH 3TFKD 3BP7A 4AQAB 1SGKA 1VDGA 3S3JA 3ARUA 1V27A 3EJPA 1NL0H 1S7UB 2F7RA 1YC7A 2BERA 1LYQA 2JKTM 2R1YB 2E7HA 2Q3AA 5DHMC 2Q76A 5K1NA 1F6AA 4EUPA 1ZE3C 2I32A 1PQZB 2A9MH 2L3BA 4PRNB 2FDBP 3T04D 5ELIA 3OKDB 5FYLD 5HHQB 1KXQA 1ZPLA 2AXJA 3ATDA 3BUQA 4MJJA 2A0LC 2B20A 4L05A 3CLEL 5JHLH 2A0LD 1EEYA 1G0YR 3QSKB 4H5SB 2XICA 1HWGB 1RURL 5EOTA 4YFLF 1PZAA 4NGHL 5I0VA 2WC7A 3HRZC 2Z4QB 3VRJA 2VXQH 2XN9A 3O6LL 4CADB 1S7XA 5AD0A 4J39A 2BZDA 2IXQA 3MLTA 1JI1A 4MNGB 1WQVT 3H53A 5DD0H 5BZZA 3ELQA 1WF5A 3QUXA 1VCAA 2ZXWB 2WP3T 5LBSL 5HTSA 2QFPA 4Z1PA 3EIFA 2ZOUA 4XC3L 3NJGA 4M7LH 2DM3A 4XP9H 3VXSB 2VDOB 4TUUA 2EH7H 3ORJA 2EVIA 5EC1A 4NQCA 1N0LA 1IVTA 1FFTB 2R9HD 3CHOA 2K6YA 4CSPA 1BLNA 3VO0A 4ZUWA 5I23A 2Y1YA 5AVTB 3BZ4B 3PABA 4HWEL 1UXSB 2AJZB 2NQ3A 2HX8A 3POCA 2ENYA 4NUMA 1AMYA 3UTSB 4J2XA 1NGPL 4GJTB 3HE7A 5EU6D 3WFHB 2VISB 2YD9A 5C08D 4R4FL 4XPAL 2EEXA 4A38A 1RUPH 1I9JH 4PHZA 4QWWD 4ZQKA 2WOYA 3QUHA 4K2UH 4W9ZA 1SF5A 1YEGL 3DVGB 5C0CD 1KV7A 3ILPA 3O6KL 2M2DA 4S2SB 5H4ZA 3IVKA 4MNQE 3P2DA 3ZTNL 1CTOA 1GR7A 3LSOA 2BCMA 3F7VB 5IEKB 5J7CC 1GYAA 3O9WB 4ANWA 3X12B 2A9NH 1FE8L 2BDNH 4R0LB 5DFVD 2WBJB 4F7PB 3UAEA 2N56A 2VM4A 4FQXD 5GJTH 2QGCA 2AXWA 1TJHH 2A6DB 3B2UC 3JV5A 1QR1A 4PV1C 1UC6A 1FGNH 3IFPA 3ZE2B 2ESVA 2EXTA 1E90A 1LL1A 4O9HH 1YEHL 3MXWH 1DL7H 4I2XB 4RAHA 1T04B 3V55A 3OPUA 1S78C 4ABQA 4QHKI 43CAB 2H26B 3ZYJA 1D6EB 5I0XA 2R27A 2NLJA 3MPCA 2EYTA 2QZ5A 1N18A 2JJWA 2WXQA 4YSPA 3VFTA 4FNPA 1D9KC 3F12A 5AW1B 2ARJB 5H94B 3TWCL 4JM4L 4M43H 1OSPH 3D05A 3SOTA 1ADQL 3DTUB 4ZMYA 3CFUA 3WGUB 2PCFB 4LSTL 1ZVSA 5IK3A 3TJHD 1DN0A 1B2WH 1WT5A 4FA6A 1ZT7A 4ZMOA 4FFZL 4GSQA 1BD2A 1F3RB 4HS6B 2B9BA 5I1LA 3HMWH 1MCEA 3ETSA 3GMOB 3DXAB 2QKIA 3H2WA 2Q1EA 3L5XL 4PSRA 4R97C 2WYZA 2DQDL 4Z6AT 3ZE2F 2CBQA 4H0IA 4ETQA 2OMWB 3CFJB 1MFDH 4TNWK 4JR9L 1VPOH 5GSVA 1J8HE 1U8IB 2X2HA 4LRNL 5GISL 1DQQB 4XHJC 1CCZA 4OU3A 1IC1A 3HBZA 4R5XA 3DSNA 4AXWB 3QYNA 4N8VG 2APTA 4GG6B 1NDTA 4O02A 2E0PA 3SQBB 3TA4D 6TAAA 3SGKA 2HG5B 3EYSH 3O0RL 3SCMB 2GJ6D 1WEJH 3MV8A 3ZUNC 4A6YH 4H1LG 1BAFL 3OAYH 4MLIA 3BPNC 2G30A 3FUEA 3ULSA 4RAVB 4DP7X 2KH2B 7FABH 1OTUC 3COOA 3SGDI 3BFQG 1IFGA 3B83A 3NK3A 3NK4A 1MCPL 1HSAB 4NHUB 1MFEH 1S7VA 1BEXA 1UEYA 5KYUA 1I3UA 2DLIA 1NCCL 3CFQA 4WO4C 4KY1L 3CZFB 4OY9A 4FLSA 2GIXA 4OFPA 1XIWD 3VXOA 1KTLB 4OGQC 2Z93B 3QHZL 5J13B 1T1XB 1FG9C 1QUPA 3SKUD 2Y7SA 2XWJA 4MDJB 4OSUH 2WCPA 4KI5F 2APSA 5I1CL 2K78A 1IM3A 1EDYA 5J06A 4QRPE 1VLXA 1HC1A 1WLHA 3TEWA 3IDMB 4BUGA 4GG6F 3IBOA 1HK6A 5AYUH 5E4EC 2MNJB 3PXJA 2YPVL 5HHVL 4HUXA 4R8WH 3X11A 4EOWL 3DUUA 3T0VA 2EUWA 4Z7QB 1KY6A 4XO9A 1D5XB 4XX5A 5EZOL 3SYPA 5I0YA 5L2KE 4WWID 4PGBA 4B0MB 1IKNC 4C59B 4QRQA 4R83A 1SQ2N 5LDUA 2NXZB 1F13A 4JRXD 2R7EA 1PNDA 4F8LA 5AZEH 1XD1A 3EG9B 3NCWA 4LL9A 1E6JH 5DRWB 2KZWA 5DMJB 4M4RA 3CSPA 5AVQB 5EOQH 2DF3A 1I82A 2F5AL 1MCQA 3QUXC 1LDPL 4GP4B 4LLVA 4H0HB 4ZNCD 1HEHC 3LPGA 1BREA 2BOLA 2WXJA 4EI6A 3H9YA 3KEDA 3LMJH 3CSTA 3IFLL 4QRBA 4U1JA 2ZXAA 2VDRB 3LQAL 2ICEA 3HW7A 5LNGA 4NKQB 3W3BA 5A2FA 2NW2A 1ADWA 3UTTE 1P1ZB 2WQAA 4A7VA 4B9ZA 5HY9B 1MVFA 1GGIL 1R3JB 3AU0A 4Z7QF 4H26B 1IQWH 1U41A 3FT9A 5DHXB 4V2CB 1RZIA 5T1LB 2FAUA 3C60C 3HE7C 1GZPA 3RGBA 1MIMH 1BM3L 4TPRL 1WV7T 3UP1A 4WVRA 5GZNA 3GRGA 4U2YA 3BGAA 1RSYA 3O4LB 3FUDA 1ND0B 2AXHA 3UTQB 4F9PA 4PGCA 1U91B 1XCQA 3QISA 3WJMB 2RBLA 1ZK5A 3V6FA 1MCWM 2NNAA 3WLBB 1R5IA 2W80C 4JGJA 3K2UL 4JY6A 4PB0H 2BVPA 4QI3A 5LO7A 3T6ZA 3UZQA 1SHXA 2R0ZH 3LRKA 5DQDH 1OGAE 3UBXA 3SOBL 1OSZA 4NC1C 1EMTH 1Z5YD 3V5DB 1ESOA 1ANUA 2I7OA 4Y7OC 4U1HA 3AXLA 3GHBH 5DJXA 2LT9A 2VABB 1JGEB 1NCIA 3DX6B 5HHOB 5LGKA 4APQD 2DL9A 4ONFH 5DD3H 1QAWA 3I84A 4XPGL 3LPFA 1EK3A 2FYYA 1YNKH 3TONA 1D2OA 4F7MA 3WXVL 4N9OB 1SMAA 3VH8A 4PJEB 4XCFL 4Y5XC 5D1QD 2K1MA 3IRPX 4YC2B 2BHUA 1S5HA 2D2OA 4UV7H 5HGDA 5DDHB 5E1GA 2L8AA 3OKLA 1WZMA 4QYOA 3ZL1A 2CMRH 4LEEA 2JKWA 5IG7A 3BLPX 3BX7C 2BSSB 3BSHA 1AQDB 2A1WH 3CD4A 4GIOA 4RSVA 1RHHA 4JRYD 4FXKC 5K9OB 1ZHKA 3H6JA 1A6AB 5GRVK 5K59F 5AAPA 1WA1X 4F37K 4XOCA 4YMPA 4PWIA 2A74A 1OARL 1YYLL 4I0PB 4BSVA 1CO1A 1RK7A 3VXQA 2X4OB 3ZSTA 2L7EA 2PCPB 4PQXA 1BXVA 5CD5C 1U4EA 4UU9B 5JW4N 5IW1B 4HFWA 4CJ0A 4CVWA 4HMDA 1JIBA 2VIRA 2NYZA 4XCYA 3LPWA 3C8KB 1GS6X 2XKUA 2YHGA 4JFVA 4MNGE 3T2NL 3V4VB 5T3ZE 4FHJA 1PY4A 1MFBH 4Y1TA 2H3KA 5IMKB 2PXYD 2QKIC 2YARA 2FIKB 3LHPL 3RWIA 4XN7A 3LRGA 2QGDA 4U6VL 4UILH 2J20A 2UYLA 3DETD 1OWWA 5A2AA 1AR2A 4H88H 4MAYD 3FTGA 3VFPA 3VXRD 3B7TA 3FUMA 1I1FA 4K7PX 4YUEL 1T1WA 2IC2A 4G8GD 4KI1A 1B4RA 4ES8A 1JPSH 1G9EA 3HOGA 3JTSB 1A6ZA 4QXWA 1LE9B 4UI2A 4B97A 4JN1H 1MWAB 4LVHB 1CE6A 1N67A 1AGCA 2CQVA 3UTSE 3VGDA 2OQJB 4ZI8A 3MQIA 5KVMC 4ZD3H 5LGYA 1THCA 2VR7A 5C0BA 1DBJL 1CFTA 4L4JA 1H0DA 2NR6D 1INEL 3KBHE 3O4OC 1IARB 5LBVA 1LTXA 3KWWB 4FF9A 1AQKL 4M8UA 1S7SA 1B0RB 2A6IB 5HGGS 4IBYA 3QO1B 3RVWC 3BUYA 2BSTA 4OQTA 4AUJA 3UZVB 3GI9H 1U21A 4M7KH 3K5RA 3VFVB 1XF4B 2PR9A 3FMGL 1HDMB 2IAMC 2OMYB 3EJTA 5FKPB 5TE7L 4KVNL 3JT0A 4KQ4H 2WTRB 2HTLC 3IAPA 5E1AB 2R2EA 5T1MA 3GSVA 3MVSA 4GI9A 1C16B 5F7EH 1WS7A 2BZ7A 4MHHG 1G7LB 1U9KA 3ZE2E 5HPMA 3GRWH 5IWLA 3MFGB 3RZCC 1QNZH 2ZOWA 2E8YA 4XPBH 2ZG1A 3RZCD 1SYVA 4GW5B 2HFGL 4WKXA 4ELDA 1HL9A 1MOEA 1UJ3C 4P59L 5C2BL 4I2XE 1JDCA 4RX4A 5ICYA 1GPOH 3K91A 3PWLA 3SKJH 3UCQA 5DMIL 5ADOH 2Q2EB 4NWUL 4TLSA 1AP2B 3OAYK 3D6GA 2HJFA 3QC5X 5D2NE 4DFIA 3CBJB 3OKMB 1IQDA 4Q6IA 2WXOA 4WTWA 3TGXA 4MXVE 5IQOA 1ZLDA 2GAZA 5ANMB 1K4CB 1IGYA 1SY6H 3V0WH 4XWGL 3QAZC 2VMEA 4BIKA 1FFQA 2VN7A 4FOMA 3KWTA 3BEVB 3HC4L 1MJ7H 2XPZA 3FL7A 3QUZA 4GKLA 1Y0LB 4MD5B 3ZMRA 3S96B 5GPRA 3DROB 3FBKA 3V6OE 3K6OA 4KHTL 4R96A 3DXAE 3T8XB 1D5IH 3PPSA 4OUUB 5F72S 4FERA 1ED3B 3MRHA 4JG9A 1DBBL 4Y1AB 1M71B 2ZKHH 4NQDB 1A7BA 2AGJL 2OK0L 5IVXF 4D3CH 1INDH 5TH2A 1FYTA 3BFWA 4C56A 4DO5A 2VN6A 4WF7A 1MG2C 4Z3JA 4HYTB 2KPNA 5TF0A 2FZ3B 2A83B 3II2A 4GG6E 3L9RB 4NKIL 5EU7E 3HE6A 4P4KA 1NFIB 5HYJB 1CJYA 3I9PA 5DK3A 5IVOA 1I8KA 2YFNA 1FLRH 1IAIL 1EUTA 4FYSA 3I02B 3QIBD 1M7DA 4NQVB 4G7VH 4ONGH 4ZFOB 3QPQD 5DUPL 3UGUA 2B15A 4UWQB 3D2UB 3JTTA 1M42A 2HN7B 2OX5A 3FSVA 4LIQH 3D85A 3ARBD 3HFML 4NUJA 4EJ1C 5FF6A 3K1KC 3NA9L 1YNTB 5DZAA 3OQRA 5AVXB 2CR3A 1D6VL 1D9KB 4BQBA 3ZQXA 4LLUB 4MKTA 2CO7A 3S88L 2ODIA 5JR1L 3P9WB 2VDRH 1S8DA 3WY4A 1VFAB 2HA1A 3F5WA 3FS9A 3Q2NA 4MJIA 5C6PB 3BT0A 5JORB 3NIFF 2VZ3A 4YSUA 4LAQH 1NGWA 1DSFL 1OPOA 3OWEA 3E9UA 2I27N 2H0FA 3A6BL 3EXLA 4TMPA 2FO1A 4XBEL 4HXAL 4X6BB 3KJ4C 5E1QA 5C6WH 1CLZL 3V0DA 4A2FA 2X4PB 4GSDL 4PP1D 4Y4HC 1S3KL 4PTTB 1KELH 3MRPB 4YGVA 5HDRA 3S5LA 5ENWB 3WY3A 4AGOA 4I7ZC 1FL5A 1HSBA 2ICES 1UWGL 2DQ6A 1SXNA 3E9TA 1CLCA 1KFAL 4JMNA 4Z7QE 4M9OA 2H6UA 4L4TA 4F2MB 2ZX9A 1JXKA 2E7MA 4JCMA 2FLRT 3DGCR 4H25B 3I9IA 1T5WA 2Q0ZX 4WRLA 1BVOA 3FO0L 4NBYB 3B56A 4K8RH 1XH1A 3U4AA 4ZX3A 4PJ9C 1YNTF 3M86A 4JDTL 2WLKA 4PRPB 2VSKB 5IVZB 3KPQA 4OZGB 5KBPA 5DJAA 2ZAGA 5KYYA 4EZLA 1U95A 1CG9A 2F5BL 4LIQE 4M5ZL 4QCIA 3SYQA 3X14A 3GDCA 3S8WA 3BHBA 3RL1A 3BPNB 3TT3H 2Y69B 4BCYA 4HHGA 4NNYB 2H2SD 2OBGA 3POHA 4JG0H 4A68A 5AB0A 4X9FA 5DJ6A 5DJZB 2D3NA 1I9EA 4MNQD 3QQ3A 2HRPL 3KDMB 3L7FB 3LNGA 3V0EA 5IESL 4ZS6D 2DMGA 4HEMA 3NN8B 1PJWA 5LAPA 3DTDA 2CRYA 3H56A 4WO4B 1QNIA 4ZXBC 1X5AA 1UXLA 3WSQL 3K81A 1E40A 2EJ1A 5B4MC 1OWRM 2B16A 4ZTPL 1WWCA 4I77L 4OR1A 4ZXBD 1ZHNB 3P4OB 4FS0A 3LZQA 3K80A 4KZDL 3BEWA 3FCBA 4OQ1A 3KR3L 1S9YB 3PP4L 4P3WA 3BP7B 3SYOA 3TV3L 2FATL 2VLRA 2ZTBA 4OJYA 3QVAA 3JBG7 5B1CA 4XPTL 4ISVA 3PWJB 4OZHA 5DHEA 1X7QA 1DLFL 5K59E 1S9WB 5FHBL 3V4VH 1UXWA 1JFHA 4LLMA 4OJFH 3FUHA 2NDGA 2Q76B 4HWZA 3SKOA 1F6AB 1UYWH 2H7WA 4N85A 4OZGF 4EUPB 2I85A 2C4FU 5D93C 1ASPA 2BWDA 4OCNC 4ZDHA 3K4DA 4KUCD 3BESR 1G6RL 1EVTC 4HAKA 1MRDL 5CZKA 2EDTA 1CYGA 3OR6A 3HKFA 1D2PA 4PI0A 3UACA 1BF5A 5CNHA 5TE6H 1BVKA 1ACYH 2DWEA 2RMNA 2Y7OA 1JZIA 4L8CA 5EOTB 3IGUA 5HHOE 3LHAA 5HYSG 2M83A 1NOFA 3RB5A 3MODL 3BVNA 2X70A 4PREB 3RDTA 3VRJB 3F6IA 4WWPA 5JUEL 2XN9B 5AD0B 5KJRL 1S7XB 4PJEE 4CBZA 1X5JA 5DI8A 3K74B 4LCCA 3W38A 1E28A 4P05A 3HFFA 3PHQA 3QUXB 4JG1H 4AL8C 2JCCB 3I75B 4JN2B 3C5SA 1C5BH 3Q8BA 2V3DA 1JPTL 1KT2A 4UDUA 1KBGL 5D9SB 2CE6A 1E6OH 3NFPA 4CMHC 1J8HD 5EC1B 4NQCB 5FYKE 1N0LB 3JWOL 4NUGL 1TOXA 1M3IA 3HR5A 1BLNB 4ZUWB 4HJGA 4JFEA 1P4UA 2E6JA 4DN3H 4LE8A 1NLBH 4KC3B 5AAMC 1NGQL 4K5LA 2GG1A 2P5WD 3PGDA 5E2TH 5C9JA 4KWUA 3C60B 3HE7B 4PP2B 1XZ0B 2ZUXA 1O7DC 1YEJH 4RGOH 2BFGA 4ZQKB 1LQSR 3S3BB 4GINA 3EJCA 3VFSA 3GKWL 1A65A 1NC4A 5E95B 1PBYA 3ILPB 5B1JA 3U0PA 1C08A 2XPGA 4NIKB 3VI3A 1IKFL 3AS0A 5D7KE 2WZPA 1ZT1A 1F6FB 3ECUA 4FFYH 2Y07H 2R69H 3LSOB 1UH3A 4NWTL 5F9OH 4OF7A 1FZJA 1IM9B 1TZAA 2AV1A 3RY5A 3TEUA 4LHUD 3ZKQD 1E5BA 2AEWA 1MFVA 4MJ5A 3GLEA 1CPUA 5HGBA 1G7QA 4O58L 4U1MA 2BVQA 3QZWA 4BUQA 4RMTA 4PMFA 4DVBA 1QR1B 3QIWD 4RRPG 3S48A 2WNKA 4WW2A 2VXUH 3FYIB 4QRPD 4ZMWA 1U42A 3C5ZA 2XWEA 4R2GC 4PCSA 1ZDSA 3FT4A 4Y5XB 1W2KT 5E99L 1RJZA 3FU6A 2DQCL 3REVB 3B6SB 1MZZA 1A02N 2EYTB 1K2DB 4YXHL 1IU1A 4U7MA 4JKNA 3S97C 4ZSOE 3VFTB 1AC6A 1N3NA 4FXKB 3RPIB 3F12B 3K6DA 2ED8A 2OMUA 5KZCB 3RFZA 3Q6GH 4U1GB 4GI6A 1JHLH 4KMTH 2EDLA 4IGBC 3L3DB 3Q44A 4XVOA 1MY5A 4ZPVA 5IK3B 1ZVSB 2N1KA 4IGBD 5IROD 4WENB 4PG2A 1TNMA 1DN0B 1ZIAA 3TCTA 1ZT7B 4Q74A 4BZ1A 3UFIA 3QE5A 4HQQL 4PRID 2IVFC 1BD2B 3BPCA 3F3HA 4GRLC 4R7LA 3W56A 5I1LB 2E74C 5F21B 1KJVA 2QKIB 4LVOC 5J56B 1MQKH 3OJMB 1UKTA 5E94A 5HDQL 3EHBD 4ETQB 4AITA 2R29L 1IBYA 3HEIB 2YAHA 1AZCA 1OGTA 1BFVH 3GK8L 1CF8L 3NZ8B 4I13B 3R7QA 5DU7A 3MKKA 5ANME 1XEUA 2Y5TA 4XPFH 3T4YB 5H37G 4BE6A 3UTTD 2NYYC 4N8CH 1KLUA 3QEQA 3QQ4A 2PKDA 4HGMA 4HWNA 4O02B 1HHHA 3LS5L 4KUZL 3BZEA 4AQZA 4NM4L 5GRUL 1FN4A 3O4OB 2FB4H 1PLGH 2JNZA 5KYWA 3NYKA 3TBCA 1J88A 1J86A 3OF6A 3SJVD 4NQDE 1JCKA 3ULSB 5HVWA 1SLWA 2D7NA 3NIFE 4JRFA 4ABVA 4JKPL 2WXKA 3JVGC 3LNIA 3BIAX 2HUEA 3F8UB 1OD7A 4UT7L 5DFWH 4XBMA 5KYUB 1MCHA 3UG4A 1GY1A 1OAQH 3PUUA 2VUYA 4HIXH 4TL4A 1J11A 2W95A 1XTLA 4OFYA 2WLJA 5HYJE 3EDDA 5K1JA 4G9DA 3B5HA 1C7SA 3PLYA 4A7SA 3IJEA 2XWJB 3EYOA 4MD0B 3L6FA 1XR9A 5GRJL 4YSSA 4JFDB 3ZT7A 4YK4C 5JMRA 5JA9A 5C0ND 1IM3B 1YDPA 2VAJA 4XN9A 5J8OA 2YKLH 1C1EL 2YD0A 5IM7B 3IK2A 3DWTA 2HXAA 2NY4C 2X4QA 2XQ0A 3GXMA 3PFQA 2AF2A 4MMYA 5BVJA 2A9DA 5FA4A 5GRWA 3QJUB 4HUXB 3X11B 3E3QC 3DUUB 1HXMA 3CZJA 4PB9L 5B39B 5DEJA 3WHXA 5EULV 4LSQL 5CSGA 3CXDH 2ERJC 4PGBB 2K6ZA 5D1XA 4KGLA 4HVBA 1NMAH 3QAZB 3IU4L 3RU8H 2ICWJ 1G7MA 3N40F 2R7EB 3DSFL 5JNYA 3V4UH 1B6DA 4HSAC 2J72A 3U25A 3CHSA 1NGYA 1SEBA 3MBXH 3VXUA 3X1NA 5CCKH 1Z3RA 5T3ZD 6FABH 2OL3B 4M4RB 3PIQA 3II1A 2GBVA 4IYKA 1E42A 5ECGA 3AB0C 4HOWA 4ZOBA 5C8JB 4XXCA 5I15L 2OTPA 2W91A 3MJWA 3OWRA 4LLVB 2WK2A 4R90L 3WNJA 5GS1A 2H41A 1P84K 2J1YA 4F2ME 4EI6B 4D2NA 4A7QA 3IMUA 1I7RB 2CIIA 4AIOA 4U1JB 2Z31D 4GKZA 3GHPA 4MYWB 2JFCA 3MV01 3HZVA 1X9UA 1R5VA 1ORSA 5HYQA 4G82A 3GMRA 1FH2A 3EZ8A 1XR8A 4HFUH 4PRPE 3UTSD 1U8NB 3VXPB 1YYML 1PY0A 3MGAA 4OZGE 3MRCA 4HS8H 3TASA 3PGCB 1RZIB 2K4AA 1WVZA 3OTTA 4XOEA 2WSDA 1HYRC 5DZNA 4L23A 4P5KB 3KZ8A 5SWZA 2ZX7A 5SWSE 1CWVA 2BIMA 1WSST 5E0FA 3CFEA 4RBPH 4AIZA 3UTOA 1XCQB 4CAGA 2WINA 2NY3C 3O9WD 1KN4H 2NNAB 5LVEA 1R5IB 4JY6B 3IJSB 2BVPB 5IFHH 2COVD 2PPAA 2WBJD 3K0WA 2FECL 4S10A 4FJ6A 8FABA 5DWUH 1OSZB 4D8OA 1Q9KB 4JO5A 1HT6A 4YHNB 3FH8A 4I9WE 3T0WA 3KCPA 3WGVB 2YKKA 4U1HB 5DJXB 2CDGA 2D3JA 3B9KA 2XTJC 4LOUD 3OG6B 1XGYH 2J21A 3EJYC 3N50A 1CE1H 2WP3O 3LOWA 2XTJD 4F91B 1CFNA 4PIBA 4JFPB 1S7QB 2FYYB 3KJ4B 4OCRH 1UKSA 4F7MB 1XF3A 5DJ2A 4GAAA 1F4YH 1WA0X 3NEXA 4Y4HB 1W0VA 3VH8B 3D48R 2P8PB 4EI0A 4PJIB 1HYSC 2AEPH 5MI0C 3AMKA 3IMSA 4QYOB 1KXQE 3QEGL 2LR4A 2OSWA 5ILTH 2IF7A 1RHHB 1CVSC 1ZHKB 4JZJA 5FM5M 1QI4A 2TSAA 3Q8CA 4ZJ9A 5C0FA 1E8ZA 2A74B 1DEDA 3EYQC 4LCIL 3QQXA 3VXQB 3ZDZB 4BSVB 1N5YL 3UYRL 1O9WA 4B96A 1REIA 1FAIH 2WMPB 4TVPL 4HFWB 2XN9E 2FJUB 4LP4A 2B1AL 2VIRB 4XCYB 2NSXA 3GUTA 4YHIA 2G2PA 5EO0B 3DXAD 4MMZA 4K7PH 5F1KC 2BWQA 5H35A 2JCCE 4OIAA 1MCCA 3MLSH 3RWIB 1ONQA 1CXIA 1X9QA 5G5DA 1AO7A 5IMMB 5BW7A 2FNBA 1PTZA 2UYLB 3RBSA 4J23A 4KI5D 3SO5A 4NQCE 5FA3A 2DLFL 2C26A 5L0QC 3SZKC 5DK2A 1SOQA 4NAQA 3IFNL 5ICZB 1T1WB 5LGHL 1L9QA 4OF0A 1I1CA 3BAXA 1A6ZB 2J44A 2Q5BA 3L8QA 2Q3ZA 3MNMA 2RH0A 2IPKB 3SE8H 1CE6B 2KYIA 1AGCB 5LCVL 4YEFA 1ZRUA 4FQLL 3LPOA 2DZEA 3QORD 5JMOC 3IB4A 2WWKT 2D31A 4WHDA 5C0BB 1CFTB 4Y19D 1H0DB 2XKNA 3AGWA 3E1F1 4OD3L 3ZDZF 1R3IL 1WTGT 3WAJA 5I1EH 1JV5A 3KPOA 5T1KA 1S7SB 3TBVA 1ZKAA 3HI6L 3UO8B 1QLEL 1F90L 2DQGL 2X4NB 3QJOA 2BSTB 4OIIL 4B50A 5D93B 2KDGA 4XP4L 1TQSA 4UF7C 5E5MA 2AJSL 2XA8H 4LEXH 4BJLA 4HZ1A 4U0QB 1H6EA 1EBAA 3KHQA 1FO0A 2R2EB 3GSVB 2RD0A 4LDLB 5L88L 1OAUH 1CFVL 1FF5A 4YH6A 4HBCH 1AGEA 1CU4H 3MLXH 1E4HA 4KKLD 2ESVE 2VLJD 1YY9D 5KEZA 1QI5A 1RULH 4DPBX 4O02H 2FX7L 1CZ8H 2YD4A 3P11L 3BFOA 1UENA 2J6EH 5D7SL 2LTQB 4UDTA 5ICYB 2R56L 5SV3A 4TUKH 5KBDA 2WKGA 4UV4H 5KAQG 1FVDB 3IDUA 3U7YH 1DJHA 3S5ZA 4BRVA 3ARFA 4YDLC 4CMHB 2HJFB 2OMVA 5IW6A 3MUJA 3N85H 1FHNA 4OZ4A 4EI5A 2ADIA 4TRPL 5AVZB 1E9QA 2LOEA 2UZYA 4C83A 4Q6IB 4ZX6A 1YN6A 2O61B 3F84A 3CDCA 2BS8A 4LU5L 3MKGA 4GY4A 4LLYA 2CRMA 2A2QT 3H9ZA 3ARGA 2PCYA 2VE6A 3QUZB 1N5AA 4BXSV 3LZOA 5BUAA 1BD2E 3EOTH 3KPLA 1A7RL 3TO2A 4W9CC 2ZWSA 4MZRA 4R96B 2BXYA 4PJDA 5EU5A 3MRKB 2FLBT 5EO9A 3BZ5A 3VSVA 1UT1A 1SXAA 1DVYA 2I5YL 2L0DA 4AT6A 1T89A 2AW2A 4EIUA 2EINB 1TYJA 3TIEA 1NL0L 1CD1B 4OV5A 1KGCD 2OXGB 1A2YA 3B8YA 5TH2B 5KSVA 1DQKA 2DQTH 1XGZA 1UD3A 2ZP9A 1ID2A 5HHNA 3TVMC 1I8LC 2MNWA 1QABA 2V33A 2EXYC 5F6HJ 3WY1A 5DHVA 3AT8A 2A9ML 1I85A 1P4BH 3GUFA 5GGSA 2WWOA 3HE6B 4P4KB 3T4AC 4N6QA 1BQHA 1T7WA 2L7JA 5T1LD 1I8KB 3VWKA 2EDDA 1A3QA 3MV8E 3SY0A 5JHLL 4F7EB 2F54A 1DJSA 1M7DB 2Y72A 1XBRA 1JPFA 2X2JA 1DEEA 3TIDA 2OL3H 4YHMH 4HV8A 4UZGA 3JTTB 2B77A 4HJIA 1U3HA 2OX5B 4FQHA 3U36A 5G4MA 2VXQL 2DM2A 1EVUA 1OHZA 3D85B 1QFUH 5FF6B 5C7XH 5I6MA 3AREA 3QUYA 5DD0L 1OKEA 4X4ZA 4TF4A 2F15A 3B9EA 2R8SL 3AS2A 1U3NA 5IJBC 2QELA 4P46A 3WNOA 1JYWA 2CO7B 2HKAA 1QRND 3F5WB 4MJIB 1MFAL 4MDIB 3SE9L 5FB8A 3B37A 1MCKA 4TNEA 1KG0A 4YHOH 5AYQA 2WNGA 1FZKA 2FH8A 4X6EA 1CICD 4XE0A 2IAAC 3QXUA 1A1NA 3D0LA 3PWPD 4GRLB 4Q14A 3QJZA 4N90D 1JS4A 3NFSH 5L9DH 3APNA 1YZZA 4FLHA 4YGVB 3S5LB 3V4PA 5CILH 3QDJB 3BP5B 4LVOB 1FL5B 1OGSA 1RERA 3MA7A 3QUMA 5TE4H 1WBYA 2X9WA 2ZXQA 1ZVNA 4D9QE 1X6NA 1WC7A 4MXWH 4WO0A 3D9AH 3T6QC 4L4TB 4F3FA 1KACB 1RUPL 1I9JL 1X4XA 2PWEA 2H6OA 2I26N 3L45A 4NQSB 2H5UA 2P8LB 3T6XA 5FYKD 3N40P 4F27A 4KNUA 1XHHA 3NJJA 2XQBL 4K2UL 3D0VB 1T5WB 3BN9D 3R0NA 1LO4H 2VTFA 4PJAB 3QJXA 4RMSA 2B2XH 4ZW3A 2CR0A 2CBPA 4QRFA 4FADA 3NP4A 1QWUA 2A9NL 5DJAB 4TQIA 2BDNL 1I9IH 5AWNH 5KYYB 1U95B 2WAQA 4E42A 3X14B 1HILA 1TJXA 5DMGD 4J3WA 5GJTL 4DNLA 3BHBB 4BFEA 4PUBL 1TJHL 4QRTB 5DGRA 2YRLA 4NZUH 1FGNL 1TIUA 1KGIA 2BMKA 5DJ6B 4PRHD 3RHWF 3VWJA 4NZTH 3QQ3B 4MCYA 1P5UC 5LNEA 4CL7A 4O9HL 3O2WH 1DL7L 1WRFA 5F97E 4JFSA 4B9IA 4HUMB 5DS2A 3CSYA 1R4XA 4L3AA 2PWDA 3MRIA 1EGJH 2GK2A 3BEWB 1BHGA 1QUNB 3O3DA 4JKWA 4LEOA 4C58B 1FLTX 1IO4C 4JQIL 4LDEB 1CXHA 4P0DA 3MC0A 2VLRB 3UAAA 1OSPL 2J5LC 3JUYA 5D2LB 5IFJB 4ISVB 1X7QB 3K0YA 4AYSA 2NY4B 4XGZA 1BBJA 1UD6A 3BAWA 1B2WL 4HWZB 3SKOB 3DIFA 4JM2A 2HRLA 1IV8A 3QP3A 5CCHE 3HMWL 4OI7A 1G1KA 3CBKB 4N2OA 4ZDHB 3HNTH 5F89A 1CLOL 5FIEA 2VR4A 4YJZL 5ETUA 2VRAA 3OR6B 2ERJB 2JTYA 1LNUB 2R39A 3D8MA 1MN4A 4YHZH 3Q2VA 2DWEB 2CBTA 5EO1A 3HLKA 1MXDA 1RJYA 5JYMA 1VPOL 1QR4A 4NOBA 3KJ6L 1QPXA 3GIZH 4MQ7B 4TN9A 1N26A 3BVNB 2X70B 2G60H 5BRQA 3RDTB 3D09A 4UAHA 5AKRA 3G6DH 5JOFA 4J4PC 5DI8B 3L95B 1E28B 4MRBA 3PHQB 1GA2A 3AB0B 2PP7A 1NUDA 2VQ1B 3VXMA 5D7LA 4FFZA 3MACH 3CDGA 3EYSL 2FTAA 2VR5A 4HK3J 1WEJL 2VJ8A 3ARTA 3HHMA 3MBWB 1GKOA 3ISWA 2CK2A 1KT2B 3WDJA 4A6YL 2EKJA 1U8LA 4UDUB 4OZHF 4E41A 2P5EA 4F8NA 3S9DB 2WB1A 4OQTH 1KMGA 1ETJA 2FWLB 3ZDZE 3DI3B 1XDTT 1NMBH 4JO8A 3HR5B 1WWWX 4PGDA 2NUTA 4HJGB 4JFEB 3DX7B 5GGVY 5LDSA 1MFEL 2YPLB 4KDVA 4HP5A 3LKQA 1IKOP 4TNGA 5AAWA 3DK0A 1DQMH 3QPXH 5EDSA 2JK5B 3FZUC 5HSFA 5L8JB 3IDJA 4UNIA 5EZIH 5SV4A 2HJLA 4NQDD 4KQ3L 2AQTA 3GXIA 4I3RH 4OSUL 4MAZA 4PJ6A 4AL8H 1NC4B 5C07B 1OM9A 4NRXA 1C08B 2XPGB 1K8IB 2V8MA 4FI8A 3VI3B 1MHPH 3MOBL 2NY3B 5FUCE 3NDYE 1FL6B 1ZT1B 4RA0C 1EHNA 3FFDB 1J5IA 2J6WA 4N68A 3PAUA 5AYUL 4OD1H 2AV1B 4TYUA 1JZ7A 3HG1D 4Y9CA 3C5JA 4R8WL 1NFDA 4UOW1 4D9RE 5FLUA 2AJVH 1ZLVH 3FO2B 5LN4A 3VD2A 3WOVA 4WWKD 2P7TB 1W0WA 1G7QB 2X87A 2ZYHA 3GBLA 4U1MB 5C0BE 3QZWB 5C0DA 3T0ED 4DVBB 5J1AB 1KULA 4YQXH 1KEMH 2IDUA 2YAEA 2GCYA 3LRLA 3C5ZB 5D4IA 3FRUA 2APBA 2VUOA 4RDBA 1E4WH 4PY8J 1RJZB 5AZEL 2GSIA 1E6JL 4UT6H 3UZEA 3SQRA 3VXTA 1BMZA 3I3EA 4FHBD 4HG4J 4ZW8A 3ZKXB 4UM9A 3GZOA 5EOQL 1N3NB 3P9LB 2VL4A 3TLRA 2OMUB 4L8BA 3RFZB 1KV3A 5AZ2H 3G7TA 1GMEA 4YZWA 3LMJL 5CMAB 3VI3F 2JWYA 1BXXA 2ODHA 1FFOA 1PS3A 3L1EA 1P2CA 2E76C 2WNXA 3UERA 2ADFH 3VCLB 2BNRA 5JHDB 1LO2H 4AQEA 1MEXL 5EIIG 3BPCB 3OMAB 1DQLL 1KTCA 1NSNL 3RPKA 3UIYA 4PCKA 1KJVB 4J3XA 1AHMA 4DO4A 3DO4A 1KYAA 4HUWA 4WW2F 1T7ZA 5ANHA 1F2QA 3DBXA 4CGUB 5F9JA 3EKCA 1CTNA 5CZVL 1OGTB 5L0QB 3IDXH 1NM9A 3CDFA 5T3ZL 3RTLA 3ZE0B 2Y06H 3ZRSA 1KLUB 3QEQB 3U2IA 3MNWA 3L3OC 4PJCA 3GMMA 2G2RA 1UB5A 1HHHB 2R0ZL 3N1QC 5D7EA 5DQDL 5EFIA 2X3BA 3DMMA 3BZEB 4GW1A 2VDOL 1FJ1A 1EMTL 4XVSH 1FCCA 3DUSB 5E4IA 5KYNA 1FN4B 1ZMYA 3NVQA 3GHBL 1S6NA 1T6BX 5D96C 5SWSD 1V55B 1XSOA 3MFFB 3ZHKA 2RFXA 3BOVA 4EN3D 2DDQH 4M03A 1URZA 4URKA 1KYOK 2XWBA 5DD3L 1J5OH 1YNKL 1FYTE 2HX9A 2C9UA 2R1XB 4YZFF 3EADA 4MXQC 3Q2LA 2YD2A 5ESQA 2R83A 4N2CA 1EXUA 5E8PB 1XB3A 2PYED 5C0AD 5IOPB 4I9WD 3JVFC 2NXYB 2G2NA 4RWYH 1YMHA 3AFLA 2A1WL 4F2FA 3EGDB 1GS7A 3EYOB 3IJEB 2NY2C 4NX0A 3D33A 1XR9B 1J0HA 3SPVA 1AOHA 2CHNA 1YDPB 3O3UN 2PETA 2AANA 3O8XA 4CU8A 4Z7IA 3T2PA 2X4QB 4K3DH 5B38G 4L3CA 1WITA 4MMYB 3IMVA 4OFDA 5FA4B 1CL7L 4YDLB 4B41A 1OL0A 4HF5H 1HXMB 1MFBL 4YSQA 1VFUA 4GQRA 2WXHA 1ZLSH 4QR7A 4JGMA 3IJHA 4UILL 2NYKA 5LAXA 4MJIE 4P57A 1DCLA 2A6JA 5D1XB 1AGFA 1I4FA 4ZUSB 5J0BA 3CVHH 4H88L 1MJ8H 1G7MB 3QFDA 4MAUH 3TP4A 3SZ6A 3AAZB 5CJ5A 1SEBB 2Y7MA 3VXUB 3MROA 3Q3GA 3DDGA 1JPSL 2H2PC 3D4ZA 7CGTA 3FT2A 3PIQB 1WZKA 2H2PD 3DOSA 1TVBA 4PSPA 5TFSH 3ZE1B 4ZD3L 3D50A 3D12B 3SDXA 3A0OA 2ZYRA 3RI5F 4L4TE 5GS1B 3EBHA 5JW3H 3N44B 4NQCD 3R8QA 3HVNA 4WI0A 2CIIB 3PUCA 5FO8A 2MKLC 4TVSa 4YS4A 4GKZB 3TVMB 1XH3A 4G8AC 2E86A 1DN2A 3HG4A 3PHSA 2RCSH 3OHXC 4R3SA 3HZVB 1R5VB 1ORSB 2D7OA 1HHJA 4HIHA 3GI9L 5IFAH 3GMRB 3UROR 4LF3A 1XR8B 3T4AB 1T0MA 1NGZB 3MRCB 5KUMA 1KWGA 3O6MH 4MDRA 5IGXH 3E6FA 1VFBA 4KK5C 1T2JA 4I18A 4E9XA 1K6QH 2BLFA 3Q1SH 5F7EL 3ZDXF 3P77A 2EVHA 1A9VA 1F18A 5SWZB 4F57L 4X98B 1WA2X 4RFOH 3GB7A 1QNZL 2ZWKA 2UY7B 3CFEB 4XPBL 4AIZB 1G9MH 1A21A 1MPAL 3EJZD 4HEME 5I8CB 3LIUA 1A7PH 5TDNA 1KTDA 1WFTA 4NP9A 2WJ7A 2JELH 4V1DD 3HI1A 4PW3A 3SDCC 3DJ9A 4Z78A 4K7PY 1JGVH 2YMTA 5ADOL 1KSRA 3V0HA 4OD2A 1TDQA 3KCPB 5IQMA 2CDGB 2ESVD 2PW1B 3B9KB 3NCYS 2VLRE 5AW6B 1E9OA 4OZHE 1VEPA 1CFNB 4OF8A 5HGAA 3NJMA 4AZUA 4KZCA 1UOLA 3V0WL 5KBNC 1XF3B 1NZRA 2AI0L 5DJ2B 3W5MA 4PJFB 1W0VB 1MJ7L 3WE6A 5AALA 4M5YH 3F00A 3PJSA 1T0NA 4ZUVA 5GHWH 1PAZA 4P2YA 1IGTA 1DVFC 1FNGA 4XNDA 2NNRA 2X0UA 1CVRA 3UC2A 3IRCA 4TTGA 5KZCD 1D5IL 1LEGA 4JDZA 1L0QA 3OPZH 2ZE0A 3WELA 2H3XC 2QADD 2ZKHL 1IGIH 4Q9CA 4D3CL 3B2VH 4IBLT 1U8KB 5C0EB 1KGWA 1INDL 4M00A 1A9EB 1BVLA 1BLIA 4WGVB 3NJHA 2WQUA 2GFBA 3NJLA 4I3GA 3WTXA 2WO3B 3GUTB 4WFFD 4YHIB 3NABL 1ZLVK 4MMZB 4KROC 5H35B 3BAIA 4NN6B 3GGWB 1VB9A 5I1HH 5KN5A 3CVBA 2Y5QA 5IF0A 2X6CA 2Y7NA 1ONQB 2YMXL 4M8QA 5G5DB 1FLRL 1KB5B 2AEOA 4G7VL 4ONGL 5IB4A 2VM3A 2VJ0A 1P5UB 1PJ9A 4EE2A 5FA3B 5I6XC 5DSCA 2WOBA 2BNUA 1BZDA 3ABLB 3QNXA 4KJQD 4LIQL 3ZL2A 4JFEE 3JWDC 2A5UA 5AKTA 3ES6A 1KLGA 3AJ7A 4BK4A 4F15B 3KLHD 1TR7A 1CK0H 2QTEA 3MXVH 3MV8D 2YXFA 4DSYA 5D70H 2BOBA 2IWFA 5I30L 4X83A 3CIQA 4BZYA 2VDRL 1SJEA 2XKNB 4RGNC 2ICWI 3IU3B 4LASH 4BZ1H 1YUHA 3KPOB 5T1KB 5A6IA 3TBVB 2BM3A 4XWOD 1WH0A 4PJ8C 3VI3E 2W07A 4G3YH 4HEPG 3NGBB 1TLKA 2HRGA 2UZPA 1GMIA 5E5MB 4IOFC 3VGGA 3ZZ1A 1LGVA 1H9DA 5E6IA 3CTTA 1FO0B 3GIVA 1TTBA 5HHMD 1JWUA 3W2DL 4FQ2H 1GZHA 4PBDA 3F83A 2AEQH 1AGEB 4JFFA 5TF1H 5DEZA 1YC8A 2YS4A 2ZUVA 2OMTA 1N6VA 1Z3GL 3BRFA 3PU7A 1JK8A 1ZSDB 1N0XH 4ZOEA 1JHKL 4HCIA 4LQFL 4B5EA 4UDTB 1RV6X 4PTUB 4D9QD 3QG6A 1D5ZA 3FCSA 1R3KA 3HG2A 3ARFB 3RHWK 1Q94A 2OMVB 1RCYA 4OZ4B 4RQQA 2IH3B 4EI5B 2ADIB 3TT3L 4FZ8H 1E9QB 3W9EA 1E30A 2UZYB 4C83B 2NCEA 1YN6B 2G5UA 4DGIL 2X40A 4GBXC 3PWVB 3BLKA 4LGRB 1PW3A 2VRKA 4KV5F 4GBXD 4LLYB 2EECA 3FT3A 4KKBC 3V95A 2VE6B 4WUKH 3MHZA 1KTJA 1FFRA 4X5LA 1M53A 5JHDE 3X1EA 2GQHA 2WAHA 3HZ3A 4GSXA 3KPLB 3TO2B 4XO5A 4YZFE 4CNIA 1IAMA 1UFUA 2XKSA 4OJCA 4W9DC 1E9PA 5EDXA 1KBPA 4D9LH 4FMVA 5EO9B 4DGWC 4BH8A 2J8HA 2HVKA 5I26A 4AT6B 4OCYH 1YMMA 5SX4H 2OYPA 4YAQA 4AEHH 3JWNH 1U6AH 4OV5B 4UM8A 5KSVB 3V4VL 5HHNB 4OJFL 5HJ3B 3ZE0E 3AY2A 2DIBA 3IF1A 1UYWL 4ZYKA 4Q56A 3MMEA 4ENEC 3QEQE 3FUJA 1FNEA 4KO5A 3LN4A 4NBZB 5JHAA 5I9QC 1OCRB 3ZGIA 2YAPA 2QTVA 4O51A 5GGSB 4OI8A 3F04A 4RGMB 1BQHB 3VWKB 4ATWA 1D3CA 4ODHL 2VLKA 3SY0B 3VMOA 4MBOA 4K5NA 3ZN6A 2F54B 2WN3A 2EE0A 3DX0A 4G7YH 2EE3A 5TE6L 1ET8A 1OK0A 3A67H 1ACYL 4LQ1A 3VI4A 1JPFB 1YO4A 3AABA 2D0FA 1DEEB 1Q9OB 5F7BA 4HV8B 1N7MH 1H3GA 1MWAL 3ILEA 3BO8B 4FQHB 5B22A 3U36B 2X1PA 1MNUH 1TCRA 3MOAH 4GMTH 1MLBB 1UZGA 2A4ZA 3AREB 1E5YA 1KTRL 4PJDF 3NCMA 4JG1L 1A25A 1XGRA 4XP6H 3LZRA 1TEFA 3HG5A 3S2AA 1C5BL 2HT3C 2VZTA 1WCBA 3A4DA 1T1ZB 3PHAA 4FQIL 3LXUX 1E6OL 1YA5A 1JTTA 5FB8B 2ZIDA 2MWCA 4TVUA 3SPHA 1KG0B 3AWFA 4AKOA 4G43B 1FZKB 4X6EB 4RMRA 3O0LA 5EBGA 3C8HA 3D0LB 4Z77B 5FGBA 2VJXA 4BK5A 1DDHB 3JWNE 1UOWA 3EH3B 2VCOA 4DN3L 5DC4B 3V4PB 5E2TL 5EBWA 4ODVH 2EE9A 2ZSVB 3FQRA 2WKLA 1WBYB 3IN2A 3QUMB 4PY7A 3T8MA 3WFCH 4HJEA 3BPOC 2A4CA 2DIAA 1WC7B 1AC0A 1YEJL 3P2TA 4P23C 2NY6B 2GBAA 1YCSA 1XH0A 4RGOL 4Y2NA 1OAZH 1T83C 3AW5A 1DLHB 4QOKA 4YSRA 1D5RA 4WK2B 4YLBA 5D1XE 3ZDXE 2UUDH 1CQKA 4AW7A 1J10A 4G6AC 1SDYA 2JJVA 3ZZSA 4OLWH 3KPRA 3GSUA 3L3OB 4FFYL 2Y07L 4HK3N 4PWKA 2R69L 4LKCA 4TQEH 5F2FA 5F9OL 3VXUE 1T66D 5D1ZA 4ZODA 2C9AA 2D2CC 2QSCH 1O6TA 5A3ID 4E42B 3ZE1E 1UOVA 1HILB 2FSEA 5G55A 2IGLA 2RGSA 3D4GA 5FECA 3P02A 1SVCP 4B3EA 4UAOB 4IBUA 2EIZA 3LH2H 4BEIA 3VWJB 1M56B 4MCYB 2XBDA 1PLAA 3LY6A 3RTQA 1INQA 3OKYA 5DZPA 1VA9A 5HHPA 2VW7A 1CBVH 4HIJB 3FCTB 4JY5L 3VQLA 2DQHL 1DZ0A 1HNYA 4JDVB 3CSYB 4MMXA 3WUZA 3GD1C 4OAWA 1IAKA 3O3DB 5C0BD 3FB5B 1EO7A 4LEOB 5FK9B 2NY2B 3CVDA 3EW3B 4OFKA 4XCNA 3Q6GL 1ULVA 2J7LA 4DN4H 4KMTL 3KYMA 1BBDH 1KZYA 4JE4B 5SWZE 1BPVA 5LUMA 4N6RB 4YPGA 1SMOA 2JLLA 3W0WA 1IEHA 4XGZB 3LKRA 1BBJB 5CP3H 5M7QA 4YDJA 2DKSA 3DIFB 1AE6H 1FL3A 3X13A 4QY8A 4E9TA 1KB5H 4LBEB 3FSWA 4HLZG 3QFJA 5DVMA 1R75A 2IGFH 5F89B 5CBAA 1NINA 4L8SC 4ZFOL 3N42B 4DKFH 2X10A 4RIRB 2ZUWA 5HDBB 3ARVA 1VESA 1QFWL 4PLJD 4W4OC 1B88A 4U31A 4KK9D 5EO1B 1BFVL 2BP0B 3QDHA 1H3PH 2GHWB 5F6HI 1RZKC 3RX8A 4ENZA 4XPFL 1R17A 3L1OH 5JIDA 1T03H 3BISA 1GGBH 3QDMA 4N8CL 1Y6KR 3LN5B 4RX4D 3L3KA 4JK0D 4M1GH 2E7DA 1JDDA 3GPEA 3VXMB 4EF3A 1HKFA 4F1SA 5D7LB 1GHFH 4MVBD 1U8LB 1PLGL 2FB4L 4MA1B 1G9NC 4E41B 4EXPX 3K5SA 4IBTA 1EAPA 3ZHNA 2AABL 1N19A 4J8RA 5I0DA 1F4XH 1WE5A 4TULH 1ZXQA 3KPPA 2R29A 1E27A 1I1AA 2Y36H 4OVVA 4AY0A 3CFCH 4WUUB 2E7BA 3MGOB 2WWKO 4JM2F 2P24A 4D0DA 4PGDB 5FAAA 4CSSA 2NUTB 4Y4KC 2H1XA 4XN8A 1OAQL 4HIXL 3N42F 3UAJD 3HPJA 3KYOA 4YHYC 3RY6C 3AU1A 1G7IB 2KZBA 3IDJB 4RMUA 3WS6A 2HJLB 5AVWB 1J5HA 3V0IA 4OLVL 1NMCC 3WENA 1MI5A 2FR4A 3BQUC 4FA7B 4LLAA 1A3ZA 2WWMD 1FYTD 1L0XA 4NRXB 4Y2DA 5IVNA 1PIFA 1Q9LB 4J3OF 4C56D 1OT1A 1I53A 3FQ1A 3CFMA 4KVPA 1J87A 5FYJH 1OAKL 4EVNA 1BXUA 2HLAA 3HE6D 4M7JH 4P4KD 3RNKA 1FDLH 5DGQA 1VZHA 5FO2A 1NFDB 3Q5YA 2KLTA 4MZ3A 4EMZA 4Q9QL 5CKGA 5E8EA 3EJJX 1W0WB 2FK9A 5DVOA 3IBEA 3EO9H 5C0DB 3KLAA 4Z7NB 2J4WH 1DUZA 3CXDL 3JUZA 2GCYB 3FRUB 4D7PA 3RU8L 3CMOH 4EZJA 1S3RA 2CA4A 3V4UL 1AIFB 3LN9A 3D85D 3QUKA 4KV5E 2JB5H 1EIBA 1EX0A 3PDGA 2GSIB 2YPKA 3MBXL 1FNAA 2VMFA 1DVFB 5CCKL 3RI5K 1BQLH 6FABL 1WG3A 4RRPM 4UM9B 1HHGB 1U4FA 4PJXA 5AOIA 3HB3C 1SM3H 5FC9A 2CHXA 1NUFA 3M88A 4HZLA 3GBNH 1JZ3A 2JJSC 1M1SA 2EC9T 2GBUA 4MJID 1XAKA 4RLDA 4Q4EA 5IT2H 3W39A 5K9JL 1BMWA 1E2ZA 1IX2A 4AENA 1P0SE 3B9DA 5TK2A 1LLAA 4G8IA 5DUBA 4UQ9A 4PJ7A 1KDJA 5F0PB 4NKDB 5E08H 3ZYOA 2W38A 2BNRB 1H3WM 4AQEB 3Q0HA 4HPOH 3L7EA 2R4RH 4FZEH 4HFUL 2VN3A 3LEXA 2WXRA 3IWUA 5BQ7A 2AJ3A 4HS8L 4L4TD 4I5BA 4LPYA 3FPYA 1L6PA 1RUKH 1LQBC 3ETBJ 5CEYB 4Z7NF 4HUWB 3U6RB 1TZ8A 5KW9H 5F9JB 2WNWA 3ASOB 3Q48A 3GSOA 4KVCH 4F24A 1FSKB