2PP8A

Formate bound to oxidized wild type afnir
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Conserved active site residues limit inhibition of a copper-containing nitrite reductase by small molecules.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 89
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2007-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2pp8A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2pp8A02
2FQEA 1BXUA 1GYCA 5I28A 4W1TA 4DP1X 1AANA 1NPJA 2N0MA 2IWEA 3UACA 2XU9A 2EIMB 3AG2B 2YAHA 1KCBA 4AX3A 1JZIA 1ILSA 1DZ0A 1KV7A 2WO3B 4NERA 3ASNB 4YSPA 4YL4A 2UXTA 2VW4A 4NB7A 1KBVA 2P80D 2B3IA 1NZRA 4N8UA 1SDDB 3FU7B 1CC3A 1PZAA 4AKQA 5E9NA 5B1BB 4FAAB 2FT8A 5B1JC 1NIAA 2YXWA 2YAMA 4JKNA 3V9CA 1GR7A 1QLEB 3FU8A 3IBOA 1IBZA 3BQVA 4F2EA 3X1BA 3DIVA 2UXFA 5IY5B 3TA4D 5B1JA 3OMIB 1E30A 4G72B 3DTUB 2JXMA 3G5WA 3JT2A 1HAWA 4UAHA 2XV0A 1A8ZA 3PCYA 5I26A 3SBQA 1HAUA 1AZNA 3UGEA 3NJLA 4BXSV 4NAJA 4E9TA 1HFUA 2UXGA 4CSZA 2IAAC 4K9JA 1KYAA 4M3HA 3X1EA 1XB3A 2H5UA 4UANA 2BZ7A 3MX0B 2Q5BA 3PXLA 1MZYA 2EIJB 2PP7A 3WIAA 3DKHA 1T5KA 2VSKB 2QPDB 3NSDA 1BEXA 4GXFA 4YSSA 1CURA 1JZFA 2IDFA 1N68A 2GBAA 2EILB 4YVUA 1SF5A 2BZCA 1GY1A 4A67A 3SQRA 2ZONA 3NJNA 5I6NA 2QDWA 5I6KA 1NIDA 1SNRA 2YAPA 1ASQA 3HB3B 3S3BB 3NJMA 3AG4B 2RACA 5B7EA 2BWDA 3FPYA 2BW4A 2XX1A 1AQ8A 3T71A 3EH3B 1OV8A 1TEGA 5I6LA 4GP8B 1JERA 3T9WA 3OQRA 2CCWA 1OOWA 1W6LA 3JTBA 3S3CB 4YSAA 1SDDA 3FU7A 2IDSA 4YVNA 2DV6A 5D4HA 4A2HA 1RKRA 5LDUA 3CDZA 3NP4A 1SFDA 2FTAA 5FC9A 4E9VA 3L45A 3FQYA 4L0PB 2VN3A 2PCFA 3H4FA 1NINA 5D4JA 4YSCA 4G7QB 1BQKA 3ERXA 4A66A 2DY2A 4HAKA 3S3DB 1GS8A 1PCSA 1XB8A 3N2JA 2Q9OA 1MDAA 3FPXA 2I7OA 3KW7A 3WG7B 4AI7A 3RYMA 1URIA 3ABKB 2IDQA 3ZDWA 4DPCX 3KW8A 1AG6A 3OM3B 2PPFA 2IH9A 1BQRA 3C75A 3EH5B 3H4HA 1WS8A 7PCYA 2OJ1A 3AG1B 2CAKA 1EZLA 2IDTA 1BXAA 2XXGA 3IN0A 4KNUA 2FNWA 1AACA 1W8EA 1L9OA 2GC7C 4CSPA 2BP0B 4A2DA 5AFAA 3ZIYA 2B08A 2HXAA 2GHZA 2DWSA 3CG8A 1TU2A 3GDCA 4P5RA 1J5CA 2HRHA 4EF3A 4KNTA 4BWWA 1JVOA 4GP5B 3OMAB 2FQDA 3FS9A 3EHBB 1M57B 1SFHA 2HLEB 2J55A 1ET7A 1V10A 2BO0A 4YSEA 3S8FB 2EIKB 4BDVB 1M9WA 3V9EA 1ZDQA 1PLBA 1SHXA 2GI0A 2OCCB 2YAQA 1PF3A 3SBRA 2HX8A 4FA7B 1OE1A 3UABA 4E9XA 2GIMA 3NSFA 3GYRA 1EHKB 3QJVB 4M4RB 1NICA 2QDVA 2UXVA 2FT7A 4RH4A 5AZUA 2GC4C 5EHFA 1JXFA 1OF0A 2DYSB 4JHVA 5I6MA 1NIBA 3AG3B 5I5MA 2QPEB 4HZ1A 7PAZA 2UX6A 4DP8X 2JFCA 4DPAX 2JKWA 1JZJA 2P80A 1J9RA 1N70A 2AZAA 3FT0A 2LLNA 3NP3A 1QHQA 4HCFA 5D4IA 3QJRB 4YSQA 2XV2A 1A65A 1JZEA 2HX9A 2PPDA 1AAJA 2PPAA 1R1CA 2J57A 2VM4A 5B7FA 1OCRB 4KO5A 5AKRA 1AZBA 3ABMB 2J5WA 2BWIA 1BXVA 1PAZA 4BWUA 2ZWNA 3NJIA 3NT0A 1WS7A 1FFTB 1NIFA 1TKWA 2Y1AA 2VSMB 2XVBA 4AKPA 4AKOA 1BYPA 1KCWA 2GSMB 4KNSA 1JXDA 2VM3A 4KOCA 2WSDA 3NYKA 1WA0X 3EF4A 2VW7A 2BP0A 3WI9A 1X9UA 1NPNA 2I7SA 2GB2A 4YSOA 2VMJA 4F2FA 3EH4B 3D12B 2XXFA 1JXGA 3WNIA 3FSZA 4KO6A 1E5YA 1MZZA 2CUAA 2UX7A 3TU6A 4E9SA 3NJJA 3NSYA 1NWOA 2EINB 2IDUA 2IWKA 1GY2A 2HRGA 3IE9A 4BDVA 3QJUB 2XLLA 1J9SA 2XYBA 4WKXA 4DP0X 3SBPA 4A2GA 1XMEB 2BW5A 1JVLA 1WA1X 5PAZA 4KO7A 4WTQA 1PLAA 1I53A 1AZRA 1WAEA 3NJHA 1KBWA 4HALA 5B3SB 3T6WA 3GXUB 1A4BA 3WKQA 1KGYE 2PCYA 4DPBX 4ENZA 1AZUA 4QKTA 4YSTA 3T6VA 2YAOA 1V55B 1MG2C 1AS7A 2R7EB 4HCGA 2E86A 1FWXA 2H47C 1GS6X 4PAZA 1J9QA 1PY0A 1RZQA 2AFNA 4E9YA 1AZCA 4A2FA 1ZDSA 2XWZA 4KOBA 4DP2X 1VLXA 1JZHA 1XB6A 4GP4B 3S8GB 2FQGA 3ABGA 4F7KA 1NIEA 2YAEA 1JOIA 4TXVB 2Y69B 3FYEB 3PAUA 2NRDA 1IKOP 1L9RA 3U25A 1FA4A 1MG3C 1SHWA 1PMYA 1NDTA 4X4KA 1B3IA 1AIZA 1PNCA 3ZX1A 4GYBA 4A68A 2HZHA 4BXVA 2TSAA 1OCCB 2H3XC 4DP4X 4BK5C 2ZOOA 1NWPA 3CVCA 2FJSA 1IC0A 4ZK8A 1ET5A 3X1FA 5B1AB 3FYIB 1GSKA 3OMNB 3QJTB 1RZPA 2XV3A 4G7SB 3PLYA 4HCIA 3AY2A 1RCYA 4DP5X 1BQ5A 2W88A 4P5SA 4KO9A 1ZV2A 3TASA 1IUZA 3ABLB 3ZBMA 1F56A 1AG0A 2XX0A 1ILUA 4BWTA 2CJ3A 2PP9A 5A7EA 4AZUA 5TK2A 2J56A 3UADA 1W6WA 1OCZB 1KDIA 2FWLB 1DYZA 2BP8B 1ASPA 3CZUB 3FSVA 2YXVA 2WO2B 4JHUA 1QNIA 1ZIAA 2FT6A 2W8CA 1OCOB 1X9RA 5B1KA 3T6ZA 4YSUA 1E5ZA 1ZPUA 2A3TA 1GS7A 3UAAA 4E9WA 2DYRB 3WKPA 3FQ2A 3CDZB 3QJSB 1L9TA 4G70B 3NJGA 2AZUA 2MTAA 2R7EA 2PLTA 3ASOB 1ASOA 2IWFA 4HIPA 4Q89A 3QQXA 3H56A 3NSCA 4YSRA 2TSBA 3NJFA 5I5JA 1CYWA 4Q8BA 3X2QB 3TBBA 9PCYA 3QPKA 1BAWA 1J9TA 1WA2X 3HEIB 2PP8A 2IH8A 1A4CA 4YSDA 2QT6A 2X88A 8PAZA 5F7BA 1E67A 1PZCA 1UATA 3X1GA 2PPCA 4UF7C 1ETJA 2OV0A 5I6PA 3X1NA 4N4YB 1ET8A 5I6OA 2YARA 3CVDA 1SJMA 4HHGA 1AR1B 4DP9X 2FQFA 1YLBB 2CALA 1J5DA 1NTDA 2VW6A 5F7AA 2CBPA 1L9SA 1GW0A 3AZUA 3OD3A 2X87A 3FQ1A 1OE2A 5B7MA 1PNDA 4A2EA 3CVBA 1AS8A 3WNJA 1SF3A 1ID2A 2BP8A 1AOZA 1L9PA 1A3ZA 1V54B 3BVDB 1AS6A 2XUWA 3FU9A 3QJQB 1TEFA 6PCYA 4MFHA 3PPSA 3FSAA 4E9RA 3IN2A 1KDJA 1M56B 3T6XA 1ADWA 3N55A 1PZBA 3IEAA 4DP6X 3PAZA 4QLWA 5ANHA 2DWTA 1PLCA 2YAFA 2AVFA 1CYXA 1E65A 1BYOA 3MBWB 3NJKA 3TBCA 1CUOA 1JZGA 1OE3A 2AANA 1IBYA 2I85A 3UAEA 2YQBA 4HHWA 2ZXWB 3FSWA 6PAZA 5I5IA 2HX7A 4PCYA 1ZIBA 5TK4A 3AW5A 1L9QA 4GY4A 2PPEA 2BHFA 2MRYA 4G71B 4G7RB 4E9QA 4W9ZA 4DP7X 5PCYA 1A4AA 3PAVA
chains in the Genus database with same CATH superfamily
4HJJL 3SO3B 5DJ0B 4NT6A 1M7IA 3OXSA 2DH3A 2FJUB 4POUB 5F70A 3WYRA 3MA7A 5C0BA 1BYNA 5C92A 2GVYA 2FSEB 2YAHA 1KPVB 4X9GA 3O4LD 7CGTA 3WJJC 5KSAD 1R5VA 3QI9B 2AJXH 4YSPA 3J07A 3U1SL 1TSHA 2WN3A 3DGCR 2QJDA 4HUVB 2YUZA 2ZP8A 3PP4H 3P77B 4WAFA 4QR7A 2HFFA 2HT2C 4X6FA 1NAMA 3WN5C 1CDGA 5DJ2A 5B1BB 4HF5L 4QXGH 3PL6D 1UENA 3EDFA 1AXIB 2X1QA 1KJVB 2YJLA 5BO0D 4NP4L 3GSUB 4GW4B 1O7DE 1SLVA 1EAPA 1F4XL 4JG1H 1DSWA 2PW1A 3TBTB 4Z7WA 5LBSH 3BQVA 4I3RH 1A6WH 5HHNB 5KOVC 4F2EA 3UBGA 3ZHLA 3MN8A 4Y2DA 5BS0D 2PCPA 3D0AA 4LHJB 3BX7C 1XZ0A 4K71B 3E9UA 3O6KH 3TA4D 1V3KA 4MKTA 5KYUB 1BLIA 1WZLA 3DTUB 5I71B 2ENSA 1VJSA 1JXJA 3MRKB 2HUHA 2DIEA 5C0BE 2X4QA 1R3IL 2PTUA 3GWJA 2VRQA 3MR9B 3OB8A 2LR4A 1YMMB 2Z4TA 1CFBA 2D2OA 3QEQD 3DKHA 2VSKB 3QUYC 1WG3A 2MTPA 3B83A 3DMMB 2VDKB 4HUMB 5A1AA 1CG9B 3MDJA 2DQMA 5D71L 5IBLC 1CK0H 3P4NA 3BT0A 3PABB 3U30C 1UASA 2OULB 5I6NA 1CFQB 4XNDA 1DDTA 1NDGB 5E8DL 1NBZA 3LN9A 4Z7WE 3VFUB 5B7EA 3VG0L 4P5TB 4PRPD 1I85C 1GJIA 3LOWA 1G9NL 2B2XH 1KENL 2F08A 3B9DA 3NCCB 3LN4A 2YHGA 4G8EB 1AQ8A 4B3VA 2DLTA 1TQSA 3EOBA 4GP8B 4HS6A 2EUVA 3RZCD 4J3OD 4P2YA 2FCBA 3EUUA 2IDSA 2X9WA 2LU7A 3VW3L 3VD7A 4WWNA 1RKRA 3GF8A 3DTXA 4ODVH 4RMQA 4A55A 4PWHA 1WT5A 4IRJD 5I1AB 4AT6B 4LSUL 2ZXBA 1NEZG 3L45A 1YVLA 4KX8A 2XRAH 4U1IB 1Z7JA 3UJTH 4B5EA 1QLFA 4ONFL 2FB4L 5D4JA 3MYJA 2RCSL 3BUTA 4GRLA 4XNXL 3FB7A 2O26U 3DX6B 3H2WA 2WLLA 5M94B 2VUOA 4MTMA 5C9KA 5F8QC 1GZQA 1WSST 1ODAA 2BSRA 2C26A 4N90E 5E9AA 1L0YA 1AIFB 4X9FA 2UYLA 5TDOB 2QADD 4L5FL 5EC2B 1G7IB 2BCKB 5GGVY 2XTJC 2VQ4A 2O5XL 1U41A 3D4ZA 4WSGA 2OW6A 2AXWA 3ECQA 1NOFA 3QEGL 1ZY9A 2DQFB 2P3YA 1F2XK 3GS0A 1FYTA 3EYQC 4OZ4A 5EBWA 3VI4A 1IGTB 3LZRA 3KLDA 4KNUA 4DPRA 3CSYB 1IEAB 4TF4A 3WO4B 4ORGA 3DX7B 3OKKB 3JVFC 2B08A 3S2AA 1MHHA 1DN0B 3ESPA 2X0VA 4JFQB 3WY3A 5C0IA 4U0QB 1KCKA 1FHNA 4OQTA 2R23B 2NTSP 2WXPA 4DAGL 3BIKA 2APWA 4ANUA 4OF0A 1RP9A 1M57B 1EAOA 5E2VH 3OPZL 4MXWH 2AMGA 1PLBA 5FO9B 1PF3A 1OAUL 2R2EA 4NM4H 5J06A 4X0KA 1TSRA 4HC1A 5F7YC 3UZQA 4EIUA 4P46D 1ZSDA 3VRJA 3P3YA 1MJJB 2WM0A 1GA2A 3EOAA 2Q7NA 1GCYA 4IIQB 1CQKA 4PWGA 3GMMB 2WN2A 4I48B 3VI4E 1AXSA 1FYTE 3DOSB 2PKDA 2VZ3A 1XIWC 3PWUB 3OF6D 4MXQD 3PDOB 1H0DA 4OIBA 3UTOA 7PAZA 1XFPA 4HMEA 4HWUA 3WMQA 3O2WL 4FADA 3V0GA 5HHMB 4Z95L 4FQPA 1LQBC 3QFDB 4ZOCA 2VDQL 1ND0B 2PPDA 1BZOA 1MAKA 2YD7A 2HT4D 2G9HB 3ABMB 5EZJA 2ERJC 4FQ2L 4RMVA 5DMIH 5LAXB 3RG1C 3NT0A 1TZOA 2FIRT 4J2QA 5BO1H 1E9QB 4QHLA 4ZS7H 1TJGL 4X9YA 2VISA 3QCUH 4HJ1A 1ACCA 1LE5B 2WSDA 2DQHL 1WA0X 3EHBC 4NI3A 4DEPC 3KJ4C 3OKEA 3L1GA 5E5LA 4AXWA 4BCZA 2ESVB 2X44D 1J0ZA 2X4TB 4V1DA 1LNUB 1ED3B 1I1FB 1WLHA 3P0GB 2PYEA 4KTDL 3EJUA 4XP5L 5EU3B 2JVUA 1P5VB 2EE2A 2YA0A 1U9KA 3MCLL 3OKLA 2CLVA 1BMZA 3C9NB 3BVXA 3UAJC 1NM4A 5EBLB 1SXSA 2DMKA 1GGBH 3Q01A 4KROD 4BDVA 4F37F 4JPQA 4KRPD 3LH9A 4LSPL 1GXEA 3V0WH 2B1AL 3H2PA 1A9BB 4J28A 5ABAA 3QUKB 4C4BA 1TTCA 3BKML 1UB6A 3CX5J 4ODTH 2FBJL 5AOIA 4Z0BH 3W57A 4E5XA 3CMOH 5IWLC 1EJOL 1MPAL 3EFFB 2VLME 4B41A 1MCBA 2IALB 3CZFA 4GAAA 3EGXB 4JZOB 5DEFB 1H3PL 4Y16B 4RIRB 2YN5A 4JKPL 5JPMB 4ENZA 4TQIA 2JSFA 4YC2B 1AZUA 2ICEB 3L13A 3SDAC 4MZ3A 2Z91B 3VI3A 3LH2H 3VSQA 5LGHL 2YRZA 2ZICA 1HEZA 5CBEA 4B9GA 4G8FA 1R3KB 2WBJC 4JRFA 4EUPH 4L8DB 1JIBA 3KDMB 2J6WA 4OY9A 1CTNA 4HMDA 3BI9X 4V1DE 4AJWA 4PJIA 5KZCD 5ERWB 4PW4A 2PYEE 2VDMB 3BP4A 4OGXL 1QBBA 2HVBA 2ZNWA 4GXUN 3UTSB 4UM8A 4L2YA 5EWIH 4TXVB 4KJYA 3HB3C 4LU5L 3U25A 3K8KA 2P5EA 4L8SC 2WNWA 5T5NF 2K8MA 3ESOA 3VYOA 4D9RD 3K2MC 1ZHBB 1ZTXH 2IAMA 4DP4X 3Q5OA 3MV7D 1SBSL 4N1HB 3VFVA 4EUPG 2FJSA 2XY2A 3ZE0E 5DZLA 4W9JC 1UYWL 1RCYA 4PJXA 4JG5A 1OTUD 2VB5A 2APBA 2GTWA 2J8OA 1OM3L 1DDHB 1HQRB 1ZV2A 4I1PA 3VI3E 2ICCA 2QSQA 1ZLSL 2CHWA 3BGMA 5KSAC 1DVQA 2CJ3A 4PJBB 2LQRA 4AK2A 4QF1B 3K6OA 4PW3A 4PJIE 3T3PE 4U1LA 3VFNB 2GJ6D 3PL6C 4NQDA 1TYJA 5I8EA 3VFSB 4JHUA 1KTLB 4E0RB 1QNIA 2FT6A 4N8CH 5FA4A 2VXQL 2VDNL 4BA8A 1T1XB 2P5EE 4ZZFA 3IJSA 4XXCC 5EPMA 2EC9T 3VGAB 2EZ0D 4WHCA 3DROB 4FFTA 1TVBA 1W0WB 4LK4A 1KTRL 3BAKA 2E27L 3NDZE 5IB5B 4WFFD 1GZPA 3TBWB 3RDTA 5C3LD 1ASOA 4XE5B 3SQOL 2XACC 2R51A 4UB0L 4DTGH 1CJYA 2WKOF 5JQ6H 5EEVA 3QWOB 4PJXE 4MD5A 3HI6L 5GS3A 1INDH 4GUOA 4R84A 3Q8BA 1PZ3A 5JUEH 1HE8A 3AU0A 4FG4A 1GKOA 1YY8A 1E40A 1UWGH 3VFWA 5KW9H 2O61B 2IH8A 4YSDA 1T66D 1J8HA 1KMGA 4PGBA 3BKYL 4JZNA 1JNHA 1NEZB 4FG2A 2MCPL 2AK4B 3ZOAA 5KG9B 2EIBA 2IBZY 4NQDE 4UF7C 1E0OB 3IS1X 1K5WA 1ET8A 3OG4B 4PSPA 2KHAA 5DD1L 5A2LH 1SJMA 2UZYB 4FL4C 1TYRA 2EDXA 2EDWA 4AJYV 3WOVA 2FQFA 3Q8FA 3K2IA 2I32A 3NG5A 1Z0MA 2D7TH 4LIQH 1FNGB 1R0AL 3L3GA 3RWDB 2X87A 3Q2VA 4PJDB 4RAVA 5E4OA 5KJ4A 4D0BB 3PWNA 4QRBA 3VFTA 3ESUF 3K2KA 4WJ5B 3I9IA 3CFKA 4A2EA 3NMEA 4JFOA 1KPUB 4PJBF 4F9PC 3RI5F 1S8DB 4G8AC 4OM0L 3WY4A 4X7CC 2Z31B 1T0MA 4YIQB 4IRJC 1DQKA 1ULVA 3L7EA 5HI4D 5KVDL 3ROOA 3X11A 2CKNA 2UUDH 2EDNA 3HZMB 2VQ1A 4UT6A 3FONB 2QKIA 2ZCKL 4KHXL 4YBQD 6PCYA 1HOEA 1KLGB 3ZKSD 2MNUA 4BUGA 1T3FB 5D70H 2QELA 4GSUA 1J8HE 1YN6A 1N5YH 2LFEA 3SKMB 4QXTB 1X44A 4RNRB 3RX7A 1XCTA 3PAZA 1FLTX 2YEZB 3BAEL 3RGVB 5ILTL 3U4EA 2BMKB 3I3BA 3SDCB 1PLCA 3FFCD 4WI9A 3IGLA 1SXAA 3SO5A 1AO7D 3PPEA 1KXHA 1OB1A 5I18H 4LZKA 2A83A 3MI6A 5JIIA 1QLEL 3LQZA 3HE7B 2E7HA 4S1SH 4BFIB 1Q0XL 2HH0L 2YQBA 5DSCA 4Y88A 2NZ9D 4LMQI 3QUZB 4WHYH 3SY6A 3O2DH 4ODXB 4BELD 4W9EC 4ZX6A 4JJHA 3IF1A 1EGJA 3HS0B 4BCYA 4EZMA 3RBSA 5IV2A 1ICTA 1BQHG 1D5MA 2XVKA 4X8JA 4ECNA 1E7VA 3QHTC 5LQBH 2RAMA 4UOW0 2W1NA 3ZYZA 2NUTB 2XSKA 5E6IA 4HH9A 1NMCB 3GQFA 5D1XD 4NKDA 2QZ5A 4UILH 3QXDA 4UQ3B 3WDIA 3WJLA 3B9KB 4XNBA 1OQOA 5F6IC 4KRMB 5GRJL 1AFVH 4L0ZA 1A6UL 3UBXG 2H3KA 2QVIA 4L2LA 1JZIA 3L5HA 1AXTL 3M7FB 3B43A 4JQIH 1QSEB 1X5KA 2PYFA 2GSIB 1E50A 1IC4L 4WHYG 1C5DB 2WIIA 1E3FA 4HJTA 4LGPB 2V6HA 3VXRB 4ELKB 3HE6A 4P46C 4ALAH 1PZAA 5BXFB 5E9NA 4Q0XH 43CAA 1FG2B 3KBHE 5AB9A 3V0DA 4GFXA 2WZAA 1MNUH 3EGDA 1KBGH 1AMXA 3HMXH 4YDKL 2GAZA 3AC0A 3N40F 4MXQC 4JZJB 1GR7A 3U6RB 3MRJB 5IW6A 3IBOA 4OJEH 2PR4L 3GXDA 4Q6IB 4WDIB 4HK3N 5F9WC 1UH3A 3GM0A 3SDDA 5T3ZD 3LEXB 2MOGA 1AD0B 1TCRA 3ALWA 2HT4C 3HS8A 1CE6A 1FUNA 3LEVH 5CN2A 2NR6A 3X17A 1JNLL 5I30H 1HAWA 5EOTB 3ARBC 1F8TH 3FU6A 1AZNA 1IGIL 3UGEA 1QBAA 4AH2B 1HFUA 2BZDA 4CSZA 4Z7NB 4Q6KA 3FTGB 4H5SB 3UP6A 3B2DC 5J89A 3QBTB 4M1CD 3GMQA 4PJ7B 1KLFB 2FX7L 4WU5A 2Q5BA 5MHSE 1DQDH 1O0VA 4KI5C 5BOZG 2DQCH 3F64A 3JTSA 2DMBA 1VFAA 1CFTB 4HZLA 3GLDA 5DRZB 3WEMA 4OLYH 1XQ4A 3D85D 4PJHA 2VZTA 1CURA 4OT1L 3KYMA 1JWSA 1P4BH 3CVIL 2Y06L 4GO9A 5FYJD 3TF4A 1W0VB 1G7QB 3U0PA 4J3BA 3BT2H 4Q58C 4ZX5A 1JXKA 4PI2A 4RBPK 3Q06A 1MREH 3S3BB 2X4PB 1ZLVH 4R0LB 4KRPC 3VJ6B 4AL8C 4F5CA 2ZJSL 3CZJA 4IK6A 3EJPA 3FQRB 4F8TA 4EBQL 4OCRH 2ZKWA 4HUXA 1IQDA 4BV1A 2K4WA 1SMAA 3D18B 2CNZA 4PRAB 3KYNB 3QUMH 3L6FA 2IFFH 1NOAA 4FQXB 1HHJB 2AK1H 3H3BC 4PY8J 4P3WA 4JANA 2YEQA 3O3AB 4O58H 5DDHA 5AW5B 2ZD0A 4JFFA 4PB0H 3ZXAC 4URTB 4NZDA 4Y9CA 3GEFA 4HDIA 4QYOA 1TZHA 2G0KA 5A2BA 1A7OH 4OFPA 4P05A 4WSJA 2N1KA 2DQ6A 3DXAD 5T1MA 3B9EA 4Q9QH 2E4TA 4FKEA 4MMZB 4PJHE 3ERXA 1IEHA 2VL5B 4YHYB 1LK3L 2AV7A 1LK2A 2EQDA 5I1CL 1EJ6A 1TJIL 1X5MA 2R69A 3K6NA 4L8CA 3IMTA 4AJ0A 5FUZH 4M3KB 2AC0A 3ECUA 1NC2D 4N2LA 3KW8A 4CA4A 2CWRA 4XC3H 2C4FU 4F5CE 2W94A 4GRMA 3FH8A 4AC4A 3BE1L 3OJVC 5JXEA 2DPKA 1P6AB 4NKOA 5HDQH 1M71B 3Q2LA 5EDXA 2AQRA 3B2VH 3D25A 5C7ZA 3MV01 4PJ7F 1C08A 1RUKL 3MBXH 2KZBA 5T33L 2DQEL 1SOKA 4JFFE 3T2NH 4XMLH 5CLWA 4P5RA 5EU5B 4N8VA 1SBBA 1OTUC 3F3HA 4U6XB 4UT7L 2FO4A 1PY4A 3FS9A 3VRIA 4W9LC 1MH5B 1OSZB 1EEUA 3CC1A 4JFXA 3AS3A 4QHKJ 1V10A 3UXFA 2H26B 4MJ6B 5IJVB 3P30H 1SJXA 3ARGD 3D9AL 3FO1A 5AVUB 1M9WA 1WWWX 4ETQB 1AKJA 5BZZA 5AUMB 3EYSH 1G4RA 3SE3A 5KOMC 3H9SA 3QHZL 3GRWL 5ADOL 1I3GH 4JRWA 1EWHA 4UQEA 2BVTA 3MQIA 2DQDH 5IHZA 4X99A 3D2TA 1DP0A 3QUXA 4OD2A 5AZEH 1R3HA 3W9DB 3W5NA 1IBBA 3SIKA 4ZJ9A 4A37A 4EI0A 1PFCA 3DJZA 3EW3B 4YHML 1TJXA 3EGSA 4FKKA 2GJJA 2IBZX 3L5XH 4LLUB 2GEQA 3E80A 5GJSH 5AAMC 3BJLA 4G1EA 3VYNA 2ARJB 4JDTL 2MKLC 2WQVA 3MGTB 4UM9A 2R0LH 1M6OB 3T1FA 1XR8B 5FM8A 4D8PA 4YSQA 1IFRA 4L8BB 1QHQA 1M4KA 1M7DA 2NNAB 2XFXA 4JQVC 2KBGA 1EDQA 1HI6A 3VXSD 1DL7L 1FZMA 1RURL 4U1GC 5SWZB 5AKRA 1Y0LA 2NW3B 3IFPB 3T2LA 1ZV5A 1TKWA 2ZG2A 1TG8A 4K5OA 1U8KA 5J7CC 4LSDA 4IHOB 3BXNA 4ZFFB 5IESH 3LKNB 1OP3K 5T1LD 1T66C 2WP3T 3K4ZA 4J1UA 4G6ML 4AENB 3H9SE 4U6YB 4JL2A 4APXA 5BUAA 3QO0A 1DFBL 1MXDA 1OP4A 2MKWA 2OYKA 4ZUWB 3UBXI 3K3QA 3NZSA 4Y1TA 2D7NA 3C12A 4HP5A 1WGOA 1AGDA 4PREB 4TL4A 4FA6A 1C7TA 2BSED 2ZTBA 3EDJA 3CHPA 1L7IL 3BPCB 4MNHA 2ZCHL 4RZCA 1GVIA 3EO1B 3HI5H 3QAZB 5D4QA 3CDFA 2NY4D 3DO7A 1XGYH 4K8RD 3C8HA 4LEXH 1AQKH 3OC5A 1DQML 3MLVL 3RIFK 3DC0A 1GSMA 1I1AD 5CP3A 1CDHA 4HUKB 4XP6L 3EYOB 1S7WB 5KYXB 3BZEB 4P59H 4I9WD 1UEMA 4P23D 2CDFB 1I53A 5I0DA 2K78A 2AS5M 4XH2A 3LKRB 1DEEA 4RGMB 2J8UB 2BX5A 1CFMA 4NCC2 4U7KA 1OXYA 2ZX9A 5E0QA 1QFWH 5BPPA 4ZFGL 5IFAH 2CDGA 4YBQC 4TQ8A 3U6XS 5AVWB 4FEIA 5I1KH 2OR7A 1ML0A 1Y6MR 1J8SA 3TCLA 5GJTH 5AOMA 3ZTNL 1R5IB 3LQAC 2ZUSA 4DCQB 2NY6B 3GXFA 2E86A 4GXVH 5HHOA 2OXHA 5A2AA 2GFBA 2XDHA 1PY0A 3GS7A 3OB0K 3OKMB 4RMTA 3VE0B 1JS4A 2VLRD 3VB9A 3CVHA 3DV6B 2CHNA 3QG7L 4M6OL 4HOXA 1P7QA 4XBPA 5IMKA 3ARZA 1AP2B 2WCPA 3F6IA 2R56L 2FHBA 4N0FB 2YAEA 4G9FD 1MFDL 1RV6X 1IKOP 4MA8H 1PX3A 1SHSA 4YHZH 5E0FA 3BRDA 4PCKA 4C4UA 4JO3H 4NO3A 1P2CA 4Y19B 5DHVH 2Y1YA 3LDBC 1GPOL 1X4ZA 2N4IA 4BXVA 4I2XA 2H32B 4JHWH 5FXCH 3ZU8A 4AUUA 3D0VA 2PMZA 4I3GA 3SKOB 4WO4A 4LRNL 5DWUL 5HGBB 2Z35B 1KPRB 1YUKB 5HI5D 3VG9C 1RSFA 4XMTA 2AJYL 1FVDA 3BQUD 5D1XC 4BSWB 4OAWA 4G7SB 1BFVL 1RIHL 2E9IA 4LLWA 1EH9A 3O9WA 2CG9X 4D9LH 5FB8A 3KPOB 5DEJA 5HHOE 5D7JC 1F13A 5DUBB 3VQ1C 3G5VB 4C4KO 4IU3B 5TK2A 1OGTB 3CFDA 5SWQB 1ZXQA 3WFDL 5E08L 5GGQL 2X6AA 3KPPB 3BO8A 5C0AA 2D2CC 2FWLB 1JYWA 4NUQA 1QOKA 2W07A 4PRBA 1MJ7L 2WNKA 4B9KC 5H37H 2Q76A 3CX2A 1MF2H 1M05A 1VFUA 2BVOA 4MQTB 2J8UF 2Z0UA 4URKA 4M43L 4AM0A 4Z77B 5KEZA 2CBTA 5IGXH 1KBKA 2YXMA 2HN7A 3OKDB 4I2XE 5FWQA 1Q1PA 1T5WA 2EDYA 4FI7A 3SDXB 3T4AA 2KH2B 3OWRA 3LZFH 4GUPB 3CFQA 4S11A 5C09A 4XX5A 1PD6A 1SMOA 4TUKH 4F7CA 1G0XA 4GSXA 1E4HA 4WEMB 5HYFA 4LSSL 3A6CH 1RJZA 1W2KT 4BD4A 6FABH 3U9PL 2ED6A 3C08L 3BDBA 4M1CC 3KDPB 12E8H 4H26A 2KPNA 3QPKA 1CI5A 4H1LH 1U3YA 4FZ8H 2DKUA 5FLVA 4HKZA 2O4EA 4M6ML 2AABH 1VGEL 2M26A 1IM3D 1OPGH 3NFSL 5C0AE 4WWOA 5DHYA 2BRRL 2A9DA 2J20A 3IXAB 3D09A 3VD0A 2Q8BL 5ALCL 1EO8L 4PJGA 1KCSL 4UQ2B 3DSFL 5GRYA 1NTDA 5C3TA 4FF9A 4HV8B 5CAYB 3GSRB 1E5UI 3B7TA 4NJAL 3N44B 5C0RL 5ACZB 3O6LL 3ECBA 3OMZA 3RWEA 1CXHA 1LEKB 1UKTA 4H1LG 4N9GB 3VFGH 3BDYL 1OB0A 1USQA 5EORL 5C09E 4HUCA 3S8WA 1C16A 2F8IA 2BP8A 3AS0A 5E7BA 1L9PA 3VA6A 4YHPB 5IQ7H 2LTQC 2Q7YB 3C2SA 4PVBA 4K7PH 4ABVA 4Z3FA 1LXMA 5J1AA 3PUCA 5JIHA 3IJHA 3QIWD 1CZ8L 4WU7A 3OZKA 5F3BB 1BZEA 1TVHA 4JFHE 2V5YA 3L9RB 5LB1A 5IFJA 1ADQH 3B1UA 4XVTH 5TDNA 2SEBA 1QR1A 3BWAB 3AAZA 5BRZD 3TWCH 5E4IA 3SDXF 5E9DA 4IBQA 3I3DA 1FHGA 1BW8A 4PJGE 4X6DB 3LRSA 3QCVL 4IBYA 3X12A 3O2VH 4G82A 1Q0YL 2CIIB 4YPJA 5L2KB 3UEQA 4HIEA 3CN1A 2DRUA 3BZFA 2IPTL 2OMZB 1CLOL 5BZXA 5JHDA 2NZ1A 1HNYA 1H3TA 1U8CA 3QXTA 3TFKD 1TJHL 5AYUH 1CFVL 5D55A 5HGHB 1HTYA 3MCYA 4TQPA 1WEJL 4LAQH 3VCLB 1UOKA 5KVGE 5DK0A 2MRYA 2F53B 4G7RB 4K5NA 3QORD 5JIMA 4TNVF 4X7DC 5F0JB 4YEEA 1Z32X 5EU6A 1LWHA 3RVWC 2VLKD 1TDQA 4JBSA 3G6JF 1NPJA 2ICWA 4LOVA 1BWWA 3GSOA 3TBSB 3ARGC 2HCZX 4KJQD 3OTTA 1MAML 1AJ7H 4HPOH 5FUCE 5GGRB 5DK2B 1FZOA 3P4OA 5J57B 2B77A 1NFIA 2ZAIA 3MA9H 3N44F 2WLIA 2YMTA 5IIEA 5HDLA 3CFJB 5E9DE 3RPBA 5DJ6A 3NEEA 2P80D 2NY1B 1NZRA 1DVSA 2A74A 4QWWD 5TPWH 4JCMA 1ACXA 1K4DA 4OV5A 2DLGA 3INUL 4AQOA 1EEZB 3X3FL 1SN2A 3GSXA 1M53A 2ZUVA 4F37K 2ARJQ 2ZX5A 3FQUA 4BZ2L 1ZHLA 5JHDE 3SJVA 1A66A 3FU8A 3ZO9A 1NH6A 2X7LB 3QNZA 5ID1A 1P4LA 2G3ZA 2ORBL 3P9LA 3G6AB 4GQQA 5FDYA 1RZ8B 4PRDB 3SYAA 5I1IH 1EJFA 4GKZB 1LMIA 1BJ8A 4HEPA 1U95A 3GSWB 4DT2A 4J3OH 5A6LA 3LS5H 3ARTA 4JDEB 1RIVL 3FOMB 3VMNA 1G0DA 2BVPA 4UU9B 1A1MA 3LN5B 2YGOA 5DJDB 1HHIA 1WFIA 5ICUA 1YEJH 3VH8A 1M1XB 3PV6B 4RRPG 5F97E 1UACL 5KUMA 2H6PB 4BXSV 3CV5A 1MFUA 4XNYL 1YC7A 2RQEA 1P5UC 3MRGA 3RVVD 4LPYA 3D4CA 2GHWB 4O9HL 1KN2L 1JRHH 3PJNA 4LPCA 5L8JB 2PP7A 3S88H 2A9MH 4NPYB 4O2FA 4LCCA 3JUYA 4TMPA 1O6VA 1JZFA 3FFDA 4YHIA 3GIZL 1VKXA 1UXSA 2XTJB 5CLYA 3GSNA 3IPBA 1N3NB 1I7TA 5CBAB 1GY1A 1MQKL 2X41A 2NY4C 1UD5A 1YPZB 3P2BA 5DD5L 4A67A 4OGQC 1MFMA 2R9HD 5CJXC 4K8RC 3SJVE 2P49B 4ERSH 1SNRA 1R24B 3KNBA 3LKSA 2P46B 3P02A 3ZQWA 3NJMA 4NP9A 5DMKB 2DH2A 3BFOA 5DJXB 3FPYA 1I1AC 4FXGA 4JREC 4RZKA 4UQDA 5IMOA 3IETA 3DBXA 4TULH 5J3HC 4BKLA 4ZYKA 4P23C 5D93C 3PDDA 4UV4L 1T1YA 3EBAA 1BG9A 1E5BA 1U4FA 1QTSA 5HHPA 5SX5K 1AC0A 4AITA 4NSKB 4S1QH 4ZMNA 3GB7B 2VJ8A 3V0FA 2YPLA 2YQ3A 5L88L 1I8LA 4AY0A 2CGYA 3FTYA 1YCSA 4AV4A 4RQQA 1O7VA 1XH3A 3TFBA 5MEQB 5KBDA 1DO5A 2EAEA 2Q6WB 3DJTA 1KJ2A 4LGRB 3UDWC 1WWAX 1OW0A 4KJPC 3CSGA 5IVXA 2AJXL 2G4GA 4DEUA 1RZGA 5EO1B 1Q94A 3I50H 4HOWA 1XD1A 3FTXA 5I2IA 3HJEA 5IBTH 4PGEA 2W60A 4QXGL 4LP8A 3FPXA 2F15A 4ODUB 5CINH 3MOBL 1XIWB 3HBQA 4HJGA 4K3EH 5CEZD 2A77H 1J0HA 5LBSL 4FTDA 1A6WL 1QI4A 4IGBB 4NZTH 4HG4J 7PCYA 4LLVB 4EIBA 2B0SL 4G83A 5IROD 1TZIA 3BW9B 5E2TL 3JWOC 2JKNA 1BXAA 5BZDA 2FEEL 1I9JH 3VXMA 2BP0B 2VITA 1NCOA 4HIHA 3BUYB 4PRHD 5JA9A 3TC9A 2WKLA 3SYQA 4B3EA 2YPLE 3CZKA 2NDGA 3QR2A 3Q05A 4GW1B 3L3IB 1UC6A 4KKPA 2X70B 3VFPA 3WLBB 1QLRA 3EHBB 1EUUA 5HYIA 1E7UA 3KJ4B 4HKJA 5IVXE 3ZYJA 4Z8FH 3GEWB 1QFWM 2AF2A 2ITCB 3ZL2A 3UYRL 1LJMA 1H9DA 1UURA 3CZGA 1YNKL 3NCFB 1OE1A 1R5WA 3PQYD 4I0PD 3DX9B 4PEEA 5K59E 3G04A 3CN2A 3R1GH 1YA5A 1JCVA 4HWZA 3DARA 1Q90A 1NICA 1QEWA 4L4VA 4OF3A 2GI7A 1T6BX 3QHFH 2ZWKA 4AL8H 4I3SH 4DF9A 2HJFB 1ZT4A 2Z92A 3QYCA 4DZBA 3O8XA 4WFGD 4P4KD 4PCTA 2BSTA 2CJSA 3RI5K 3T65A 2FECL 5GGVL 3VXME 4I18B 4F33A 2LLNA 5I8OL 4M7LT 2K3TA 3LKPA 4G8GB 2H3NA 1W72A 5AD0B 5C7XL 2EVGA 3HR5B 3SDAB 3TCXA 4H1LB 1SUHA 1WCQA 3WV0A 2ALWA 2XRAL 4YDLC 1NBVL 4PGDA 3FO2B 2WXFA 3LEYL 2WBJB 1XGPB 3PXHA 4NKMB 3F12A 3T77B 3OAUH 1AC6A 5DA4A 2E7MA 4E9LA 4HJEA 1Z5LA 2DQJH 3C5JA 4JM2A 4KOCA 3HBGA 5T1KB 4NJ9H 3AROA 3MNVB 3NH7L 3KPSB 1JNNH 2QQLL 1B4TA 1EIBA 2Y2WA 4H25B 1CS6A 4X4XA 3EJQA 2ZIDA 3FBQA 2EACA 3LXCA 4XNZC 4Q14A 4L4VE 2OQJA 2M1KA 2WMPA 1JK9A 4GJTB 5C0GA 4NO0D 4OZIA 1E27B 5DJCB 2CO6A 1I7ZA 3ZE1F 1REIA 1JMZA 4XVSL 1R33A 4JPSA 2IDUA 3B7RL 4NT6B 1HL4A 1M7IB 3D33A 4AV0A 6TAAA 3VWJD 3WEXA 1N64L 4ZS6D 5C0BB 2D4DA 5FYLE 3K5SA 1JVLA 2ZYRA 4QKXB 4XP1H 1F90H 2G2PA 4DJMA 1N6QH 1IM9D 2OLDA 5ACMA 2ZUXA 1IKNA 5KSAB 2WPGA 5F1IA 2HFFB 1B0RA 2IH1A 3WKQA 1NAMB 3QIWC 1U8LB 3K72B 2Q3XA 5C2BH 4Q2ZA 4K7PX 3DUUB 4P2RD 4Z5RB 2R1WB 2BP3A 4FS0A 4NM4L 3FHQA 5DUPL 4XBMA 3Q13A 4L4TD 4GBXA 1MG2C 1AS7A 4HCGA 5IBUG 2H47C 5FYKD 1BVOA 3T2OA 1I75A 4J4PD 1JN6A 5K39A 4Y2DB 1KGIA 4A04A 2AFNA 1AZCA 1XZ0B 4HWBH 4OZIE 1FNAA 1ORSA 2R29L 2F7RA 3EOTH 3RA7L 3BWUC 4Y5VA 5A16B 4DN3H 3GBML 3TNMA 2C3VB 3VQLA 4ZDHB 5BV7C 2VR5A 1T89C 2WSKA 5E2WH 5I66B 5AW4B 2KZWA 2XQYG 1X7QB 2CE6A 2X4QB 3QIUA 5L4IA 4PN6A 3UEZA 4AIOA 1AD9A 3GI8H 1K8DA 4EN3D 2E5EA 3HHSB 4MAUL 1UVQA 3MRDA 3P4MB 2J1YA 3AITA 1JRHI 1T83A 3V4VH 2PCXA 1UD6A 2GIXA 4U6HB 2MQCA 3RY4A 3L3KB 5CJQL 1F6AA 2BNRD 3GT6A 1YEGL 2PXYA 1J1XH 1F4WL 1DCEA 4KJQC 3N1FC 3P4NB 1I4FB 4RSYA 3IJEA 4AQAB 3IGAA 3KM2A 2J1XA 4PGCB 5AKVA 1OALA 4MA1C 3AWGA 4TQHA 3QNXB 4QWWC 1UWXH 3N5AA 1DVFA 5CGYD 1ASPA 4UTCA 1U8JA 4HS6B 3KLSA 4I85A 4Y1AD 3GI9L 3FQNA 1D5IH 2UY7B 2XN9B 5DURB 3V0IA 4Q9RL 1FIGH 3B7UX 2XJLA 5EIQA 4OCWL 3QQNA 2Y5QA 3FQ2A 4XCYB 4TVUA 1I9IH 4YPGA 1EV2E 4BYHA 4Q9BA 3S5LA 2EYRA 3IDYC 2ZZUT 5FGBA 2CO4A 3CMOL 3IGUA 3MGOA 4DGYL 3MYJB 1KB5L 3CPLA 1TVDA 2CK2A 3L3HA 5T5FA 4MAZA 4PTUB 4CJ0A 3AXIA 4NQXA 2P42B 2WLLB 3KPQB 2FWOB 3H1ZA 4PLNC 4PP1D 4JGJA 3RVVC 4ZMOA 2BS9A 2Y7NA 5F7EH 1GZQB 3DVGA 1NJ9B 2OKMA 2OMUA 3LH2L 1T03H 2VAAB 2BSRB 5EBMA 3V7AG 2XZCH 3LQAH 3MUGB 3QARA 5CN3A 4AVIA 3PHQA 2X88A 3IJYB 4TN9A 2X6BA 4IOSD 4JW3A 3VFOA 1ODUA 3VI4B 2V7NB 4NQEA 3X1NA 3TBVA 4ORGB 5C07A 2R9HC 5TQ0H 2ILLA 3LNEA 2LHAA 2Q8AH 2CO2A 3ATDA 1J7VR 1MHHB 4WKZA 5AWNH 1YLBB 4OJFH 5F1KC 2VW6A 35C8H 5HJ3B 5JIKA 5KSBA 1GW0A 2CK0L 5IT2H 4M1GL 1ZTXL 1FJ1B 1YEDB 3CXDL 1OD7A 2B20A 4I89A 4LT7A 1CGSL 2J6EA 3W9EB 3WL9B 1ZWIA 4GRLD 2WV3A 2X10A 4AIEA 1GCFA 4N0UA 2ICES 3SE8L 1P9MA 1GOHA 3N41B 2R2EB 4KK5D 3UPAA 4X0KB 2WZPD 3KAAA 5C0FA 5J13B 4X7SH 2OCFD 3DK2A 3FU9A 1NGQL 3QPQD 1ZSDB 5FCSH 3VRJB 4XCCH 3EOAB 1E43A 4ENED 1MUJA 1AE6H 5FIEA 4X80L 4XBGA 1AXSB 2DI8A 4F92B 4QLWA 3B3BA 4MRCA 3EO9L 4NQEE 2UY6A 2XBTA 3TVMC 3X13B 5C07E 4PS4H 3U82B 3CSPA 2YC1A 3IDNA 1CYXA 3KH3A 2VOTA 3KHOA 2AMUA 4OM1L 2VXUL 4KZDL 4QRFA 1BQLL 2IO5A 3EJSA 4QRPB 5EZJB 1IAKB 1MCWM 2YN3A 4OCSH 4UTAH 5KSBE 5SV3A 1KGCE 3KYKH 4GXUM 5T3ZH 3FU5A 1X7SA 2F19L 1P7BA 3WNPA 4WTZA 4DTGL 3ARBB 4W93A 3MTXA 4AEHH 4K2UL 4N0UE 4ODHL 2VISB 5JQ6L 2YPKB 3WTWA 5IQ9A 2CGZA 4LPWA 1FL5A 4V2BA 1INDL 2DIJA 3HUJF 5MEQA 3OKEB 1JPFB 5DS8A 1SJHA 3FN0L 5TTRA 4AXWB 4Z7OB 1DLFH 3ESVF 2GTQA 3MKKA 4V1DB 2XIBA 5C1MB 4OLWL 2X6CA 5LO7A 2ZXDA 3U9WA 4HBCH 1DVUA 3OKLB 5JNYA 4FTVD 2WO3B 4I0PC 2RALA 4TOYH 4QI3A 5FYJH 3TA3D 3Q5YA 4NCC1 4AYEC 1MFCH 5CMAA 4DKFL 4KX7A 4NB7A 4NRZA 3R7QA 1NKRA 1X4YA 5AALA 4KRPB 1S5IH 4QTHA 5D7LA 1DBBL 4NIYE 4XT1C 2ZCLL 1QNZH 3GUTA 3N41F 4LLMA 1UB6B 2D7TL 2R2HA 2WBKA 4LIQL 1RZ7L 4CADA 4E5XB 4R90H 1YUHA 2HKHL 1IVTA 2X28A 4P4KC 4GSDH 3G5ZA 4LCVA 3ZE0B 4P2OB 3CZFB 3MV8D 4MA7H 2A6DA 5IY5B 4OJYA 4OKVA 5IJKA 3ARFD 1RUPH 1W0YT 1V7NL 3CDGA 4JPWH 3VI3B 1A14H 1MCHA 4YLCA 4NM8L 1FNEA 1HEZB 2BHUA 2J1WA 1BPLB 4UAHA 1E6OL 1B90A 3SGEH 2QMKA 1XTLA 4KUCD 3T3PB 4ZSOA 5D9SA 3WENA 1BFSA 4IDJH 3BP4B 5D70L 4CSTA 2V17L 4XNAA 2GABA 2EH7L 1DQJB 3TESA 1QTYT 3CX5K 1TTAA 5J5EA 5FLUA 1DUZA 2V5SA 1FH5H 1OAYH 1F3JA 2HWZH 3JV5A 1SOQA 2P5EB 5CGMA 2AEQH 2NY5L 3F7QA 3L4YA 8FABA 5D7LE 2H9GA 5I18L 2WWMD 2QV2A 4U1JA 3AXLB 5TDPA 2BZCA 2EIEA 2IAMB 4IJ3C 4U1SA 5TH2A 2B14A 3SB3A 4A7GF 4TQEH 5JLZA 4FI8A 4O2CB 4PCSA 4MJIA 4W9KC 3AG4B 4BHUI 3D6GA 3O2DL 4Z7OF 1UGKA 4KI5F 4ZFZB 3VWJC 5AYTA 4ZS6C 4YQXL 4PJXB 5E6RB 1WHPA 2UZXA 1TCMA 2GTWB 3EH3B 4QXUH 1IIKA 2IANB 3D52A 4QRRD 2J21A 3H9YA 5K9QG 4R5VA 3JVGC 3GUFA 3OQRA 5DGRA 1NL0H 3BGMB 4OZGA 4MKMA 3RWGA 1FBIH 1OAKH 3PY9A 1RZIA 5DTFA 1XF4A 4UILL 1F3DJ 2ZXQA 2DV6A 3CQFA 4ZSOE 1GL4B 3GHEL 5B4MD 1E9PA 2R0KH 5A2FA 2GJ6B 3UTPE 2JV6A 3FKUS 1EHLL 3FT3A 1LO2H 4J4PC 1NINA 2VDPH 4YXHH 3G5XB 4ALAL 5EPMB 1IX2A 2UUDK 3C5ZD 3REWA 4MAYD 2VSDA 4X6CA 5F7WC 4GMSL 5MEPA 1MJ8H 3O3BA 1MW3A 3OZ9H 4K0OA 2QGCA 1KBGL 3NCYS 3Q6FA 1WZAA 5TFSH 5DC9B 3ZDWA 4NRXA 2ZKHL 4KV5F 4M62H 4OFKA 4P2AA 2PPFA 3GTNA 4MJIE 3BAXA 4Z7UA 2BHYA 4BFGA 1JFQH 3ETTA 1TQBB 4WWKA 3LX9A 2V2XA 2EH8L 5IW3A 4EN3C 1X9QA 4U1GB 2EDLA 2EIZA 1R9FA 4OZGE 3LEVL 1YY8B 3Q9PA 4J3TA 3VGBA 4MA3A 2WXRA 4OW6A 4YL9A 4HU8A 1T0OA 2YD0A 4Y4KA 5F7FA 4FQCH 3M6DA 1J8HB 3NSXA 2BJMH 4BZ1H 1IL1A 3KEDA 3PWVA 4PWIA 2BSSB 5LCVH 1A5FL 2E9JA 1A3RL 4P5KB 2NNRA 1KLUA 1UT1A 3FUEA 4WGKA 5CUSH 5EO9B 3MGAA 3U0TA 4NEHB 1MIEH 2YAQA 2QPFA 3DGGA 4MB1A 5EF2A 3L17A 3D7PA 4X6CE 2VIRB 1GTFA 3CLEH 5CZXD 3LRHA 1RFDH 3NSFA 5CGYC 3BT2L 3U7WL 4GKOA 1HXYB 3MRBB 1QRKA 1KV3A 2MPVA 4HJSA 3VFTB 3CFCH 1G6RB 4Z7UE 2MHAA 4K8RH 3VSUA 1KC5L 4MJ5B 5D1ZD 1PJ9A 1NGWA 1U8IA 3NIFF 1OF0A 5BVPL 1NAKH 3LZPA 5D2LB 3X11B 1QPPA 3IDIB 3SGDH 4IEFB 2UX6A 2VQ1B 4NUJA 5I1LB 2QKIB 2A2QT 4OKDA 2W9DL 1Z9SA 3AREA 3MRNA 2JB6A 4O58L 1HT6A 1A65A 2ATPA 3ES6B 3LIUA 1R1CA 1OKEA 3LHAA 1OCRB 1G9NC 1CDJA 2CA3A 1F3DH 4FN0A 3U4EB 3AT0A 1JGEA 3HZYB 3BP5A 1NIFA 2I5YL 2XN0A 4KDWA 3V5HB 1W15A 3BDXA 1OB1B 3QE5A 4N5ED 2YWZA 3ULVE 4N5UA 1HCVA 5KVEE 2AQTA 5DZAA 1FVEA 1CDUA 1UWFA 3BPNC 3CSTA 4U7MA 1H5BC 1VEMA 5IOPB 1G7HA 5FUZL 4PMFA 1NBQA 5J12B 3TYGL 4M5SA 1M2VB 3AMKA 5G55A 3T0AA 1DR9A 5IFHH 2E8YA 2ZXEB 3QFJA 1WD9A 4YJZL 1D5MB 4QOKA 2EDEA 4A7VA 3K81A 3N9GH 2NQCA 2MNWA 2XG5B 4KFZC 2BVQA 4XVJH 3JWOH 4NKDB 3QW9A 4TNVK 2PR9A 3L2NA 7FABL 2VLLB 4DGVL 3T2NL 3JWDL 3MBEC 1NUNB 3S35L 4RWHA 4KK5C 4LSVL 1AZRA 3Q6GH 1ZLVK 1WAEA 1SMDA 2PYFB 2Q2EB 1YQ2A 2WIIB 5B3SB 3GXMA 4LSQH 2ZPKH 3N40P 3QPQC 5D7JB 1EMTL 3P30L 1TO5A 5EIIG 5AG8A 2KUTA 3WTUA 2FDBP 3SCMA 4ENEC 3LHPL 3LRGA 4K94L 3CXHJ 3VXPB 4F3FA 1ITCA 2C4XA 2XVLA 3BGFC 4U1KA 5DZ9A 1KJMA 5ESQA 2GAZB 4LSRL 5TF0A 1O75A 4HD5A 2FBRA 2N59A 1RUAH 4NKIH 4PAZA 5D2LF 1UG9A 5IW6B 2B5IC 5DJZA 2GBVA 1CT8B 3SKJH 3SDDB 3QFJE 2NDFA 2YGQA 4QOKE 1PZUB 1TCRB 5FGRA 2LAGB 4XXWA 2XWTB 3CDCA 5AW2B 5E6ID 1A64A 5GZNA 4F9LC 5GJSL 2NUPB 2EKJA 2WINB 5CJBA 4AEIL 2HJLA 1BVNP 2QQKH 2VN7A 3NRFA 3FZUD 1B3IA 2YMXL 4PJ9A 3SGKA 4PLKD 1HS6A 2HZHA 1P7HL 1S9KC 5MHSD 5HVHC 4AG4H 1S5HB 2R0WL 5DUJA 5K9QI 3JTSB 4R9HA 1VFAB 5F7UA 4UOW1 4HMCA 1KELL 2H6OA 3FYIB 4PJHB 4U49A 4I0CC 4YFLI 3CZLA 1JWSB 4WWPA 5HHVH 4WI2A 3KLQA 5IESL 2E9WA 2CBOA 1I1RA 4KO9A 1HH9A 3LKOB 1SRDA 2D03L 1KB3A 3NFNA 4WNQA 1XCWA 4PV8A 1TQVA 3TA3C 1LEGB 3CQPA 1HSBA 1C9SA 4XHJD 3HI5L 1KZQA 5C0CD 1MFBH 3HG2A 1E6JH 2EP6A 4ZMPA 3L6FB 4LEXL 1LVEA 2AJZA 2NR6D 5HJDA 4JANB 2XPGB 3OBAA 4ONGL 4JFFB 4LQFL 1QFUH 2OSWA 4P59L 1XL4A 4ONHA 3ARFC 3KLAA 5E5RB 2LABA 2C3WA 4QYOB 4XAKD 2LTQB 3GBEA 1CDYA 2I60L 3H9HA 5DD6B 3C6LC 3GM8A 3HFMH 5T1MB 2YD5A 1QFWL 2UZIH 2A6KB 2I24N 3ORJA 3GMPA 4M56A 4O00A 1LK2B 2TSBA 3EG9A 3MV9A 4HUWA 4JAMA 4JN1H 2X3AA 4JO2H 3UP1A 1H3XA 3V8OA 2QQNL 2OYMA 5E8EA 1XXFC 4JVWA 3U1PA 4GRWH 1L9MA 1I7UA 3L5WA 5CJ8A 3S4SG 5K9OB 4GXVL 5DMGD 4EI5A 4MD4A 2CJUH 3VB8A 4Y5YA 2C9AA 1NC2B 4GRMB 1RZFH 2GCYA 4O5LL 2WWMC 1PZCA 4NKOB 3S0PA 3SZKC 3D25B 3T0ED 1SYVA 4P2QD 1C08B 1B4JL 4HQQH 3FQWA 4P3DA 4U0RC 4OSUH 3OJDA 2VXTH 4IBZA 4QHNB 4S1DC 3LRMA 4CSSA 5BV7H 5GSVA 4B50A 3MU3A 2GITA 2Y23A 4N8VB 3WXWL 1IIIA 3AZUA 1T0NA 1JDCA 1MIML 5J6GA 4JHWL 3VRIB 3UTZB 4JB9H 2X2HA 5ABZA 3FQ1A 1T7ZA 1FGNL 4G59C 2WYTA 2C9QA 2WTPA 3FO1B 3PGFH 4JRXD 1TQCC 1ID2A 3ARGB 3MV9E 5B4MC 2CHZA 5GGTH 1NCTA 4D9LL 2CCLA 1TJMA 2IMNA 1AZVA 1NMAL 2ZKMX 3ARVA 5EOQL 5I9QC 2EUWA 3NABL 5F7DA 5IHZB 1CDCA 1YQVH 1HILA 1TEFA 2AEWA 3EDEA 4OD2B 2HKFH 4TVPE 4G80A 5F1NB 2RD0A 3INOA 2ADGA 5JXED 2VDLH 5C6PB 3MLTB 1CL7H 1PS3A 1JHKH 3KXFD 5F0LB 2WP3O 3KWXA 3C5ZC 2CKBH 3FH7A 5GGSB 4MAYC 4JFZH 3ALPA 3IJ7A 1J8RA 3ZHKA 1GGIH 1RZKH 4UM9B 2ZUTA 3SGDI 4Y9FA 4CDHA 1MF2L 4NN6C 2XFXB 1IO4C 3RNKA 5JDJA 1UKSA 4K55A 3DGDA 3MXWL 5IGXL 4PBVC 3MRMB 3HNTH 2R2BA 3GSVB 3MRHA 2AJSH 2ZXWB 3FSWA 2H2SD 4PJ8A 5BUPA 3M7OA 4YFLF 1KOAA 4PCYA 1A7RH 5BJTA 3JV0A 5CILL 2AXGB 1TIUA 1O6TA 3JUZA 5HP5A 1KYUA 1UADC 5DD3H 4LPUA 4B9FA 3H9SD 4APXB 3MRCA 4RFEB 1A21A 2BSBA 2FAUA 2G3NA 3NESA 5T1LB 1OF2A 4LRIA 5HDBF 2OK0L 2EUXA 1FZJB 4BQCA 4K9EL 1ZSHA 1MCDA 1AGDB 3QUXD 4MS8C 4FZ8L 2VRAA 4R97B 2NTFB 1ZVSB 4MNHB 4IMKA 4NO5B 2BNUA 4LEEA 1OPGL 4PI0A 2V9QA 3OAYH 1XGTB 5I8KH 4DGUA 4NBZB 5CZXC 1CD1A 4AW7A 3WFBL 3AY4C 1U3HA 1NC4D 1NBYB 4JO4H 5DWPA 5G4OA 3VAEA 1MWAA 2W80C 5GGUA 5KTEL 1F1DA 4FQJH 5F9JA 3ULUE 4MMYA 3VGEA 2CUMA 2XIDA 3FH5A 1UGNA 5D1ZC 5E5MA 5B1JC 1DJXA 1A3LL 1JFHA 4XH2B 1DEEB 4NC1C 4NFBA 2N56A 4OLZH 5JPNC 2VWEC 4X6EA 3RAJL 2PCFB 4NWUH 3MZGB 2RTTA 4GS7B 1QFPA 1A4KA 2MOVA 3PGDA 4XPFH 3ARDA 1FNSH 4DVBA 2F58H 1LE9A 3C2AL 1S7XA 1HHGA 1FFPA 5HHOB 2Z9TA 4G6FB 4QY8A 2X1OA 3SBQA 4JE4B 4N5EC 4PRIA 4Y5XC 2OL3A 2PETA 4N0YH 3CVHB 4HWEH 1KYAA 1GYWA 1A6VH 2F1BA 5FX3A 5IMKB 2VLRB 1UQSB 2BZ7A 4YE4H 1AQMA 3D4GA 3MJ9H 4M5ZL 1OO2A 1IT9L 1AI1L 3TWCL 3RGBA 5J6HA 4G9FB 2OYPA 1N59B 1BAGA 3HW7A 2OYLA 2D3JA 4NO3B 5DI8A 1D2OA 5CEZH 3O2VL 3PYCA 3MLRH 5M95B 5CWSA 2Q86A 4I2XB 1FFOB 2BRQA 4DZ8A 5DJ0A 3D0VB 5A6MA 4KZ0A 1VFOA 3PWPA 2FYYB 3N1PC 2IIJA 4ZW6A 4OLXH 4XBEL 4FCAA 3FXIC 4BFKA 1YDPB 5BZWB 1MHCB 2OMXB 3MLYL 4LLWB 4R8WL 5CJOH 1KPVA 4R4ND 3BSZA 4AQ8C 4XOAA 1SYSB 4ODSL 1OL0A 3FB5A 4K5MA 1DSFL 4HUVA 5GRVL 5JDSA 3JTBA 3V4PA 1M3IA 2Y1VA 3CFDB 4PRIE 1WP6A 1ZHNA 2ENYA 3BO8B 5C0AB 4ELMA 5LDUA 5EOCJ 2CR3A 4F8PA 2W07B 4PRBB 5E6YA 1FORH 3DJRA 4HPOL 2NXYC 1WFOA 4QEGA 3AQZA 1M05B 2EEAA 4IHBA 3PS6A 1FCCA 4UTBL 2NCMA 2I69A 3V0VA 1GS8A 1XB8A 3HAEA 4OV6F 5JR1L 2VDOH 5KYUA 1N5AB 2Q9OA 2WQAA 5DQ9B 3D39D 2HN7B 3LXAA 4FXKA 1T5WB 4PJ5D 4Z7IA 5A3ID 4G6JH 3ABKB 2WWKT 4W6YB 3L1OH 3MRKA 1FNLA 3FF7A 2P43B 1AG6A 1Y1DA 3PWPE 4EDWH 2W5PA 3MR9A 2D7MA 4UIKL 4F7CB 1P6WA 3RKPA 4CMMB 4N2IA 1YMMA 3O9WD 2CAKA 4NN5C 3FZUC 1N8ZA 2IDTA 1BQUA 3LS5L 3QUHA 1SVBA 2QMJA 4H26B 2ZWSA 1AACA 1W8EA 2K1MA 3DMMA 1OAQH 2BY2A 3KVDD 4OZFH 5AFAA 1DLHA 2EDMA 2IDCA 3JWNE 4IOFD 2P8PB 1CG9A 1VERA 3GXTA 4WUKH 3H53A 2NSMA 2ODHA 4ELME 4NC2B 4KJWD 4GQ9L 3PABA 4KQ3H 3S97C 1A7PH 1NLDH 5DHYB 4X4YB 1CFQA 2FQDA 5KUKA 2LU4A 4FJ6A 5F96L 3UBFA 3IFNH 5FKAA 3T0WA 5LKNA 3VFUA 1JPTH 3GJEB 3QNYA 4P5TA 2R4RH 4G8EA 4XNZB 3NIDB 4N8PA 1UOVA 3DTDA 3D4YA 4H8HA 4IS6B 1HE7A 4N2BA 4XHJC 3MNWB 3PFUA 3ECBB 3RWEB 5ISZB 3UC0L 5MP6L 4OZFG 4CNIB 3IKCA 1JF1B 1DVXA 2NR6C 4N2OA 5IB1B 4M6NH 5C09D 5I1AA 1C16B 1YMME 2KLRA 2IGFL 1LL1A 2E74C 4OCXH 4U1IA 3QZBA 3PHAA 5IB4B 5CM1A 2JKWA 2NSQA 3VXTB 4AIXA 4X5XB 4GEIA 4ZUTB 3BSGA 5CNHA 3NACH 3DX6A 4WU7B 4P3CL 1JWUB 1TVHB 1T22A 4JFHD 3QIWB 5FM5O 4GKNA 5IFJB 2JB5H 4KO5A 5TDNB 1PD1A 1QR1B 1CL7I 2DM7A 4MNQD 3AAZB 2ZWNA 3NJIA 1AIFA 5TE4L 4N6RB 5LG1A 4WWID 4NQCD 5EC2A 1G7IA 5DMGC 2VSMB 3C09C 3LRSB 5FA3B 4N1EA 5FYKH 3I75B 1CGYA 3NQKA 3V4LA 3P3TA 4HIEB 1IGTA 4HJJH 5FWRA 3BZFB 3VYPA 2DWEA 2VW7A 2MJWA 3T0EC 1U8CB 3NGBC 4NWTL 5E23A 5CINL 4BSVA 4LLAA 3BLPX 4BKSC 3QEHA 1ZLUK 4OFDA 3NCMA 4JFQA 3WHXA 4Y1SA 5LBGA 3V79C 2OTPA 3LNDA 3N0PB 5T3XL 3G08A 4FC3E 2R23A 4JRYD 2G30A 3U1SH 2C9VA 1XCXA 2E6QA 5EU6B 5IKCB 2DJSA 3APFA 4PY7B 2Y7QA 4RGOH 1XV8A 1Z66A 2XC8A 4HF5H 1OARH 4LHUD 4NP4H 4A2GA 2MWCA 2O5NA 1JTPA 2ZSWA 4KKQA 4LOFA 5PAZA 4KXZI 1F4XH 3NIDF 3L16A 4LEOB 4N68A 5IMMB 3WS6C 3NEXA 2ZX7A 3KS0J 4O02A 1NFIB 5IIEB 4HALA 4W4OC 5E9DD 5DJ6B 1JK8B 4OZHF 1NLBH 3GMMA 5CSBA 3NVQA 4D9QE 1A7BA 1OTTD 3GSXB 3A6BL 1G7MB 3B5GA 3FQUB 1QBLL 3PDOA 1HL9A 4TLUA 5B3JF 2XWXA 3R1GL 1R3IH 5CIPB 5HPOA 3QNZB 1IU1A 2LVCA 1P4LB 3SZ6A 1R75A 3P9LB 3QFDA 5ID1B 4L18A 4XMXA 1ND0A 5KBKA 4OF5A 4DP2X 3UPRA 1W80A 4P48A 2G9HA 4J12A 2H41A 5LAXA 2DYPD 4GRWF 4QRQB 3KBEA 4XB8A 2H2SC 3ZPDA 4OGYL 3WIHA 3L08A 5D71H 3HRZC 3ZZ1A 3VXQB 4YBHA 1S9VA 1AIZA 3MRGB 1L4IA 2DB8A 2Y2YA 4W6XB 5E8DH 3TEUA 5CHNA 4NBYB 3EXLA 3WJMA 2I9TA 1X5LA 2X4TA 2XXMB 1LNUA 1KENH 3BWUF 4FFYA 4O2FB 1ED3A 1I1FA 3NCJL 4G6KL 4JFSA 5JZ7D 4RA0C 2XV3A 2YD2A 4YHIB 3FFDB 3W5MA 1E5CA 1XF2A 3DSNB 5EU3A 3OAUL 3GSNB 1Q9KA 2AGJH 4KTYA 1I7TB 2EEBA 2DQJL 1IUZA 4JQXC 5F44A 5CD3B 3U46A 5HXMA 3IYLW 1PCXA 2FZ3A 4NJ9L 3SJVD 1DBKL 2KT6A 3K6SA 3KNBB 4QCIB 1UM4L 5HHME 1A9BA 3J8F7 4FXGB 2DICA 3NPZB 4M7JL 5IMOB 5BRPA 2AXHA 4LSUH 5B8CC 3DBXB 4PG9B 1NFDB 3MJ8A 4BKLB 4ZYKB 5LHDA 3MV11 4WW1A 1CBVH 2MNJB 4ONFH 3EYUH 1B2YA 2RCSH 1JZDC 1BG1A 5EEUA 5KS9B 1K3IA 4XNXH 5DEFA 2IALA 4JZOA 4C56A 1SXCA 4RIRA 2XN1A 3L3OA 4TLSA 5JORB 2A3TA 2YPLB 3MUJA 4CC4A 4HCRA 4N24A 4BRJA 1XH3B 2YR3A 1D7BA 1WD8A 2WLJA 3NJGA 2V7HB 1FO0A 1A8JH 4XP1L 1KJ2B 1BZDA 3G7TA 3QO1A 4ISVB 2R8SH 1R3KA 1WPCA 4L8DA 2WKOA 5IVXB 3NPSC 4L5FH 2R4SL 2R1XA 2R59A 1FLRL 4WENB 5FAAA 4Z1PA 1BIHA 2O5XH 2YD1A 3QEGH 5C08B 3IXTB 3P73A 1WFTA 4PVLA 5I2IB 3CHXA 3H56A 1KY6A 4F80A 4PSRA 1IBGL 2D4FA 2OXGB 1F5WA 3UTSA 5DJYB 1XAUA 2IC2A 3TVMB 2FSDA 2VDML 2XVGA 2Z7ZA 3CBJB 3LZQA 4Z3EA 3FHAA 3P3RA 1UM6L 5LWYL 3ZMNA 2Q3ZA 1ZHBA 4DAGH 3IU3A 1VDGA 3QDJB 2ATAA 4H20L 1EHXA 5CS7A 3HKZA 1E42A 3OPZH 4WFEE 2QPUA 2AI0L 5DVNA 1BZ9A 4N25A 2VITB 4HIHB 5D2NB 4FLQA 4JUSA 4C56E 1KG0B 3B9VA 1OAUH 3EBHA 4MZ2A 2VO5A 4ZW8A 3TN0B 4PRHB 3NJXA 3RRQA 1SZNA 4FYQA 4R4NC 2VQTA 4EVNA 3V6ZB 5D7HA 3VFPB 1NANH 3HHMA 1N6VA 4HKJB 2AQSA 2MMXA 1G0YR 4HC1H 3VFNA 1AOZA 4P49A 1JTTA 4HG4K 1RLBA 2RH0A 3HG4A 4QIRA 4TPRL 3VFSA 3UTSE 2JI1A 1KTLA 3ZQXA 4E0RA 1NFDF 4APQD 3ME0A 1W16A 3O2WH 1LWRA 4I0PB 5FW8A 1RD6A 3HZVA 4AM0Q 5JMOC 1T1XA 1WWBX 1YZZA 2VDQH 2Z8VC 5KS9F 3WTTA 3PPSA 3UTTD 3DROA 1W0WA 4FQ2H 5DF0A 5IB5A 1XO8A 1JTOA 1ZT4B 2XQYK 3CN3A 2BNQD 2YQGA 3O8XB 5A3IC 1WH0A 2HFGL 2Z93A 2JXMB 3SE9L 4F33B 1TJGH 3MXVL 4PG2C 3QWOA 2N1TE 3D34A 4YHLH 3DPBB 2NY7L 5FUOL 3LKPB 3ZKXC 2H3NB 1DANT 1W72B 4GT0A 4OVVA 3TYFA 4BFNA 4Q97A 3WXVH 4F7PA 1LQSR 3BYTA 3CN4A 4KQ0A 3QA3B 1CGTA 2VZSA 4H7VA 4KTDH 2JQZA 4XP5H 5TK4A 1JHLH 3F12B 3MCLH 4IOFC 5LXGL 1NEZA 4I1RA 3IE4A 5CR8A 1KBBA 1VACB 2V9UA 3C5JB 4JM2B 5AVSB 1IAIL 4KJWC 2AJUL 4LSPH 4QRTB 2ZWLT 1V3MA 4S1RH 4OFIA 3RFRA 2UZYA 2X89A 1S9XB 5AAPA 2B1AH 4X4XB 1D3CA 3UZEA 3CMGA 1A4JA 4BUHA 4DP1X 2N0MA 2OQJB 2XT1B 3QULB 3RZWA 4B6ZA 2EIMB 3QIBD 5C0GB 5JW4N 3BKMH 4OZIB 2FBJH 3UJJH 1I7ZB 3RWDA 4K3JL 5CSGA 4AX3A 1EJOH 4KKZA 3OX8A 2YKLL 1H3PH 1NCGA 2VW4A 4JKPH 4PS8A 4YLQT 3QB7C 2CRYA 1S8DA 2X1PA 4WW2B 1TITA 4OCNC 5T1DL 5FO7B 5LGHH 3TPKA 4FAAB 35C8L 4AMKL 1OSEA 3A47A 3HZMA 5IT2L 4TUOA 2M8XA 2VNCA 2EXTA 2P26A 3LV3A 1KLGA 1IM9B 4YWGL 3LIZA 1UWXK 5F1IB 3L4XA 2J3SA 3K46A 5F89B 1B0RB 2IH1B 1QRNB 5DYFA 5AW9B 1KCRL 5EEWA 1NKGA 3FO0L 4Q2ZB 4RNRA 2Q0ZX 4LLQA 2BVUA 2TAAA 4QRAA 2F68X 2VN4A 3RGVA 5EU4B 3SDCA 4LU5H 4G72B 4OGZA 4Z78B 1J88A 1ZGLM 1WE5A 1JN6B 3ARPA 4FLSA 5B38G 2VDRB 4R3SB 1QKZH 2CH8A 1HAUA 4XCCL 2WQXA 4BFIA 2IOMA 3RX8A 4M3HA 2YWYA 2QHRL 1DJYA 1T5KA 4ODXA 2WXOA 2EO7A 1UYWH 4GXFA 2ROXA 4EO5A 5KAQG 2ADFL 3QIUB 3PWJB 4YSSA 3WIFB 1OM3H 5D6DC 4AGOA 3OC8A 2F74B 5GRZA 3HN8A 4OJAA 1ZLSH 1CE1H 2NUTA 2KS0A 2FATL 3O3EB 3MRDB 3U2IA 2DWXA 1H15B 3UBHA 4OCSL 3L3JB 4EN3B 4X8XA 4UQ3A 4L3ED 1DSYA 1FF5A 2O72A 1HXMB 3E38A 1F6AB 3DRQB 2PXYB 4AEHL 3KE0A 2AQ3A 2LVEA 1YAZA 1QSEA 2BNRB 3L3DA 2VT0A 2CCWA 4GBXD 2VXQH 2ZAGA 3CZNA 3VXRA 5E8NA 1PU0A 2CHDA 4D0CA 4ELKA 2OZNA 4B96A 1W6LA 4J3XA 1DLFL 3S3CB 4YSAA 4M61B 2DWDA 5BXFA 3BAJA 2M2DA 1GRWA 3KBFA 4WW2F 1DVFB 3MODL 5TQ2L 4HBCL 1U8JB 2Y5TB 3SQOH 2OI9B 4JZJA 2VLJB 1UKQA 3U2JA 3AB0C 3H6AA 4UB0H 3U6RA 3EDKA 1V3LA 4D3CL 2NY3D 4L0PB 2LU3A 5EZOH 3FQNB 5T8IA 3FT9A 3V4UL 3HI6H 4Y1AB 4EZKA 3V2AR 4JCLA 5KBMA 3IRCA 1FGVL 4L23A 3QISA 3RB5A 5EF3A 2WWOA 3U9UA 2FJHA 3A0OA 1QNZL 5C0EA 1J05B 2KDGA 1URIA 4U33A 3S5LB 3VSTA 5EOTA 5TJWK 2EDBA 4A6YL 5JIPA 1F86A 1E28B 5DFAA 3CPLB 2Z34A 2P8LB 4LOUD 3BKYH 3T1WA 1UD3A 3EH5B 4XPTL 3FTGA 3GO1L 4NQXB 4PJ7A 1MJUH 3LNFA 2ODIA 4JPWL 1QSEE 2I9LA 4Q74A 5DD1H 2OMUB 1A14L 3KGUA 3VXRE 1CFTA 1OSPL 5DRZA 5I0VA 1DJGA 3ZIYA 2JCCF 2APVA 2D7PA 5JZ7C 1W0VA 1G7QA 1R0AH 3GDCA 3VFOB 3QG6A 2YSTA 2XKNB 4EF3A 3OLEA 4NQEB 4O4YL 3BPNB 3TBVB 5C07B 1H5BB 1V8HA 2OZ4L 1PG7W 4R0LA 3S8FB 3VJ6A 1E4KC 4OM0H 4HSCX 1OAYL 3FQRA 1T4KA 4LMQE 3V9EA 1SHXA 4R4FH 2OCCB 3RTQC 1YNLH 5KVDH 5FHBL 1E8XA 5DFWH 3WKML 4LVOB 2QR0B 3DETD 4PRAA 5KSBB 3KYNA 4BK5A 1T5XB 1UJTA 4KHXH 2ZP9A 1B9ZA 1TLMA 5I6XB 4KRLB 2AKRA 1BOYA 1CICB 4Y0GA 1ZWIB 4L4JA 2FT7A 1IEBB 5KSUB 4N0UB 3QDMD 4PJ7E 1J5HA 3BAEH 3CLFH 3MBEB 4EUPA 3ET9F 1HQ4B 2X2YA 2FJFB 1FC1A 1NL0L 2H2PD 5DHEA 1QLEH 1YECL 1N70A 3CHRA 3F7LA 4HCFA 1CGWA 1Q0XH 2BH0A 2HH0H 1U91B 1JZEA 3PE9A 4XBGB 4RMRA 2EDJA 4IRZL 1AZBA 3BGFB 1FYHB 2UY6B 5J1TC 4FCHA 3QZNA 1WS7A 3ZT7A 4AIZA 2YD9A 5DVMA 4YXHL 5C0JB 1BZQK 1INEL 4IRSA 3RDJA 1FAKT 1M71A 1R46A 4LCYB 4H8WL 1HEHC 2YPVL 4AUYA 3CU1A 3NEOA 1IE4A 2E6PA 3NYKA 4MNGB 4N2DA 4OU3A 3SDYL 1EGJH 1KGCD 5ANMB 3EYVA 2I7SA 1TF4A 4M7ZB 5GRJH 3BN3B 2COVD 4R7XA 2QVTA 3TP4A 4M62L 2DKSA 4HGMA 4OFQA 5HGDB 1A6UH 3JV6B 3OR6A 3MAWA 3QWRA 4LDLB 1AXTH 1JFQL 1F4AA 3BLKA 4Z7QB 4U6XA 1E5YA 4G3YL 4N2NA 3TH3T 1IC4H 1HHHA 1OSZA 5DS8B 4Y8DC 1OP5H 4E9SA 1U33A 3NSYA 3GDBA 2KI6A 3BP6A 5HVHB 2QLVB 2O30A 1BIIB 4ETQA 3BAIA 4YNYB 2XYBA 4UT9A 3C8DA 1MVUB 4U1MA 2AQ1A 3P69A 5CCKL 2X5PA 3RWJB 1NCBL 4IKJA 4JEGB 2PR4H 3KPTA 4ZFOL 4APQC 4WZ9A 2IG2L 3W9DA 3V8CA 4NRZB 3GTTA 4Y2OA 3D3VD 4WIQA 1A4BA 3T4YB 3TA3B 3V52L 5GS1C 2XY1A 2MQ0A 3GUTB 4LLUA 4A38A 1JNLH 5L0QC 2K9UA 1YUHB 1RFDL 3L8QA 1GS6X 1IGIH 4B9IA 2C1OA 3G5ZB 1T7XA 2Z3FA 3CFCL 1RZQA 2A6DB 5BW7A 2VZOA 3WCYA 5SWZA 4Z6AT 3CDGB 4MMXA 5HHXH 1UZ8A 2NW3A 3QFGA 3ZMRA 1FNEB 2EC8A 3FYEB 4UUJB 2NY0B 3R8BB 3CVIH 3POHA 2Y06H 5DU7A 3V6BR 3C6LB 3LKNA 1FA4A 5D9SB 4AENA 1G1CA 2D0GA 3PAYA 3WTSA 1J0JA 1I3RA 1WRFA 4ZUWA 2EUZA 3PJSA 4ATWA 2ZJSH 4F7MA 4ZK8A 1F3JB 4PLOB 3X1FA 4EBQH 1HL5A 1Y18A 3BPCA 3RL2B 3EO1A 1M1SA 1IMHC 2H9GB 4PGZA 1OP9A 4GG8A 3QIBC 4WK0B 2C3XA 4NXKA 1IILE 4Z7QF 5FYJU 5IVZA 1NCAL 5B38B 3TCTA 1KYFA 4E42A 4F93B 2A0LD 1PG7L 1EANA 3EYOA 1LDPH 5DEGB 4KH2A 4U0RB 1NGYA 2MH4A 4LPTA 1ZD6A 5IFHL 1OCZB 5SWZE 4MYWB 1M7UA 1WAAF 3BGAA 3RFZA 2X4NA 1MFVA 4YGVA 2J8UA 3VXUD 4FMFA 2X4SA 5JHLL 4OZGB 5F88A 3TV8A 2W8CA 1BQHA 5DTFB 1LK3H 5I1CH 1HYRC 1S7QA 1TJIH 1U92B 1G9HA 4ZW7A 3WKPA 1ANUA 4FQLH 1E9PB 2EDTA 4DCQA 1TQCB 4G70B 1MLCA 1JDAA 1J0IA 3M46A 1N7ML 3QQDA 4QO1A 1JWMA 1TPXB 1LMKA 5ICYB 5I9QB 3FT3B 4Y9GA 3BE1H 2VR9A 2R69H 4LSQL 3UBXA 3VE0A 5F3HA 4XP9L 1JG9A 3OHXC 4YZFE 3HHRB 5D5MA 1AP2A 4X6CB 5D1QB 1RUKH 3EJZC 2R39A 4HT1L 2PTTB 2W0FA 3Q6FB 1AGFB 4NRXB 4BIKA 4TLTA 2GPZA 2YUWA 4Z7UB 1NKOA 4NO2B 3KJ6L 4Y19A 4NN6B 3RUGF 2F8VA 3SGJC 1J9CT 3CPUA 2NNXA 2V2XB 2CO1A 1ETJA 2OV0A 2J8UE 4KUCF 5E99H 3R4RA 3D9AH 5HGBA 2Z35A 1KPRA 4EQ3A 5HYJA 4BSWA 3IMWA 2VZUA 3KGTA 3H8NA 1GZHA 3NN8A 3BPOB 3QHZH 3GRWH 1TQTA 1T7YA 1JGDA 1XL6A 4JQIA 5ADOH 4AQ1C 1K3ZA 5E95B 3PFQA 2XYCA 1IL1B 3SD2A 2VDNB 3VX0A 4MWFB 3G5VA 4DUVA 4IU3A 4DESA 3NIGB 1OGTA 2Y07H 5B7MA 1ZJBA 2YRLA 4JS7A 3KPPA 3U0TB 5A40E 4YHMH 3CVBA 4KMTL 3HMXA 5CF3A 4G7YH 4YDVA 5C0DA 1M3JA 3QQ4B 5HHVL 1RLWA 4I4WB 5D5ME 4AYDC 1KZYA 4PHZA 5DT1L 1A3ZA 1V54B 4JDTH 2EADA 1FH2A 1PEZA 2J72A 3I2CL 1GGCL 1CF8L 1SJVA 5TE6L 2NY3C 5E94B 2MHAB 2WOYA 3D8MA 3DRTB 4GIPD 1GKEA 3M1OA 1RURH 4Y19E 4Z77A 2BDNL 1NGWB 1U8IB 3K1KC 1BX2B 3SDXA 3WKNA 4DP6X 1CCZA 2CSPA 1SLWA 5IB3B 4NQVA 3T04D 5HYJE 4NUJB 4GUPA 3IDGA 4FNQA 3PV7A 3V5KB 3JV4B 1Z9SB 3AREB 3MRNB 4P99A 1OT2A 4IKKA 2JB6B 4HGWA 3AWFA 2E0PA 2IH3A 4LOUC 1BYOA 4Y4KD 1QFUL 1DFBH 1RPKA 1CUOA 5GZOD 5J9PA 1B2WH 2X6MA 4E68A 4AOFA 1HJBC 1NGZA 1CBJA 1JGEB 2QVKA 4HIXL 4L9LC 3BP5B 1QUNB 2ZCHH 2APFA 3HFML 3ULVD 3I85A 4GY4A 2PN5A 4Y5XB 1JPSL 3IWUA 4W9ZA 2R1YA 3MLVH 3P2DA 4B27A 1IGML 3I02B 2ZG1A 2CMRH 3G6JA 3H55A 1G7HB 3THML 4XP6H 2N0KA 4LBEA 4DGIL 3AU1B 4KXDA 4UQ2A 3GSRA 2QEJA 3KH4A 1KCBA 2YLKA 5CP3H 3ARQA 3SDXE 4YXKL 3DETC 3MACL 2EXYC 5EIVA 1Q4NX 3ASNB 4J23A 3FQTB 1H6EA 4NZJA 3H0TB 1FQ9C 1KBVA 2JKXA 2B3IA 1TFHA 3NIGF 2QKSA 3ZTNH 4XN7A 4ZRGA 2Q7YA 3QRBA 3ZRCC 5I23A 2VJXA 2L7JA 3WJJA 4XVUD 1UCBL 4JKNA 3Q8CA 1QLEB 2F7OA 3HR6A 4JB9L 1MQ8A 2H2PC 3DIVA 3QG7H 4M6OH 2NYKA 4MCZA 4BINA 3WN5A 1G6VK 3PGFL 3SCMB 1OCWH 2R56H 2AVGA 1HZHH 4F3FB 5EZIL 4U1KB 1WISA 2RIKA 1MFDH 5ESQB 3BWAA 3RL1A 3E8UH 3ZTEA 1W8NA 2BIIA 1F3RB 3G6JE 2NXYB 4YO0B 1GYVA 2G5RA 4EKXA 3NJLA 5C0ND 5L2KA 3QFJD 1ZHKA 2F61A 3MO1B 4QOKD 2OMZA 2VERA 2CKBL 5DWUH 1B6DA 4JFZL 2AJYH 5HGHA 2EDQA 3FSOA 3NSDA 1BFVH 1RIHH 3GGWB 3IDMA 1RZKL 1HYSD 1HDMA 4Y4FC 3RWCA 1TQWA 2EILB 4PJ9B 1ECZA 4Z3JA 1IC5L 4NN5B 4ONOA 3QZWG 2ZONA 3NJNA 2QSCL 4WFHE 1DJIA 1NIDA 3ARYA 3QUYA 4GAGL 25C8H 1XSJA 3WFDH 2W92A 5GGQH 3RX5A 1CD8A 4LVNB 3TBSA 3HC3L 2BWDA 2YGPA 3L9EA 4QD2E 4R83A 5EA0L 2BW4A 3WE1A 2BIMA 2CO7B 4Y9BA 1MJ7H 5GGRA 1HH9B 3AQDA 4H0HB 5DK2A 3S96A 4HX1B 3NFNB 1BM7A 3CFJA 4PV8B 1JF5A 1IE5A 2NW2B 1I85A 5L2KE 1EEZA 3W39A 1ZVNA 3IDJB 2P5WD 4ZAKD 3ZTCC 1F6FB 2AJZB 2X7LA 3QH3B 1B4RA 1WQVT 4WJKB 1RZ8A 3EADA 4JMXA 1QPXA 4GKZA 1HU8A 4JO4L 4LSSH 4PRDA 5CEYA 3OR7B 3EXJA 3GSWA 1OT4A 4KK6C 3U9PH 3C08H 3FOMA 4YX2L 4OF8A 4UU9A 3LN5A 5DJDA 5DZOA 5AOJA 4M6MH 1M1XA 2AJ3B 1IARB 3FO9B 3PV6A 1VGEH 2G3XA 1UXMA 1D5XA 3NFSH 4KKRA 1BF8A 2YKKA 4CUCA 3GMPB 4NWUL 2DD8H 2BRRH 2OJ1A 3EG9B 3MV9B 4HUWB 1T2XA 2GJPA 2YBRB 1CDIA 4CMHC 2QFRA 1OM9A 4LCWD 1N4XH 2Q8BH 5ALCH 3OWEA 4CSPA 4A2DA 1KCSH 5A6IA 5ITBL 3DSFH 4OF6A 4Y5YB 3VRLF 2VXSL 2GCYB 4NJAH 4L9DA 5ABDE 4FYRA 5C0RH 4DUWA 3I9AA 1A6VL 3QXAB 3D51A 2WVUA 4X7EC 1R24A 3FQWB 3BDYH 3CBKB 5DMKA 1ETZB 5EORH 3NUKA 1K4CB 3T0EB 4P2QB 2A0LC 2P24A 3OJDB 3DI2B 2YD3A 2GITB 3SBRA