2PP8A

Formate bound to oxidized wild type afnir
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conserved active site residues limit inhibition of a copper-containing nitrite reductase by small molecules.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
molecule keywords Copper-containing nitrite reductase
total genus 89
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2007-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2pp8A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2pp8A02
1A4AA 1SDDA 3FPYA 3SBRA 1X9UA 3IN2A 3PCYA 3PXLA 3CZUB 1FWXA 1CURA 2YAFA 3NP4A 2XX1A 5D4IA 1IC0A 2CCWA 2OCCB 2VM4A 4DPAX 1CYWA 1AAJA 2XYBA 2AZUA 4BWTA 1PNCA 4HHGA 2VSMB 1AACA 2QPDB 2VN3A 3PAUA 4HZ1A 5I6MA 2DV6A 1PLBA 1J5DA 2IH9A 1A8ZA 2YQBA 2H5UA 3CVDA 2ZXWB 1M56B 1QHQA 5B3SB 3H56A 1PLCA 1NIBA 3FQ1A 3CDZB 2H47C 1WA0X 4YSCA 4GP8B 1IKOP 2HRGA 5B1KA 3UADA 2HX8A 1WA1X 2CBPA 2VW4A 1ETJA 2TSBA 1V10A 1I53A 3QJQB 5IY5B 2PCFA 2YARA 1ASOA 2VSKB 5I5MA 3FU8A 5I26A 2RACA 1FFTB 4G72B 1XB6A 4BK5C 8PAZA 3QJRB 4AI7A 5I6PA 1V55B 3OD3A 1NICA 2GB2A 2DWTA 3PAZA 4HALA 4KNTA 1AS8A 6PAZA 1MZZA 5B1AB 3FU7B 1ZDSA 2GSMB 2VM3A 3GXUB 3QQXA 4A2FA 4E9RA 1KDJA 5B1JC 4YSOA 1SF5A 2IWEA 1GS7A 4BXSV 2ZONA 2XX0A 1AS6A 1ILSA 1KV7A 5TK4A 2P80A 4YVUA 3WNIA 1IUZA 5LDUA 3OMNB 3S3CB 1ZV2A 3T6XA 1URIA 2PP7A 2J5WA 3DKHA 1W8EA 4KNSA 2YXWA 3S3DB 3NYKA 2OJ1A 3OM3B 1UATA 3SBPA 1ASPA 3T6VA 1KGYE 1E30A 1L9QA 2BHFA 3AY2A 1HAWA 3V9CA 2HXAA 3DTUB 1KBVA 1XMEB 3ZX1A 3QJSB 4DP8X 2WO2B 9PCYA 1ZDQA 1BAWA 3NSDA 2XWZA 3OMIB 4A2HA 1E65A 3ZDWA 4DP1X 3ABLB 3ASNB 3UACA 4F2EA 5A7EA 4YSDA 3H4HA 2BO0A 2XV3A 1AR1B 2HX7A 1N70A 3NJJA 2DYRB 2BZ7A 3RYMA 1JZHA 3V9EA 4HIPA 3X1EA 2J55A 3GDCA 3X1BA 4WTQA 4A2EA 2BW4A 1BQKA 3FSZA 2XUWA 2I85A 4BDVB 1OCOB 3TU6A 3FSAA 4JHUA 4CSPA 1JZEA 1JXGA 4ENZA 3FYEB 2BP8B 2J57A 4G7RB 1KYAA 3NJGA 1OE1A 4W1TA 3N2JA 4N4YB 3NJFA 2IDSA 2ZOOA 1NIFA 2VMJA 1E5YA 3PPSA 3X2QB 4DP4X 4HCIA 1J9SA 2XU9A 3QJUB 1KDIA 4GP5B 2YAQA 1BXUA 4P5SA 2IDQA 2VW7A 3TBCA 2XVBA 2QDVA 4AZUA 3ZIYA 1JZIA 2BWIA 3KW7A 3ABKB 3U25A 2Y69B 3N55A 2IDUA 1F56A 3AG4B 1BYPA 1OOWA 2XV0A 4KO9A 1V54B 2BW5A 2BP0B 2EIJB 1BXVA 4TXVB 2HLEB 1QLEB 1GYCA 1AZCA 2AANA 3EH4B 4ZK8A 4A66A 5I6OA 2IAAC 1MG2C 2PP9A 1OCCB 2WO3B 3WNJA 4DP0X 1GSKA 2Y1AA 1AS7A 1AZBA 1J9RA 1NTDA 3QJVB 2PCYA 4GYBA 1L9SA 1TEGA 2YAPA 3AG2B 4Q89A 4HCFA 4KNUA 2XV2A 4A2DA 2XLLA 3CDZA 1NDTA 4YL4A 1MZYA 4F2FA 1NWPA 1KCBA 2CAKA 5B7FA 3S8FB 1BXAA 3FS9A 2MTAA 4G7SB 4RH4A 3NJHA 3UAEA 3NJMA 1BQ5A 2EIMB 4E9YA 4BWUA 1JZFA 3NT0A 2UXFA 4E9WA 3TBBA 1AOZA 1J9TA 4P5RA 1M9WA 1AIZA 2AZAA 3CG8A 1ZIAA 3H4FA 1SDDB 2E86A 1PZBA 2YAHA 1J9QA 4N8UA 1ZIBA 2X87A 3UAAA 4YSAA 1ILUA 2IDFA 3FSVA 1N68A 2DYSB 4Q8BA 4X4KA 5B1BB 2QT6A 2PPDA 3WKPA 1PLAA 2FNWA 3MX0B 2TSAA 1L9OA 3L45A 2FT6A 2YAOA 1TKWA 2PLTA 1E67A 3T9WA 4E9SA 2YAEA 2N0MA 1IBZA 3D12B 2FQDA 2EINB 1WS7A 1SNRA 2JXMA 3IBOA 5I6LA 1KBWA 2A3TA 3FT0A 3EH3B 3PLYA 4W9ZA 1SHWA 2EIKB 1ADWA 1GS6X 5I6NA 2HX9A 4CSZA 1NWOA 2AVFA 4YSPA 5AZUA 4AX3A 4FAAB 5B7EA 2I7SA 1BYOA 1SHXA 4HAKA 4DP9X 1GY2A 4YSTA 3IEAA 1DYZA 3WIAA 4G70B 4HHWA 4E9XA 3OMAB 1NPNA 2YAMA 1HFUA 2IWKA 4GY4A 3MBWB 1AZRA 1A4CA 3FYIB 7PAZA 4MFHA 3EHBB 2GIMA 1AZUA 2VW6A 2GBAA 3FU9A 4PAZA 2R7EB 5I5JA 3X1NA 1RZPA 3NSCA 4DPCX 2ZWNA 4EF3A 4HCGA 1QNIA 1TU2A 1OF0A 1X9RA 2JKWA 1ASQA 1JERA 1JXDA 5EHFA 1CUOA 2MRYA 4M3HA 2FTAA 1A4BA 1R1CA 1RCYA 3AG1B 4GP4B 3CVCA 3GYRA 4BDVA 3NJLA 4NB7A 3QJTB 2GI0A 4KO5A 4NERA 4YSSA 2HZHA 1NZRA 7PCYA 2I7OA 2OV0A 2PPEA 2PP8A 5I6KA 4DP7X 2FT8A 2W8CA 4NAJA 3ABGA 2P80D 5B1JA 3TA4D 1EHKB 5I28A 1A3ZA 1NIDA 5B7MA 1PAZA 1TEFA 3AZUA 4KOBA 1PZCA 2JFCA 2B08A 3EF4A 3UGEA 2R7EA 3AG3B 1JVOA 2IH8A 1SJMA 2FQGA 1JVLA 1W6LA 2FQFA 3WI9A 1SFDA 3WG7B 1FA4A 1XB3A 4E9VA 1AG0A 1NIAA 1EZLA 3FQ2A 3NSYA 4QKTA 4G7QB 1WA2X 2FT7A 1JZJA 4KO7A 1PF3A 1OV8A 3HB3B 3X1GA 4A2GA 1L9PA 1WS8A 5E9NA 4A67A 3BQVA 4FA7B 1NIEA 1VLXA 4AKOA 3WKQA 3S3BB 1BEXA 2PPCA 5PAZA 3JT2A 3BVDB 1PNDA 5AKRA 4PCYA 5F7AA 1L9RA 2J56A 1J5CA 2FQEA 2GC4C 1W6WA 3UABA 3ERXA 3ZBMA 3FU7A 2QPEB 2DY2A 2BP0A 3ABMB 5I5IA 2NRDA 5D4HA 1AZNA 4QLWA 3NJIA 5ANHA 2B3IA 1ZPUA 4BXVA 2Q9OA 4GXFA 3ASOB 1L9TA 1IBYA 3KW8A 4KO6A 3AW5A 1ET8A 3TASA 4E9TA 2IDTA 5F7BA 1A65A 1GY1A 1NINA 1M57B 1PMYA 3HEIB 1YLBB 4F7KA 1ET7A 2Q5BA 5FC9A 4JKNA 1RZQA 3FSWA 1PY0A 3DIVA 1OCRB 3FPXA 2GHZA 1HAUA 2QDWA 3QPKA 3T6ZA 3X1FA 2HRHA 2CALA 2FWLB 1GR7A 3EH5B 4JHVA 1KCWA 1PZAA 1AG6A 2UX7A 1OE3A 1OCZB 1JZGA 4YSQA 3G5WA 2DWSA 2UXVA 2XXGA 1OE2A 1WAEA 5TK2A 2BWDA 3SBQA 2YXVA 1AQ8A 2CUAA 2EILB 3NSFA 1T5KA 6PCYA 4UF7C 4YVNA 4E9QA 2UXTA 4WKXA 4DP2X 4UAHA 4BWWA 1JXFA 1PCSA 4YSEA 2AFNA 2W88A 4DPBX 3JTBA 4DP5X 1MDAA 3NJNA 1DZ0A 2XXFA 4YSUA 3IE9A 4UANA 3SQRA 2X88A 1RKRA 4YSRA 3NJKA 3FQYA 1BQRA 2PPAA 3PAVA 2UX6A 3OQRA 4K9JA 1JOIA 1E5ZA 5D4JA 1B3IA 2BP8A 3C75A 3CVBA 1GS8A 2LLNA 1CC3A 4M4RB 2UXGA 3NP3A 3T6WA 3S8GB 1AANA 5AFAA 2H3XC 1ID2A 2BZCA 4DP6X 4G71B 4AKPA 1GW0A 2FJSA 1NPJA 4A68A 1SFHA 4L0PB 1ET5A 1SF3A 2GC7C 2IWFA 4AKQA 2PPFA 3IN0A 1CYXA 2WSDA 4KOCA 1XB8A 2CJ3A 3T71A 5PCYA 1MG3C
chains in the Genus database with same CATH superfamily
2AQPA 3CFDB 4G7YH 2CKBL 4XPHH 4JM2B 2NXYB 1Z9SA 1IC0A 2GK2A 1JI1A 4LMQI 1CYWA 1DBKL 4QY8B 4DEWA 4BKLB 4YO0B 1CICD 1VIWA 1NC2D 2J12B 1RHHA 1EANA 4OZHE 2Y22A 3PP3K 5CGYD 2YD1A 4K8RL 3BAJA 3U82B 4N0YH 5CSZA 4QNPE 3T3PB 5J56B 2VR8A 1WWCA 2YQBA 5JQHC 1OARL 1XH3A 5IQLA 3VXNA 2VDNB 2ATKA 4L0YA 3LNHA 3FQ1A 2WOBA 3H6JA 4X4XB 1UD4A 2Y6TE 4JVUA 2NXYD 1WBZB 5B1KA 1QP1A 5HVFB 3N0AA 3GNMH 4YNYB 1C8QA 1ORQA 1RK1B 2APVA 3BP7A 3FQWA 2WZPD 5EOCJ 1SYVB 2UY7A 3H7BB 1WE5A 1ASOA 2FB4L 4CU6A 3IFLL 5FYKU 1E4XL 2KDYA 4OCRH 2A83B 3CXHK 3I50L 4G72B 2B4CL 1VFUA 4L0ZA 4QYAA 2W9LA 4JHAL 2R9HD 4JW3A 3QIWB 5DR5H 1YEIL 5GGRA 4TMPA 2XRAL 3ILPB 4OZGE 4UU9B 2CGYA 5CSGA 2CO3A 3HOGA 3VUAA 4LK4A 3QCTL 4MXQC 5C2BL 5KVGH 2XZCH 5HHPA 2RFXA 5EBGA 4IRZA 3MR9B 1MHCA 2MMXA 2ZONA 3R1GL 1S9YB 1XF2A 1BIIB 1GZQA 2BNRB 3FO0H 1J11A 3WL9A 3GMQA 4BFKA 1BG1A 4HS3A 4F57H 2OKMA 3WNIA 2BSSB 5T1LB 7FABL 5KVMC 1FHNA 4JGJA 4MJ6B 3T09A 2BX5A 5I8EA 4AYFA 1JMZA 5CCJA 2Z93A 5KSBA 3EO1B 1U91A 3ZDZB 4NGHH 4PB9L 1P5UB 2DJSA 4JG1H 3KLHD 3PPEA 5JPMA 2A9CA 2P8PB 1WBZA 5I1IL 4IK7A 4U6XB 1YC8A 4DFIA 2NX5B 1CDUA 1D5IL 3QUGA 2OL3H 1XO8A 4O9HL 4ZFOB 3OMIB 4JFDB 4LHUD 5BJTA 1L0QA 1NFIA 3IMWA 4GIPD 1NC2A 4RNRA 3CX5K 1A6AB 3E6FB 4KU1A 2YA0A 1M2OA 3I6LD 4TSAH 5DFVD 3Q7JA 4X9FA 1KV3A 2CRYA 2WQSA 3LMJL 2I07A 5FCSH 3O2WH 5F89A 4B6ZA 2QHRL 4WV1B 1MCEA 4ZUVB 3ARRA 2BVQA 3GS7A 1MFVA 1BQKA 2CNYA 4QT5A 2IGTA 1CXLA 5L7XL 3PL6B 3DPBB 5D72L 3FUFA 2QGDA 4X5WB 1Z9SB 1OE1A 4M1DH 4MXQD 3N2JA 5E9DE 1INQA 5EOQL 2ZOOA 1IM3D 5I8CA 2Y06H 4KKBC 4UAOB 1W0YT 2XU9A 3GMOB 3QZWB 4X4ZA 4N5EC 4MQTB 1GC1H 2YAQA 3CLFH 2C3HA 5SWSD 2HFGH 4ILDA 4NN7B 4QWWD 2GJ6E 2OP4H 3RGVB 3SDXF 3QPQC 3U2IA 4A6YB 2GJ6A 4YGVB 5FECA 3DETC 3G6DH 2Y69B 5T3XE 3HNVL 2HPTA 1F2XK 3O4LA 5T33L 3QXTA 5E95B 1F4YL 3AROA 5JA9A 1J8SA 2NXYC 3T0BA 1BZ8A 1WO2A 2E9JA 2BP3A 3P2BA 4Z0XA 2X05A 1KJVB 2EDQA 1J1XL 1JPSH 5JW3H 2UWEF 4NN6C 3PDGA 6TAAA 3I74A 1QTYT 5JHDA 5BVJA 1A3LL 2R2EB 4HPYH 4NQXB 4B9YA 5FW8A 3FCSA 4GBXC 1X7SA 3SY0B 1A21A 2PYEE 3FO9B 4G1MB 1RJLA 5DUBB 1BFSA 1J8HB 5IOPA 2QPUA 5HYIA 4ZW8A 4JFYB 4PGBA 5ERWA 1UFUA 1MCCA 2NY6D 4HJ0D 4FL4B 2A9DA 5DMGC 2CDGB 2ZOWA 4FFYH 1KPUB 1BXAA 5FDWA 5F0LB 15C8L 4YAQB 1I7ZB 1G7HB 1RUAH 2XA3A 3EXLA 3IGAA 2IALA 1DQKA 5E08L 2J4WH 3DK2A 4OJYA 4XPFL 2ESVB 4KQ0A 4YHKL 1F6AB 1G9HA 4ZPVB 1FLRL 4A2MA 3MROA 2X1XR 4G7VL 5LGYA 1A6TB 4LAQH 2EUZA 1T22A 1SY6A 4IMLA 1HSBB 3B83A 5D93B 5T1KD 1RPUA 1DUZA 4H5SA 1VFMA 3F64A 2PWHA 4HJTA 1A7QH 4HIIA 2AXFA 2PO6C 4K7FB 5IJCC 2M8XA 3LYRA 4M1CD 2BOCA 3HBGA 4L3AA 4KAQH 4AITA 4N8UA 4PRPD 3D69A 1ADQH 2ZXCA 3B6SA 3BZEA 2NDGA 3I6KB 4CMMA 4M7LL 1K8IA 3L3OB 4N9GB 1PS3A 2P5EB 3AB0C 5DEGA 3HCVB 4Z7VF 5SWZD 1IKFL 3UPAA 3PWLB 4AT6A 4OQ1A 1NFAA 2XQBH 1ECYA 3JTSB 1TZ8A 5CLTA 3UP6A 5FYLL 5J4MA 3MOAL 1OY3B 2QSVA 4ALAC 5IB5B 1G7PA 3L45A 3SDCB 5L6YL 1TKWA 2H2SD 3VMPA 4D9LH 2PLTA 3D87B 3VRIB 3QDJA 4NJ9H 4KJWD 3WLWD 1CO1A 4YXKL 3WS6A 3V4VL 1U8OA 2AK4E 3BESR 3FT0A 3T2PA 1SY6H 2V2WB 4JGNA 3C6EA 3W9EB 3MCYA 3ATAA 3KL0A 1XCTB 5IK3A 5FO7B 2UZXA 4UQ3A 4WJKB 5T3ZE 4KMTH 2I7SA 4UTAH 3GS0A 1FQ9C 4YBQC 2YD3A 3FQTA 4JFDE 1COBA 3WIAA 3JWNH 3RAJL 3P2TA 2Z31D 1FZOA 3BUBA 3RJOA 2ZP9A 3VXRD 4PJGB 5DI8A 1NCTA 2XVLA 2C9AA 5DJ6A 1WT5C 4JX0A 4E5XA 4Y2DA 2BSDA 3EHBB 3BLPX 4CKVX 3EKCA 2DIJA 5ITBH 5FCUH 1NFDE 5H37H 3KCPB 2FHFA 2EAEA 4FNTA 1RZPA 1Y6NR 4K9EC 4ORGB 4EF3A 5ECGA 3WUWG 1QNIA 5TE7L 2NY2C 3TXAA 5C0AB 4PJEF 2F5AH 1RD6A 5D70L 1IILE 1WBXA 3QWRD 5T8IA 1HC1A 3OX8A 1NGYB 4JO5A 4GBXB 3WFEH 4MCNA 4NKIL 3M1BA 4LLAA 3GYRA 4E36A 2Z31B 5HHMD 2YD9A 5LO7A 3AJ7A 5HGHB 5E2TH 4U4BA 3W11D 3HPJB 1SOXA 1AKJA 5ETUA 1G84A 3GBLA 3MREA 3O6ML 1TU2B 3DMMB 7PCYA 1BJ8A 5I1DB 2XICA 3CFEA 4NC2B 2Q10A 3MXWH 4ELMA 5IHHA 3LEYH 4Q2ZB 2J8UB 1KB5A 1QLRA 4RAHA 1AJ7L 1JV5B 2CLZA 2IQ9H 3TA4D 1RK7A 2Y2TA 4QHPA 1OB0A 1A3ZA 5HHME 4NN7C 4OGAD 1F97A 5F1NB 4L3CA 2N1TE 3LPPA 5MERA 2F54D 2GYSA 1JWMA 3BPOC 4WI9A 3FUNA 5HHNA 1JVOA 4KFZC 3D2TA 3PU7A 3DLQR 5HY9A 4CVXA 4QKXB 1MUJB 2ZG1A 2BOBB 2P8PA 4QHLA 4IQHA 4M29A 2RCSH 5FF6A 2DQ6A 4BZYA 1T2QL 2NT0A 2ZSWB 2WHVA 1IC1A 2Y1YA 5F1IA 3RFZB 4C47A 3DOHA 4G6KL 4Z7UA 4IBWA 3RHWF 1IFRA 3SIKA 4WF7A 5EU4A 4JFEE 2Z35A 4H20H 3ZUCA 2F54B 1DJXA 1L9PA 2RQEA 4JLRB 4DAGL 3PABA 3MGTB 3OB0H 1O75A 5IVXB 5TPWH 4BGDA 2L7UA 3ES6A 5C0GB 3PFQA 3IDGB 1SMDA 3N1MC 3HC3H 3A6CH 4RRPM 1L3WA 4L05A 4BSVB 2J56A 5DQJA 1Y6MR 1WAAE 4K4KA 5ADOL 3VWKA 3WJJA 4OLXH 2WXOA 3WEMA 2H2SC 5DQ9B 5EDXA 2A9ML 3QIWA 1Z66A 4DGVL 1AP2A 2B3IA 3GSUA 4ZMQA 1OB1A 2Q9OA 4YHPB 1C16B 1KF9B 4GEIA 1QEWB 2B14A 4G80B 2UVEA 3GB7A 3GQFA 4L8BA 3IJEA 4HBQA 3GBNH 5CD3B 2R8SH 2DOCA 3RI5K 4LCUA 1RFDL 3JBG7 4N1HB 5E03A 3ZTEA 1LEGB 2BHZA 1U3JA 2OSLB 4NHUA 3LEXB 3VI3A 3B7TA 3WIIL 3WO4B 3W0WD 4R26L 2ZG2A 1BLIA 1LK2A 4PB9H 4K5MA 3CK0L 2XWRA 1SQ2N 4Y5YA 5I66A 2OK0H 4NLAA 1JTPA 5KSAD 3BJLA 5D7EA 3C60A 3O3BA 1K4CB 2CRZA 3D3VB 3HI6H 4NQVB 2AQQA 2NZIA 1P6WA 4YSQA 3PS6A 4KHXH 4HZAA 4LIQE 2XXGA 3CLEL 2PF6A 3S5YA 3IRCA 4PY8J 1P4UA 2ZZUT 2GK0B 2EILB 3QIWC 1G87A 4L4TB 4PYHA 4B9PA 5D5MB 5KVFH 1T21A 1J8HA 6PCYA 1VKXA 4KX9A 3M17B 2YEZB 2QADD 1PCSA 2EDHA 5LAXA 2AFNA 3MMEA 3VXSA 3W11C 4DP5X 3NIGB 3GSOA 4RGNE 2XXMB 3BSZA 1N6QL 3D3VD 1TOXA 3VDCA 1U8NA 1DJZA 4CAGA 3MA7B 1N19A 3X11A 4OCSL 4KPHH 5EZJA 2R0LL 4FLSA 4AGNA 2AITA 2CHDA 5D9SB 5AVSB 4DWHA 1KPVA 4JVWA 5DRNB 5F9OH 5EO0A 1RXLA 2FBJH 2QSTA 3MRNB 4RMQA 5D71L 3R8QA 3EJZC 3DIFA 4KXAA 4WO4D 1QBLH 4BZ1H 3UEZA 3UJIH 2G2RA 2UXGA 8FABA 1REIA 2CRIA 5AFAA 1NCCH 4Y9FA 1RZKC 3VFUA 2WYZA 4FJ6A 4Y88A 5J13C 4K3EH 5GS2H 1GPOH 3ZE1F 3GSVA 4KOCA 1ACYH 3GLDA 2LOEA 4X9IA 1LWJA 3C5ZA 1B0IA 4PMFA 5BRZB 4XPGL 3BP6A 1SDDA 5MENA 3HS0A 3EFFB 5JNYA 2A74B 3CFKB 1T03L 5C0CA 1RVFH 3TPKA 4B27A 2Y72A 2YC1B 5CSBA 4K9EH 3MV9A 1JXJA 4H8PA 1I1AC 2XYBA 1FC2D 2AMGA 2HRPL 1OZTG 5K9KA 3LKPB 4UBDD 4CBPA 3D2UD 3PWVA 1XGYL 5AUMB 1VEMA 1FFOA 3JWDH 5AYTA 3EHBD 2OMNA 4Y2OB 1NBVL 5BO0D 1WAPA 2JVUA 2LQRA 2C1OA 2YSSA 5ID0A 1U8LB 2CDGA 1WZAA 4M7KL 3EYFB 1FNFA 4N2LA 1H5BB 15C8H 3I3DA 5C07A 1TNNA 1NSNH 2F8VA 4IU3B 1U3YA 2A6IB 4KROC 1KLUA 1QKZL 3E8UH 4KTDL 2R2EA 4NQXA 2WWKO 1IV8A 3U4EB 2YD5A 1HL9A 4PRBA 5D7LD 4NPYB 5C3LD 2F7OA 5LG1A 1BEYL 3DUSA 1ACXA 4PJFE 3BIKA 3VGHA 4HJJL 1O7VA 1NICA 3MXVL 5KSVA 2QMJA 2DI7A 1TDQA 3C8DA 3JVGA 5SX4I 3O2DL 4Z3TA 1HINH 3LVTA 3ULVD 3W0WB 3GFUA 4Y9BA 1AGFB 2HFEA 3HE7C 4FF9A 4GAJL 3VO0A 1VA9A 5JXEC 3KMDA 2FGWH 3P0GB 1YDPA 4BXSV 1D6VL 2YFOA 3MOAH 1JMXA 2FK9A 4ODTH 2AS5M 4PI2A 3MJ9A 1QRNE 5KSUB 3EO0B 5JIKA 1VKXB 1BMGA 1KG0B 2QV2A 2ZCLH 4UQIM 5C7ZA 1UJ3B 3DOSB 3FHQA 2XTSA 2NR6A 4Y5XB 2E56A 2EYRA 2VLMD 1B2WH 4R2GD 4N0UA 3VI3F 1EZSA 1HIMH 4XVUC 4HKBA 1ZKAA 4U1IB 4DNLA 2FEDD 3LB6C 5JIIA 1J5OH 2D7OA 2ENYA 3FO2A 3T2OA 1JIBA 4JJHA 5LWYL 3H9SB 3GZKA 2AJYH 2BSED 5EIIG 1P84J 4Y4FA 1ZT4B 3ZT5A 2K78A 1KXVA 2OR9H 5AVXB 4GRWH 3T0EA 3ZSSA 3U1SL 1YG9A 4ISVB 5JTWA 1LDPL 4H88L 2VC2H 3MLVL 1SBBA 2LTQB 5DC0A 1A6UH 2V7HB 2ITFA 1IGTA 2G3ZA 1NC2B 3DVIA 2OJZL 5FX3A 2YBGA 4NPJA 1G9NC 2ZIDA 3UAJD 3K8MA 1YNKL 4L8BB 3GB7B 1S9WA 3I2CH 1A4JB 3L81A 2J55A 4HW6A 3ELAT 2WN2A 1GZHA 1QR4A 5J57B 3X1BA 2D2OA 1R5VB 3ETSA 2NY6C 4KRMB 4QXVA 2BW4A 2XWXA 5DQ9A 5A6IA 2V5YA 3SJVB 4B0MB 2R27A 3FSZA 5JIMA 2K0RA 2Z4QB 3HHSB 4M5YH 4I1RA 3M6DA 4R0LA 4AXWB 5CEZD 5DLML 3VXUA 2J57A 4BGLA 3U0WH 2DB8A 3GIZH 1MFEL 1AGCA 3OKMA 3KR3H 1KIPB 3B7SA 4HMDA 3QW9A 5DSCA 3DV6A 4PRAA 1RQ5A 2BMKA 4HUCA 2BIHA 1FHGA 1V5JA 5ANMA 4DZ8B 4K3GA 4XMTA 3LOWA 3LKOA 2DQTH 4Y2LA 3V6ZB 5BRQA 1CFSA 3IDIB 3BRDA 1NAKL 3ZIYA 4A6YL 3VSUA 2BWIA 5KVDL 1FDLH 3VFRA 3BWUF 5BRZE 4Z7OB 4LOEA 1R0AH 1CG9B 1KY6A 1NCUA 4Y19B 1D5BA 1IGIH 1BYPA 3VXQB 1G6RB 1NJ9B 1OM9A 1JNNH 1XL4A 1ODAA 3LSOA 1SBSL 2X1PA 3NACH 5DF0A 5GJTH 1UHVA 5E2WL 1SVZA 1JGVL 1GYCA 1KELL 1UYWL 3KWWB 2V8MA 5I6OA 2VB5A 4RBPH 1AO7A 1T2JA 3P0VH 4WO4C 4QPEA 5FOBB 3NZSA 1MJUH 4X99B 2DN7A 3ATBA 4QRPE 3FB7B 1J0YA 2QEJA 3PUUA 4O2FA 5I2IB 1JHKL 2ENSA 3M8OH 1W72L 1VFBB 5DC2A 2EEDA 4XAWH 4Z7UB 3FB6B 3VQ1C 1N5YH 3Q06A 4ODUB 1UM6L 3V5KA 2NY3B 2XKUA 3ETBF 3MN8A 1ZV9A 3NA9L 4FFTA 3L3IA 4YPGB 2ZOLB 3CQQA 3FS9A 2NNAB 3VVWA 2NCEA 1CFVL 1EERB 1TQCC 5HI3D 3QH3B 4KI5D 4NQEA 5F7WC 2XJLA 2FJFB 2UXFA 2BZDA 2Q8AH 4QXUL 2HT2C 5J5EA 2COQA 3AM8C 4YE4H 5A2JH 1EGJL 3C9NB 3TN0B 2FCBA 4L4TE 2WD0A 2HT3D 3H42L 4R8WH 1AQKH 3T6QC 1R6VA 3MOQA 3F05A 4J4PA 1YNTF 1UGKA 3L7FB 3QDJD 1UB6B 4ZOEA 3HNSL 4PJCA 2CGZA 1ZLUH 2CUMA 1IBHA 3HLKA 4JJOA 4ELMB 2RJMA 3UIZA 3V52L 3OGCA 1O9WA 5J6GA 3PP4H 5DVNA 2YMXH 4UIKH 3QRGL 3B34A 1Q9OB 3CK0H 3WKPA 5FGCB 3IDJA 1WFOA 2OL3B 3MX0B 2WCGA 3VXTB 4PJFB 5F9WC 3ULUH 5JOFB 5SX5H 2CGRH 5AYUL 1EWHA 2Y23A 5F70A 5EOCH 3LZPA 4J3WA 1OF2B 1QA9B 3H0TB 3KGSA 1IGJA 3QXAB 1CTOA 3VU2A 3ZTDC 5I6LA 3HJ0A 1ZD6A 3IMSA 2N0KA 4PS3A 3S96B 3TEZA 1M05A 2CO4A 1DJGA 2X41A 3QEUA 4QHUB 1SHWA 1ADWA 1LO5A 2AVFA 2YUZA 3LKSB 2FAUA 5I74C 2E7BA 1KGCD 2WJ7A 4KJYA 3TN0C 3ZZQA 3ULVC 4U49A 1YY9D 2ZWSA 4XO4A 4ZUSA 4NZRL 3HE7D 4IGBC 4FLOA 4PWFA 1TVDA 3ORJA 2IWKA 2UV3A 3PWUB 2YGPA 4Z3GA 1N0LB 5DXWA 3HG1B 2JQMA 4OCSH 5IJBC 3GXIA 3RWCA 4TVPD 2VW6A 2CJUL 4BUHA 3VWJB 5JORA 3FFCE 4D0CA 3QG7L 4OCYH 5IMOA 1TJHH 5F96H 2DLTA 1NGZA 1YYML 5T5FL 1X9RA 3JWOL 1DUZB 1ERNA 3K4ZA 3ESMA 3II2A 1JD7A 3MV9D 2C5DC 1P7HL 1YMMB 1R4XA 4XBEL 1FPTL 3GMMA 1KTDB 4XVTL 5KVGE 5GRJH 4DGIL 5INDB 1NDGA 1MIEL 3E9TA 3OPZL 4ZX4A 4QO1B 2H6PA 3F7YA 4DTGH 5LNGA 1KPRB 1TIUA 5ADPL 3VXMA 5B3NA 4N2OA 4RMBA 1FVCA 4QMEA 4XPGH 2UZYB 2VRKA 2R1WB 1FIEA 1MRFH 3TO4C 1B2YA 1EQWA 2WLHA 3D4CA 1AGDB 3H9SD 2ZPKH 1YMMD 5FUCE 3ARWA 2EDTA 3REVA 3RWDB 4FP8H 3FCSB 1HXYB 3GRBA 1KCUH 4Z7UE 3TPUA 1UXSB 2CIKA 2UYLA 4PHXA 2QGCA 3WLBA 1CTNA 3TA3A 5EF1A 1JYNA 3DRQA 4Y5VA 3MUJA 1S7WB 5F7EL 4G8EA 1SLVA 5DK0B 4DZBA 1IT9L 1WA2X 1M53A 1DJWA 2X4SB 1LHZA 1K4DB 3GI8L 4KGLA 1C5BH 3VFVA 4JS7A 3RVVD 4XCNB 3ROLB 3MRMB 2C1PA 3VTMA 3QRBA 1RMFH 1OWWA 1GAFL 5K39B 2AEQH 3GMNA 3FRPA 2V5RA 5CEYB 3TEUA 1FNSL 1NAMA 1EK3A 5PAZA 3LZQA 4ZD3H 3D9AL 5F7AA 4PEEA 3EO9H 3TBWB 5ACZB 1TETL 2V2TB 3FU5A 3IMVA 5IHWA 2A4CA 4YHMH 5D96B 2JKIS 1DVFC 1XSKA 3ALXA 3LRKA 4Z78A 3TYGH 3CMOL 5D7JC 1MW2A 2FGWL 1MELA 5KN5B 4EXKA 2NSQA 1CFMA 3HHRB 1BJ1H 1F90L 3IKCB 1ZLUK 1ZS2A 2YMOA 3QHZH 3T2LA 2A0LD 3ULVF 4W9FC 5IIEA 2AK1L 4PJAA 5HI4D 5F7BA 3PV7A 3W38A 2A77L 3AQDA 1C5CL 5F0JB 4PJDF 4F7KA 2E4FA 4N8VG 2FJHB 2RB8A 1QQDA 1XF5A 4P46B 4P2OB 5DU7A 3SYAA 2MOGA 5I75C 2CALA 3CN2A 1PIGA 2ZYIA 5DMYA 1DE4A 4GLRH 5E6IA 3L3IB 3Q5YA 5F9WB 4AUJA 1B4TA 5CINH 4QR7A 4M43L 2BWDA 2P8LB 4NSKA 1LDPH 1JWUB 2VC2L 4H88H 5D7KE 2CUAA 2BFVH 2WXKA 4UDTA 5CD5C 3G5XB 3K0WA 3RLSA 4WU5A 3LSOB 3ZL4H 1JRHH 1LO2H 4QLRA 1NBQA 3E0GA 4M6NL 4YVNA 2LW3A 5D1XA 3CSTA 4RNRB 1EDQA 2B77A 4MDJA 5C3TA 5L88H 4ODUA 5EU5A 5FLVA 4UV4H 2KI6A 2D03H 3E2HC 1ES0B 5DLLA 1CLZH 1IEAA 3SKOB 2MTPA 2IGLA 3FXIC 4AVIA 2L0DA 4QRFA 2ITCB 2WXPA 3NFNA 4WI0B 3UMTA 3GMQB 5C0IB 1G0XA 3BOVA 3U6RB 5GGRB 1BVLA 3T4YA 1ZHBA 4RCAA 5AW4B 4WFEE 4ES8A 2RFXB 3Q2LA 2VLKB 3W39B 5F44A 5E99H 2DQUL 3QC6X 2V7NB 4F24A 3V6ZA 4M6MH 1OOAA 5DJ8A 2WAQA 4JG0L 1X4XA 2XDHA 3FC8A 4MCYB 2SEBA 1KIPA 2FO4B 4IHBA 4L0PB 4L8SB 1AGCB 3ULAB 3KS0H 1QRND 1CYXA 2RALA 3O6KL 3H3KA 1O7DE 3II3A 3TT1H 3ZO0A 1LVEA 2LU5A 2ORBH 3CHSA 4WO4B 4DGYL 5CFHA 3DX6B 3FPYA 5CSZB 4KKLC 5TF1H 3SBRA 4CN6A 4WU5B 2UUDK 3KXFE 2WWKT 1VADB 5CMAB 3UMNA 2IPTH 1M6OB 5HVHC 4DPAX 3TCLA 4FS0A 2ZXGA 2X5PA 1ULVA 5ITFA 5LLIC 4PY8I 3SSGA 2VN3A 4BFJA 5GSVB 3BP7B 3F6IA 2W1NA 2CJSA 1A8ZA 1E27A 4WJ5B 4N2FA 3VWJD 1F4WH 2X4TB 2BJMH 2ZXWB 5EC1B 3OR7B 5GGUA 3L7EB 4QY8A 1CLOH 1BOGA 1U8CA 1S7TB 4F93B 3I02A 5D55A 3OZ9H 4QXTA 3MKGA 3O9WA 4X6FB 3NEEA 1IKOP 5GGVL 3KEDA 1CMOA 3QUZA 5T3XL 5EEWA 3BN9D 3DMMD 2Z8WC 4OLEA 4RWHA 2WANA 4KROD 1INEH 5H2BB 5I15H 1WFNA 2P24B 4LFHD 4GKSA 2O5ZH 4U6VH 2R4SH 2EE6A 2COVD 3FUMA 4IRJD 4X6CF 2BCKA 5EEXA 3D7PA 1TCRA 4OGXH 2NX5E 4RAUA 1QSEA 1TQTA 1E8YA 3QUZD 4P5TD 1BVNP 1H15B 2DL2A 4PJFF 1SM3L 2DWEB 2X4RA 2EH7L 4RZCB 4ODHH 1JFQL 4NKDB 5DJZA 5JXED 4AEIH 3QQNA 5AAWC 1HQRA 3MRJA 1X5IA 2JB5H 3ZDXE 4A7TA 5FO9B 3FQNA 3HMWH 3KNBB 3RNKB 3TJHC 3HG3A 3J27A 1M6UA 4LSSL 4G42B 1KWKA 4BFGA 1JG9A 1CN4A 1QW9A 3BZDA 3VSTA 4G6MH 2Y7LA 4MAUL 4JR9L 2YXWA 5D7SL 4GG8B 2E9IA 5T1KA 5IQ7H 3SBPA 1O6SB 4FQ2L 4Y4KD 3P3UA 1FFOB 4NIYE 1J0HA 1TFHA 1UT2A 1KUMA 1N6UA 4MQXD 4PRPA 3S2AA 2IADB 4G8GA 1EFQA 4PVLA 3UO1L 2R39A 2VZ3A 4MB1A 1U58A 2G9KA 2XA8L 3IJHB 2OMUA 4X2UA 5E4EC 4U1NA 1BBDL 2FHBA 3NSJA 1EZVY 2MCMA 1T83C 4LBEA 2VLKD 4PG2A 3TIEA 1VEOA 4FEMA 3V0FA 1JZHA 4D0DB 1FBIL 1WWBX 4WIQA 4W9IC 4PJAB 5KTEH 4ZS7H 1T0NB 1L6ZA 1R24B 4QF1A 1EAOA 3LPFA 1MCIA 4JEGB 3KLKA 2APBA 2XPYA 5A3IC 2DM2A 4HUVB 2F18A 3L6FA 5ADPH 3NJGA 1U36A 1QYGL 4Z7OF 1NGXB 1HOCA 4ZW6A 1F2QA 5GRZA 3TCTA 5HI5D 2ZUVA 3VMOA 3LZFL 1HK6A 1UT9A 2Z7ZA 4PJEE 4R90H 2HMID 1IL1A 3BPOB 1R3IL 5KSBE 3EXJA 3GEFA 3UG3A 3VNYA 1BVKA 1VSCA 1G6VK 5CILH 1USQA 2X9ZA 4OLYL 2WLLA 2EE0A 3MBWA 3MLYL 2H7WA 4MJHA 3KL3A 1JK8B 1VGKB 5E4IA 5FXCH 3UYPB 3VGEA 1CCZA 1MN4A 2VLRA 1NUDA 2VH5H 3NPSB 5AZ2H 3UTTB 5T1LD 4J23A 6FABH 4W6YB 2GW5A 3NBNA 1MJJA 4F9LC 2R15A 3OXRA 1CI5A 3QPQD 2W92A 2Y2YA 5K9QG 3MCLL 2HH0L 4I9WE 2IAAC 3QPXH 3LN4B 4XCYB 1A3QA 1QWNA 2G0LA 2V33A 3WE1A 1YEKL 2ZKWA 3DRQB 3MV7E 5E00A 2Y1AA 4BFIB 4B3EA 1R3KA 4HXBL 2OMWA 5KS9B 4P57A 1GH7A 4I5BB 5I6XB 2Z64C 2Q7NA 3JWDC 5IJVB 1NDTA 2ADIA 3GD1C 4NUGH 3WKMH 3MLTB 3ARDD 4EI5D 4YL4A 3V0AC 4JFQB 4Y16A 2ZWZA 2AF2A 4PU2A 4XVJH 2G75A 3QR1A 4LPUA 1BQ5A 4YHLL 1F8TH 5I30H 2UZYA 1QHOA 4ZUTA 1MVYA 2YPLA 3BZ4B 3RZCB 4KK5D 4QJ4B 1MQKL 3FOMB 3GT6A 3AMLA 4XP6L 3LEXA 3VI3B 4L3ED 2WJ5A 4PTTB 2AZAA 4YFLF 1F90H 3ENEA 2WZ6A 4HWBA 4NFBA 4AYEC 4LDEB 2YAHA 2WXJA 1AFVL 3HC4H 4QWWC 4AUYA 4ECNA 2JJVA 2P47B 2P44B 3NCCB 4HUUA 4Y5YB 5AVUB 5DVPA 4LL9A 3QUXD 2OP4L 3B5TA 4GSUA 5DO2D 1HYSD 3L3GA 2FJGA 1V27A 4MMZC 4PS7A 1RI8A 4ZDHB 2XQYK 4E41D 4LBAA 2PO6D 5E70A 1IBFA 1T4WA 2GTQA 5JQIB 1J0KA 1E9OA 2FNWA 1I9RL 5C0DB 2J8HA 5DJ8B 1B0GB 3Q1SL 2FX9L 2ZE0A 2R4RH 2OW7A 2XWJA 1SOSA 4HGKC 3NOIA 4OZIA 3RVTD 5GRXG 1J1XH 2YAEA 2ENPA 4LKCA 2DI9A 2ZSWA 5F1IB 3RVWD 5FF6B 3PLYA 4G6AD 5E1GA 4ALAH 1CI3M 1NWOA 1UXWB 2YEVB 2YUVA 1M4KA 5BS0B 1LO5B 5D93C 1NBYA 1IEAB 2A9NL 4GT0A 4KZCA 1CFQA 2EIZA 1U3HA 4HEPG 2I60L 4PCSA 2FB4H 1NKRA 3GS4A 4NZDA 3V6BR 2O6FA 3IDGA 1E4XH 2C7UB 3MLXH 5IBLD 1RAMA 1Q1JH 1CLZL 3OMAB 3F04A 5I76A 4Z7AA 2AV1A 5TDPB 4PTUB 1KJ2A 1MW1A 5BO1L 5IB4A 1PU0A 2FUTA 4NZTL 2LABA 5J9PB 5IREA 4FL4C 1AZUA 3RWIB 2WZ5A 4AIOA 3GJEB 2CRMA 1M2VA 3NSCA 2MQ3A 4PRDA 5GGRY 4CW1A 1CBVH 4FQQB 1ORSA 2WVVA 1TU2A 2Y0SA 5FFOA 4O00A 2FJGB 4GUCA 3TOPA 3BKJL 4KDWA 4MNGB 5DEJA 4NNXA 4UMGA 2NNFA 1KSRA 5IMLA 1CDCA 2CLZB 4P5KA 4Q6YA 2Z91A 3AT8A 4X4MA 4XWOD 3M1BB 5GJSH 5DWPA 1T20A 5TGBA 4YE0A 4NB7A 3RPIA 2B2XL 4KO5A 3GBMH 4YMPA 3QJFB 3KD4A 3QUHA 4WWID 2HZHA 1HDMB 3QA3B 1UCBH 4FZ8L 5F1NA 4WZ9A 1BGXL 2V3FA 5FYJH 3SDDC 4U1JB 4DP7X 3QNZA 1Q72H 1QLRB 1KB5B 2P5ED 4XC3H 1KY7A 2IV8A 3EOTH 5IVOA 5SWZB 4H13C 2FSEA 4I5BA 1JF6A 2WM0A 5EUOA 5FR3A 5I28A 1X5ZA 4XP4L 1NIDA 4XI5D 4L5FH 4NQCB 4QEGA 3WNNA 3DMMA 4ZMVA 5BQ7B 1I4FA 3MLTA 1CICA 5KEZA 3VD9A 4O9HH 4P5MB 5CP3A 3FQRA 1RIVH 1N59B 3IB4A 5I2IA 3BKML 1ZMYA 3C6LB 4LVOC 4ADGA 1I9JL 5GISL 4B0MM 2AI0L 5H94A 5B39B 3GMLB 2J1WA 4DO6A 4LPXA 4EI6B 4AVJA 1Q9KB 4RFOH 3GJEA 4RWYL 3S7GA 1BJ1J 4QRUB 3OZ9L 2V17H 5GGVH 4U1HA 3P69A 4JRYD 4TV3A 5A6LA 3L3JB 3I9PA 1LP9B 1XGTA 4IDJH 3L5XL 3X1GA 3MRGA 2WXRA 4MX7B 4ONHB 5D5MF 3TBYA 3LIZH 1WIOA 1NEUA 2PR4L 1HOCB 2R4SL 5C0CD 4PCYA 3LRSA 4ZXBB 1X5FA 4ANVA 5HD8C 1J5CA 3WO3B 1K6QH 1UZ8A 1YEDA 4PJBA 1HCFX 3BH8B 4JVPA 3ZBMA 5GS1B 2CU9A 5IV2B 2D3VA 2X4UB 4LSVH 3LEVL 4PJHE 2VKXA 4JRYB 3LXBA 3NJIA 5KSBF 2XN1A 4F8TA 4J5VA 3BAKA 4GXFA 1JPEA 2WBJB 3NDZE 2X4PB 5DQDL 2KS0A 2PCXA 3PHQA 1L9TA 4P2RE 1WFMA 1CGTA 4FXKB 3WUWB 2ROXA 4CMMB 5B38B 1YYLH 3QUYD 1SLWA 2OJEB 2G30A 3NTCL 3PGFH 1B0GA 4CC4A 4ZMNA 1TQSA 4ENED 3VD4A 3O8XA 4J4PD 5JO5B 2FECL 3TBTB 3ZMNA 1G7IB 1JN6B 3S5LA 3HZKB 3D48R 1YLBB 5DJAB 1PX4A 3VXRA 5JQ6H 3QS2A 3WENA 1DLFH 4G9DB 2OQJB 3QWOB 43C9B 4R97C 4WY7L 2O72A 2D4FA 5A2KH 2QKSA 1DUYA 3EH5B 3STBA 1PZAA 1A64A 3GSRB 4UQ2B 2XA8H 4FFYL 4Y4FB 4X9YA 1HL5A 2KUTA 4EDXB 1IC7L 4HIEA 3D0VA 2OYPA 4LBEB 1JUFA 4ZX3A 1BYNA 4KXZH 1TQBB 3SD2A 5IVXF 3L3OC 2OZNA 3A67L 4U3CA 3ISRA 4GG8A 3AREB 1TNMA 3V79C 3MV8D 4I1PA 3QEGL 2GJ6B 3P3RA 5C0BE 5IEKA 3GHEL 1DP0A 2HB0A 1AYOA 4HHAB 1FE8H 4GKOA 3TV3L 2KMWA 3S35L 2OMWB 3F83A 5HD8D 3EO0A 3NJKA 4F5CE 2TAAA 2EDBA 5C6PB 1XTMA 1I8UA 5HGBA 1KZQA 2PR9A 3BKYL 3PAVA 4IKJA 3MRNA 2GSIB 4NX0A 4OB5L 2CBOA 5BUGA 3LZFH 1N26A 3QDME 3GBNL 4E42B 3FTGB 5EU3B 1M71A 4RGOH 4BQ8A 1KFAH 1XT5A 4NUQA 5EZJB 3K6NA 3BQUD 4D9LL 1NPJA 2VDPL 4UQ9A 3C5XA 4Q6IA 3EJSA 3T8VA 3ZTNL 2PPFA 2DD8H 3VFNB 5GIRA 5IROA 3U6XA 1EHNA 3EYSL 4CMHB 3T71A 1CB4A 1OLZA 4YN3A 3BEVB 2BVEA 3B2XA 3QNYB 4PG9B 4LT7A 1MFDH 1U93B 5CBAB 3AFLA 4U2ZA 3IM1A 3KS0J 2VJ0A 1FSKB 2GBUA 5JZ7D 1PX8A 1U8IA 3PCYA 1VGEL 4PRNA 2HKHH 1ZHNA 3GUTB 4FEIA 4JFDA 2XX1A 2YS4A 1FV1B 2YOAA 2MKLC 1PKQB 2B1AH 3HUJE 5L6YH 3K0YA 1ECZA 2Z7YA 4KTEL 4M8QB 3ZW3A 4DQOH 5FHBL 4HXBH 4HZ1A 2QADC 1EBAA 1AR1D 3FOLB 3W37A 5AVTB 4XWGL 2CZNA 4GMSL 4Q4IA 4JFEB 2IDCA 5C0FA 3WJJC 5F89B 4Q7DA 3IFPB 4NBZB 4MJ5B 4HC1L 2MFNA 1JPFB 4NWUL 5IT2L 3L7EA 4NLHA 4KVCL 4XVJL 2O61B 1A6WH 1KLGB 4L8DB 5J1AB 3DVNB 5AW1B 1CR9H 1ZVNA 3OC8A 3KXFA 4PJXF 3PL6C 2OMZA 4XO5A 3RB5A 3V4UH 3BN9C 3VDBA 1XF2B 2WLYA 5HVGB 4P3DA 5EFIA 3MR9A 5IJKC 1U8JB 4XGZA 4QCIB 3MV8A 4UYPA 4HOZA 1P7KA 4I0PD 3SGJA 4AV5A 3O2VL 1LILA 1PZSA 2BSSA 3O0RL 3N44B 1RPKA 2HWZH 3VI4E 1OSPH 4NRXA 2IQ9L 2BCKB 3REWA 3ROOA 1U91B 4M4RA 35C8L 3NAAL 3Q3GA 5E0QA 2Z93B 1OTTD 4YSOA 1WC7A 1J48A 1VACB 2OMVB 2VLJA 3D0LA 3H8NA 2O1AA 4HPOH 4QTIL 4AK2A 1PY4A 4UZUA 3PHSA 4EI0A 2VITA 3PWPD 3MGOA 4N0RA 1KV7A 4L3EE 1T6VN 5AW8B 5E1IA 3CV5A 4OBRA 4X7FC 3MAWA 2P8LA 3B3IB 1OSEA 4JRYE 5MEQB 1NOAA 1W8EA 1H15A 2Q86A 2ATKB 4TKWA 3G5VB 4IYKA 3JYBA 1UATA 4JFFB 4LQ1A 4Y1AE 4OZ4A 2VERA 3CQFA 1P7QD 3DVNA 1UM4L 4OLUH 4XB8A 3MBED 5HHOE 3U4KA 5DUJA 5TPWL 5F6HI 4A7SA 3SKOA 1KCVL 5LN4A 3W57A 2ZNXA 4PSRA 4P3DB 5EFIB 3A6CL 1FYHB 2O6DA 1JWSB 1PDKB 4WK2B 1SYVA 2UY7B 4GH7B 1UQSA 3ABLB 1ANUA 3ASNB 1K72A 2AV7A 5BO1H 4HIJA 2VUOA 3GJFB 4Z3JA 4R4FL 2V3EA 2CXGA 4OF8A 4LOFA 5D8JH 4PCKA 3V6FB 1CLYL 3DX4A 2Q3XA 3V9EA 3NJXA 4JKPH 1SEBB 5CZRA 2ZCHL 3UTSA 1EJOL 1UOWA 4KY2A 4L37B 3SDYH 2MOQA 3ZOAA 2ETWA 2SEBB 2SODB 5CJQH 1ZA6B 5ENWA 1FYTD 4A04A 1U8KB 5CD3A 3AGWA 2K45A 4K94H 2V9RA 4WW1A 3FSAA 5DMGD 2XT1B 1QQDB 4HEMA 3UZEA 1KIRB 3Q2CA 5JW4N 1AH1A 2WB1A 3BO8B 3V4LA 2ZXBA 2BERA 3RY4A 1QFWH 1NMBL 3S48A 3SKJH 1NIFA 3HMXA 4FG6C 4XO9A 4EAEA 3HE6A 2BHYA 3D18B 3PPSA 3RWIA 1J9SA 4PG9A 4AQ1C 2ZCLL 2WTRB 2VR6A 4K15A 1RUMH 4P5SA 1FYTA 1B9KA 2ENJA 2IPKA 2XVBA 4XOEA 3VFNA 2DIAA 4NN5B 4ZAKC 1SXNA 5CEYA 2P5WE 3MRLB 3QZNA 1MHEB 5C08B 4J3VA 4EZLA 3KLDA 4WUUD 2VDOB 2EIJB 2CUHA 2WQWA 4NRZA 4WW2A 4NUPA 5KSAA 2X1QA 2AJYL 1QLEB 4R2GC 1FSKC 3VSVA 1XZWA 2BIQA 3OKKB 4R4NC 5D1QE 1CYGA 2NY7H 3OJDA 3ARBB 2BXYA 3MBEC 5TH2A 2N4IA 1RZGB 1S7WA 4HK3J 1BVLB 3WIFB 1GSKA 4LP5A 1DBBL 2XZQL 1KN2H 2IBGA 2VO8A 1J9RA 3KPSE 3H9YA 4GI6A 4WSKA 2KQMA 1XR9A 4GYBA 1Y0LB 1QFUL 2AGJH 4KRPB 3BKCL 4NDMB 4ZSOE 5FW6A 1QABA 5LBSA 1DANT 1W8NA 1F42A 3B1UA 3QFJE 3BP5A 3T0WA 1EAQA 3X3GH 5KBKA 4BUQA 5E8DL 3S8FB 1PCXA 4N85A 5BRZD 3MNVB 1E5UI 2PXYB 3PDDA 4AIZA 1RIHL 4S0TD 3ZHDA 2LT9A 3RBSA 5CU5A 4F37F 3LKQA 2FZ3A 2KZWA 1SLUA 4YLBA 1JZ6A 3HAEB 3MKKA 4FXKA 2QQNH 4Y9CA 5JPMC 3HKFA 4G5ZH 2J6EH 1GPOL 2BVYA 2ZD0A 3NGBC 3ZDZF 3ZDYE 3CG8A 3GK8L 1YYLL 1O6TA 5C86A 2H26B 2Z31A 5BRZA 3FN0L 1X4YA 3RG1C 4KZ0A 3WAJA 1T03H 2G75B 2Q0ZX 3CFJA 1HEZA 4G9DA 4QDGA 1XSOA 5MHSE 1ILUA 3BC9A 4A6YH 2D0GA 3G5ZA 3BW9A 2CO7B 2F8XC 4L18A 3QB7C 2EXTA 2GSGB 4M93C 1LYQA 2WN3A 4L3EB 4XN5A 3UTPE 3SHSA 4EVNA 4Z7IA 1A6PA 3QUYB 3QQDB 3OZKA 3NACL 5GJTL 5I16A 3UAJA 3TF4A 4BZ2L 3IF1A 2R56H 1RJLB 2NYZA 3I9AA 1KELH 3MRKB 3PHQB 1WFJA 3PWJA 2IQAB 1OVZA 3MA9L 1FH5L 3QULA 4G8EB 3X17A 4C56E 2Y4SA 4JPWL 3OJDB 4U1LB 5K9JH 2EUXA 2EIKB 1FNEB 4YSPA 1EHLL 4OFKA 3V95A 3LKSA 3VXUD 3DURB 5FLUA 4YDKH 2EE2A 5IOKA 3STLA 4XAWL 1HH6A 3HVNA 5IVNA 5I8OL 4N2KA 4KZEL 3DJZA 4NKOB 2VC2B 1NDMB 4Z76A 1A4CA 2WIIB 5AVWB 4MFHA 2ED8A 5C0ND 5TD4A 3K8LA 1IEHA 1K8DB 3UZVB 1HINL 3T3PF 2GVYA 5LGHH 2DEWX 5AVQB 3O6FC 4OFDA 5GS1C 4KRPC 2YZ1A 3ZDYF 2Z34A 1NBCA 4FQXB 2O5YL 2DJMA 2X2UA 5E94A 2KLSA 1U3HC 4XNBA 4NENB 3CVCA 4WW1B 1QFOA 3R8BB 3ARBC 3WY3A 4N5ED 2BNRE 1HZLA 2Q76B 2OMTA 1HXYA 2DEYX 3CU1A 4JKKA 4CU8A 3A3YB 1FF5A 3EYSH 1CD1B 1M2VB 3PXJA 4BFRA 3TBTA 3WDHA 1MFDL 4LCUB 5I0ZA 3K91A 4K71B 3DIDA 4QGTA 3VXSE 4E0RB 4ODWA 1ZGLB 5C09B 3BSZL 2JFCA 1JWSA 1PDKA 4L9LA 2B1AL 1ZY9A 4FFWC 3UGEA 4YQXL 4DSYA 1OCWH 1CXIA 3MV9E 4TVSa 4B7IA 1OP9A 4GFXA 2FQFA 1TZGH 1R19A 3MUGB 3WG7B 2FWUA 3FFCD 4O51B 1H8LA 5CR8A 2XFXB 3MRCB 1XSJA 3S96A 5TH2B 3BIAX 2PWEA 4OFIA 4AMWA 3QG6B 2UWEA 1ZWIB 1YECL 4Y1TA 1JZJA 4PJBE 4ZZFA 3SO5A 3JUZA 3ECUA 5ESVA 4N8VA 4H26B 2DIEA 4HGWA 4YDNA 1HZKA 4LP8A 3WKQA 5AL0A 1JHTA 1TJHL 4LARL 3JWOH 5FWRA 4I2XE 2OA9A 2CBQA 3WJMA 2NYKA 5CM1A 4FXGB 1S5IH 4IBUA 5DRXB 4FJYA 1BMZA 2JK5A 2KKQA 1AQDB 2DY2A 4R83A 1U8KA 5HHOB 3DV6B 1DL7L 2VKWA 1ZT7A 3QR2A 1MF2L 5D1ZD 2DYPB 3L8QA 1SXAA 1HZHH 3Q9QA 2X7LA 5HHMB 3MV7A 1FDLL 1FUNA 1OHQA 1AGBB 3K80A 1I75A 2WUCL 5GZNC 4KZDL 3GLAA 4HF5H 4A38A 4KO6A 1OK0A 3WMSA 4EZKA 2F19L 2EDOA 3WFDL 5A7BA 1JZDC 1Q94B 2BRRL 1D6EB 4MRBA 1IGTB 4LHJB 3NRPA 2VMDA 4NP4H 3ZRSA 2NY0D 5C7XH 2H32A 4NJAL 4HWNA 3AS2A 3D06A 1S9WB 2Q5BA 5FC9A 1BOGB 4HWEL 1ZJAA 4LGSB 4P48A 3T8XB 2YRLA 4Z7VA 4X8JA 3RIKA 4DGWC 5JR1L 4PR5A 2QDWA 4WI6A 2Z8VC 4FXLA 4LRIA 5DS8A 1XF4A 4PJIF 1QO3A 1KCWA 1JHKH 1RUKH 4PGJA 1KOAA 3WHE1 1JK9A 4HU8A 1AD9A 2APFA 1A4JA 1M7DB 5D2NC 2AJZB 2KPWA 1IKNA 2VJXA 2BVTA 3H54A 2D8KA 5J9PA 2EIDA 1AQ8A 1C5BL 2MIZA 4MMZB 1B90A 2GT9A 1EO8H 1XCQB 4UF7C 4ZUWB 4E9QA 1MW0A 3HBPA 4MMYB 4D8PB 1UQSB 1YY8A 1DQIA 1WT5A 3C60D 3ATEA 3HRZB 4HU2A 3VU1A 1MAML 4LSUL 1N18A 2ZOTA 2QSCH 4HUNB 2XETA 1WC7B 3GBDA 4OJAA 4BH8B 4D8OA 4R7NB 4PLKC 2ODHA 4DZ8A 4MJIA 1OAZL 1LE9A 4TVPH 2GIYA 2AXGB 3B2VL 2EXYC 2PPAA 2UX6A 3OJVC 3RDJA 3SCMA 2XNAB 4I48A 4I3RL 3W39A 3SKJL 1U6AH 4PJ7B 4M4RB 1MWAB 4O02B 2DWDA 5EC2B 3T6WA 2X70A 4OCWL 5I16B 3GHBH 1J88A 3ZXAC 5DURD 2N1KA 1G9EA 2VL4A 3VG9B 1UXLA 4JM2C 3QORC 4MD5A 5JIPA 1TTAA 3BW9B 1JHLH 1CE6B 3CFCH 4KHTH 2WSDA 5DJCA 3OAZK 3KPMA 5C9JB 2VIRA 2CJ3A 1NMAH 1IJNA 9CGTA 2Z0UA 1U8LA 3WTSA 1GYAA 1N5AA 1B0RA 1T0MA 3IU4L 5CWSA 3KPPB 3NIDB 3MCKB 1SZNA 3V5DA 2MHAB 4NZRH 3DSNA 3S88L 3STZB 5DK2A 1RZJH 3NPSC 2AZUA 5KZCD 1MJ7L 1J05B 3IFOB 2YSSB 2XZQH 4XNXL 3HHSA 3TH2T 1G9NL 2DV6A 3MOBL 1EFXD 5HPOA 3QNYA 4AH2A 4C4UA 1AMYA 1M56B 1SJVA 3BFQG 5B3SB 1A7RH 1DQML 2ZKXA 1DVFA 1WBYA 2D03L 2E59A 1DBKH 1NIBA 5IJVA 1G7MA 4OFVA 5C09E 2IADA 4G8GB 1QBML 1WA0X 3PGCB 1BF8A 4JDEB 1UJ3A 3DOSA 4LNVA 5ISZE 3L5IA 1ZGLP 2IBBA 3AU1A 2DQJL 3AREC 3B8YA 1YDPB 2J6EL 1UD3A 1MSPA 1N67A 4K3JH 4MNGE 4L2YA 4HSQA 2XI9A 3SCMB 1AD0B 2VABA 3F85A 1DFBL 4JG0H 4HDIB 5GRYA 1F1DA 3NPZB 1YYCA 2DTSA 1M71B 3L9YA 1CDHA 2XIDA 2D3JA 1MHEA 2B20A 1KBGL 4UINH 4AE0A 4NNPL 1R3HA 4XE0A 2WYIA 3FUKA 3G08B 3C6LD 1Y7VA 4GKSB 5E2VL 2IWEA 4GG6E 3DBXB 1KCUL 2HVKA 1GS7A 3QDJE 5I24A 3BD4A 3Q6GL 5GHWH 2VDNL 4PG2C 3VGAC 3UC0L 5KVEL 1OGAA 3MRJB 2ZUXA 2C34A 3AC0A 4PBVC 3EAKA 4N2IA 2A4ZA 1HSAB 2A73B 4P3CH 1E8WA 4GRLB 4WEMB 4JFZH 5F7MC 3NFPA 3OSKA 3S98A 5T3ZL 1H9DA 5SV4A 5LAXB 1YPZE 1SEQH 1BREA 3QWQB 1EHLH 3SDAA 4FXKC 1D5MA 3BVNB 3QIWD 3DJSA 5DS8B 4MJIB 3MU3A 1IVTA 1U8NB 1JFHA 2BJML 4KX8A 2EEBA 4TTGA 5BRPA 2RAMA 1X5MA 3L9RA 2L8AA 1P9MA 1NANI 2X4TA 4F2EA 5DJ0B 3TVMA 4WJ5A 4DUVA 5DEFB 2G5RA 2GT9B 2DQHH 2BWQA 3ML9A 1FVEA 3CCHB 5C07B 4Z3FA 2OMXB 3RJQB 4LOVA 5GGSB 3TCXA 2GBVA 3VGBA 3VRLE 2LVCA 1R46A 2O5YH 2ZX5A 1KN4L 1C16A 2R0WH 5BZWB 4Y4HC 5DURB 1JN6A 1DBJH 2H1XA 4IKLA 3ZHLA 2QVFB 1OEZW 3OAYK 4O2CB 3FUDA 4OGXL 1EEUA 2AJVH 5HHOA 1BD2A 2XUWA 1W15A 1YY9C 1R5IB 5I8KH 2IANB 3OL2A 5AWNL 2VDLL 1C5CH 1DLHA 2ZKYA 4PGZA 3T8XA 4YL9A 5F0PB 4OD1L 2ZF9A 4D0BA 2F0CA 5DRNA 2QHRH 3G6DL 3NCJH 1KXHA 2G9HB 3C6LC 1FAIL 1F4AA 3KNBA 3VFPB 4C4BA 5E6SB 5MI0C 4OD3H 4P5TC 1D6EA 3RIAK 1RZ7H 2P5WA 3NABH 1CE6A 5DJCB 1AVAA 2HT3C 5HDQL 3FN9A 5DD1H 2MEJB 4KH2A 3ABKB 5EOQH 1A3LH 4HPYL 1Q9KA 3G04A 2IDUA 4M6AA 3TBYB 3UROR 1I31A 4KKQA 5TE4L 1T21B 2CHNA 4NO0B 4FG4A 3G5XA 5TJWK 3O9WC 4PJBB 2H2PD 3DX8B 3HE6C 2AANA 2J71A 2X4NA 4IRJA 1M7DA 2W0LA 2BY0A 4LDLB 2PP9A 3VFSB 5IGXH 4QRRD 1HHJA 1RUAL 3FQWB 4G59C 4KQ4L 4ZUWA 2VQ4A 2J4WL 2CR3A 2L7EA 2Y9RT 4ZRGA 1TEGA 4R96B 2FDBP 2WOYA 1ND0B 1JZ8A 1ZTXL 2W65A 4Q2ZA 2XLLA 5TTRA 3QG6A 3QAZB 2QVMA 3CXFA 3CDGB 2LR4A 1NWPA 1KCBA 3TO2B 5JHAA 1BFOA 1LWRA 1Z9NA 2Z8RA 2C4FT 1SJXA 1QPPA 2BSRB 4BFBD 4RH4A 1JZ5A 2YWZA 2AC0A 1TYEB 5IIEB 5SWZA 2G60L 3SOTA 4HS8L 3FB5B 3NT0A 2EIBA 4UOW0 1CF8L 1P69B 2ZUUA 4OVVA 3TF7C 4WHTB 2I26N 4FMVA 2AJXL 4BE5A 5DRWA 2XQBL 4ANKA 3KM1A 3HE7A 2VUKA 3WFCH 5IHBA 3RVXC 3H4FA 4MBRA 5TE6L 2NSMA 1JF5A 1ZIBA 1A9EA 2X87A 3DJTA 4H25B 5BVPH 4P5KB 3QNZB 5TF1L 1T5WA 3QBTB 3BAWA 3BGMB 1AGBA 1N68A 1V3LA 3MQIA 2IAMC 2MWCA 4Y2DC 3GDBA 5F7DB 4KAQL 4K3DL 3FB8A 3MRMA 1QNZL 2M1KA 5DS2A 3TC9A 2H1LM 1LJMA 2EADA 4Q14A 3WEXA 3PY9A 2E7DA 1F6LL 4XNAA 2IJ0C 5LGKA 3ZL1A 1RSYA 5DK0A 1ZHKB 2F53D 1WIPA 1ZLSH 4ANXA 2C7UA 2A3TA 4IRJB 3V6OA 3P9MA 1VFOA 5CHNA 2GJZA 1HE7A 2C1PB 4C56D 1DJSA 2CPUA 4B95C 2GHWB 3HG0A 4HHAA 3L4XA 3QQ4B 3QUYA 1OT4A 3EJPA 1BXXA 1ZWIA 4NUGL 1INDH 2VXQH 1XWVA 1I1AA 3KWTA 4DP9X 1IKNC 2DTMH 3V4VH 3BQUC 2KERA 3UJJH 4HX1B 4XC1L 2BM3A 3D25A 1OW0C 2CCVA 1GZHC 3JWNG 4GAFB 3IJYA 3MLUL 5A43C 2AEIT 5EBWB 5C97A 1UH2A 2GBAA 1WAAF 2CIKB 2FBOJ 1H3PL 2GG1A 1CVRA 5LN8A 4PTTA 2EDDA 3CFQA 3NA4A 1S46A 2XHNA 2F2HA 4D0BB 3S8WA 4UT9A 3ZMEA 1L0YA 4PLJC 2FTAA 2PN5A 4OCWH 1AGDA 1JDDA 1WG3A 2IWGA 5IHUL 2H45A 1E2ZA 1GGUA 3RVXD 3ZKMC 5CXPA 2GFBA 4DUWA 4OJDH 4IRZL 1R75A 4TSCH 3TPUB 4WCYL 3QFDA 4I13B 5DJAA 5F7UA 4NQSA 4XH2A 3KLSA 2P46B 2B59A 5EA0H 1AXIB 3QRFM 2Y36L 4NAJA 4QOKB 4BBWA 1N9PA 4WWNA 5HYJE 1A1MA 5I0WA 4N87A 2MKWA 5IBUB 1BZQK 4AGPA 3RL2B 2NLJB 3RWJA 1TEFA 1KPUA 3WIFA 4QRQB 3W2DH 5I1JL 5I0VA 4GW4B 3KPSD 2OMTB 1F02I 3ZZ1A 1MJ7H 2CDEB 1ACCA 5BVJB 4FADA 1JBJA 3LEYL 3SJVE 2IH8A 1G9NH 3ISWA 5C0BB 4H8WL 1S3RA 4Z0XB 2ESVA 3TLRA 1TSHA 2BH0A 3QDGE 2VL5B 3U46A 2I60H 2JI1A 1EGJA 2ZKHL 3RPKA 4DJMA 4FQJL 4DPRA 4PUBH 1Q4NX 1X7TA 4MYWB 1PJWA 4X83A 4LFHG 4NZTH 4LSDA 4OLXL 3ZQ9A 4GSDL 1U95B 5L2KE 3RNKA 3UL4A 1MCNA 3CHOA 5CJOL 1NIEA 3MJ8A 5HI3C 1L0PA 2ESVD 4JKWA 2AQSA 4AT6B 1PNDA 4QTHB 2H4EA 5E2UL 3IWVA 3L6FB 3EZ8A 5I1GH 5FUZH 5BXFB 3QQ3A 4JO3H 1NFDF 3DPBA 3MRQA 3PJSA 3BZEB 5IR1B 1XIWD 2EEXA 1PY9A 2OI9C 3K71B 2ICCA 1HJBC 2R8SL 1R17A 1R3IH 2EDJA 1NCDH 1D7BA 3VWJC 2DQEL 2OL3A 5IHZB 2AP2A 4J1UA 5CILL 3BN3B 4W4NA 1INQB 4AL8H 5D1QB 3FMGL 3DA0A 5HBBA 1A47A 1Q8MA 2P5EE 4LCWE 4MCZA 5KVEH 3TASA 4E9TA 2EH8L 3RA7H 3SDCA 5IB5A 1CD9B 3I75A 3LRGA 3K2IA 3MX0A 1A4KB 2XN9E 3L1OH 3KGRA 5C2UB 1IU1A 3GZOA 3OZLA 2EP6A 3PWLA 4LPYA 4DERA 4ZO7A 1U58B 1RZQA 3FT4B 3SKMB 4LEOB 3Q43A 3P0YH 1HAUA 2NY1C 3EBHA 1XGPA 2QPSA 4OM1H 1MLCB 2JCCA 1A6AA 3E6FA 3FU0A 3VE0A 4JFFA 1IEBA 4P2AA 3TO2A 4EN3C 1MCQA 1I3RB 4QYOA 3V5KB 4MD0A 2FIKB 5MENE 1WAEA 1KWGA 3DWTA 1WQVT 1MCPL 1SGKA 1F6AA 2E4TA 3QO1A 3IJYB 3QNXA 3U79A 3K4DA 4FNPA 4WI2A 4HIJB 1JJUA 1U8HB 4W93A 1P7BA 3K3QA 5L8LB 1NFIB 2NOYA 3KJ4C 2F8IA 2WIMA 1TTGA 2PR4H 4I2XA 4WO4A 4BWWA 2VZOA 4J3OD 3WY2A 5E6ID 1MDAA 5I19H 2OMYA 3CWGA 3OV6A 3I3BA 3ARDA 2NW3B 2FD6L 3U0PA 5F3BB 3VX1A 1UWYA 1EEYA 5KVFL 3U1QA 4IHOB 3O0LA 4Y0GA 5FUCC 2RQ8A 2BNRA 2E7HA 2HTKD 1MQ8A 3H6AA 5IFJA 4LSQH 2V7NA 4K9JA 2J25A 4OD1H 4PJ5B 3MRRA 3AWFA 4QHKI 3VXSD 3SPCA 1FAIH 4F7PB 2NYYC 1TVBA 1HYRC 4L9DA 4NUJB 4ELDA 1RZ7L 2KLRA 1WDAA 4AEHH 4GMTL 2G9HA 2CR6A 4X6FA 4KRLB 2FATH 2BNRD 1SLXA 4F20A 3WN5B 1QG3A 2W9DL 3ME0A 3RGVD 4H1LB 5KW9L 5EC1A 3BMWA 3RTQB 3HUJB 1TQUA 5E9DD 4ACPA 3NH7H 2B7DT 4XAKE 4YNYA 3HJEA 4F58H 3RRQA 1PZ3A 1SUHA 1FWXA 1O5PA 2A9NH 3O9WB 4BE6A 4J3BA 3ZJAA 4PIBA 1S7TA 2Q7YB 5ITFB 1A6VL 3MLXL 2J72A 3UPRA 2JCWA 2OMXA 4D7PA 2K9FB 2Q3AA 3H53A 2YGVA 3C5JA 5LBSH 1Z0MA 4S0HA 4CN4A 1ZA6A 5ENWB 2B1HL 1KGJA 5DFTA 2P1YA 1E28B 2IH9A 1KLFB 3A67H 5BPPA 1HWHB 3F7VA 3GXTA 1BFOB 2GQHA 2C9UA 3CDGA 4MNHB 1A1OB 1J7VR 2X4QB 3T4YB 4NQEE 1ZSHA 5T3ZD 4OZIE 4Z7WB 2W9EH 3H9HA 4R96A 2HRGA 4JQIL 3LNEA 3TH4T 4RLDA 1BX2A 4KJQC 4YHZL 5GJSL 4ZMZA 1TG8A 2NY3D 4NUJA 1ZSDA 3LQAC 1AGEA 2FEDC 3BKYH 5CU9A 1RIUL 1I3UA 1S78C 3N50A 3ARED 1YQVL 4Q9RH 1FZJA 2HTKC 1VACA 1RZFH 2VLJB 1QEWA 3D0LB 3DDFA 4L8SA 1M6OA 1U21A 4JPVH 4G8GD 4KUZH 2WVSA 3MJGX 2GEEA 4RFEA 2VM3A 4HJUA 3RGBA 4C56A 3B3BA 1KDJA 1NUFA 3QCVH 1SF5A 1N3NA 4LSPL 4V2CB 3RTLA 3UG4A 1RY7B 2HTLD 2JB6A 5IQNA 2CR0A 1L0XA 4L48A 2AMUA 2Z0BA 2FH6A 4XNZC 3AS1A 1OTSD 1DVUA 4LHUG 1BSIA 1E4WH 3MCG1 5GISH 4YVUA 1IUZA 2QKIB 4UDTB 5JHMA 2EDMA 2E6QA 2D7MA 5FM4A 3UCQA 2PMZA 3AACA 1FVDA 1MPAL 3LV3A 3P4NB 3TBSB 4AXWA 4CBZA 4GUQA 4LNRB 5ID1A 2WZPA 3U1SH 2OJ1A 5CGBA 1S8DA 5DZ9A 2Y6SD 3EYVB 3FH7A 3FZUC 4DKDC 4IU3A 1A6UL 1L9QA 4UWQB 4Q0XH 2ITCA 1JYWA 4J2XA 2HXAA 1OQOA 3MO1B 2ZOKA 3UERA 1JPFA 4WGKA 3SZKC 4HG4K 3KPTA 1DVFB 2H2PC 3CSYB 2XWZA 1HXMB 4CDGC 4URKA 2BLFA 4P2QA 1RH8A 4GS7C 2NYYD 5IVZA 2YLHA 3H4HA 1RK0A 1XGRB 3LKRB 4X6BB 2F6AA 2F1BA 3SPVB 4LSVL 3T0AA 5AG9A 4GQZA 5FM8A 2BK8A 2E7CA 4PS4H 4XT1C 5D7JD 5D1QD 1M1XB 3II1A 3U2JA 1F58L 1GGBL 1OGAD 2QQLH 1HH9A 2J5LB 3ECBA 4UT7H 1GOFA 1OW0A 3X1EA 5CN2A 5DK3A 3IGUA 3K2UL 3MREB 3CZLA 4ZO8A 5BOZG 3MLVH 3HS0B 3P54A 4XMLL 5IHZA 4GO8A 3FT3A 5JNYB 1RL1A 4BCXA 2D31B 3BHBB 3R0MA 4GSQA 2ICEB 1FZKA 1F3RB 2V8LA 5T1KB 4JMNA 4WWPA 4BDVB 4X5XB 1QR1A 5AW5B 1YNKH 3T3PE 3Q5OA 1FCGA 5KVDH 4E41E 3NJFA 3BAEH 2VMJA 2C3XA 4CN1A 4PJ8B 2RH0A 1YUKB 4D7BA 3I75B 4HCRL 4BRJA 3NK3A 5DJZB 4YBLB 2E9WA 2YD6A 4YOKA 1IAOA 3OLIA 3WJLC 1S7XA 1TZIA 3MRBB 3GSVB 4G8AC 4LOUD 4MB5A 4ZOBA 4UOJA 1G94A 3LZLA 3N55A 1F56A 2B0SH 3FQTB 1A9VA 3RL1B 3AG4B 5DRZB 4RIRA 4TULH 4KO9A 1UM4H 3DURA 4LGRB 3PHOA 2HLEB 2CBTA 3DIFB 4NKQB 4I1NB 1KIQA 4C4KO 5KG9A 3B9KB 3QEGH 3CBJB 4PJBF 5FOJA 4L5FE 2AJ3A 1LE5A 1E2WA 1KLUB 4ICXA 1AZBA 4I9WD 2YMTA 5F21B 4WKZA 4AYDC 5GSRB 2FLRT 3AG2B 3OWRA 2VLJD 1FIGL 4FTVD 4HETA 3IFNH 1PEZA 1LD9A 5SV3A 3JTSA 3IU3A 3MRPA 5FHAL 3NEXA 4W6WB 3CZFB 1D7FA 5DMIL 5DEZA 4HLJA 3KH3A 1NCDL 5IUSA 1XDTT 4MA7H 2OXGA 3D85A 4L4VB 1NCOA 4OQTH 1X7QB 3QFJB 4IGBB 5ILTL 4G6JL 2VDPH 5I1EL 4NQDB 3DX1A 1T1YA 2WSKA 1EV2E 2X3AA 3P3TA 2A5UA 3PP4L 4G8FB 1M9WA 4HV8B 2OSLA 2IV9A 1SDDB 5MENB 2JJWA 1J9QA 3DTDA 4D2NA 1CXKA 3B2MA 1MRCH 2X28A 3EDKA 4L8CB 2A7BA 2BVPB 2GUYA 3UJTH 2ENQA 3KEHA 2F7RA 5AZEH 3R4RA 2H32H 5FDWB 1IGYB 4Q9QL 1YQ2A 2QT6A 4AV0A 1G4RA 1DQJB 2X6MA 3KBFA 1UURA 2QZ5A 3V4PB 2GTZB 3ZRCC 3WFHA 4RRPA 5AW7B 3UTTD 3IGLA 1KCRH 1B4JH 4J3SA 3L1FA 3U7YH 4EIUA 5F6HJ 4K07A 4I0PB 3FQXA 2NY1B 3WOVA 1OP3H 5SWQB 5HHQB 4PP1D 1KIUA 2DQDL 1MCPH 1I8IB 3WO4C 3MRHA 4XHJD 2KQNA 2D9QB 3HG1A 3FSOA 1QZNA 4Z6AT 2AV1B 1S3KL 3FTZA 3GM0A 1J1PH 1E42A 1GY2A 1OSZB 1GCYA 2F53B 4JMXA 4KKCD 3IDXH 2Q2LA 1TQCB 1I1RA 4AEEA 4MMYA 4NQUA 4MXVE 4XMKH 4FG2A 4K8RH 4P9MH 3A0OA 1LP9A 1MVUA 1XGTB 3KJ6H 2V37A 4L23A 4X0KA 1TQWA 1OAYH 5F1OB 2VQ1A 2D3LA 2WC7A 35C8H 2C9VA 2NTSP 3F7PC 4PAZA 3EYQC 2E7LC 2X9WA 4KK9D 4PRID 5AVYB 4ZYKB 4DOHE 1IGJB 2O93L 4G11A 4HIQA 4BINA 5T5FA 4FXGC 5H94B 5B39A 1IFHH 2YPLB 3BZ4A 3DHUA 4JGUA 5BCAA 1IGFH 5EUOB 1UG9A 1MUJA 4AGMA 5JOFA 4QD2E 3LS5L 3N6YA 3HR6A 4B9FA 3RY6C 5C0DA 2P9RA 4QRBA 1D5XA 5F96L 4Q9CA 4OF3A 2VERN 3S4SG 1PQZB 3P77A 5JPNB 3K6OA 5KW9H 2FSEB 2ZUYA 2G3XA 4HH8A 2W8CA 3GXDA 3MLWH 4O2FB 5AW9B 3O45A 1DZBA 1DQLL 1OGTB 1S9XA 4PTUA 3WDJA 4FTVE 3FTUA 1YEJH 3B43A 1FH5H 3HS8A 5C0AD 3TNNB 4IDLA 3CX5J 3O6FA 3CSBA 1IT9H 3LVEA 4NQEB 4APQA 2QR0B 2QFPA 3FQ4A 1CZ8H 1KJ2B 1YEHL 2AK4B 2A6DA 4LLUA 3M1CA 1O9VA 2AEQL 4BHUA 3UZQA 1AO7B 2BNQA 3ETTA 3GMNB 1EZLA 5HI4C 3S34H 2OTWB 3NIDF 4OR1A 1JGLH 1HU8A 3GSQB 5DHDA 1JDAA 3STLB 4B5ZA 3FBQA 3ZK0A 5I18H 4A7UA 5CEZH 4YBQD 3KWUA 2CQVA 3BQVA 4JPIB 5GRVK 3WL9B 5IBTL 3VFPA 2KBGA 3W56A 4ZFQA 4ZPTA 1RZFL 3OKMB 1F3JA 4I8DA 3ZQXA 1IGYA 3SGEH 4AQAB 1U8MA 4YHYC 4M8UA 5E6IC 2GC4C 3BD5A 3I6KA 3TA3B 2EDRA 1IBGL 4ODXB 4DK5A 3EHBC 5EZPA 1FNSH 1A02N 3O2WL 4PW9A 4P99A 4K0OA 3L3GB 2X2IA 4ZDHA 3P30H 3EO9L 1I7TA 3PWNB 1HEZB 1ET8A 3S9DB 2XG5B 3T0ED 4AW7A 4PVBA 4P2RD 5GGVY 4GXUN 1N0XL 1PZ5B 2IALB 1EZUA 4IK6A 2O61A 1HHIB 3QUML 4N3UA 5ERWB 3GKWL 1GA2A 1ZT4A 3MLSH 4G6FD 4X7TB 3QHZL 1TZGL 4JFEA 4DHLA 4BQBA 2JI2A 4NIKB 3EUDA 2VISA 2BOCB 4Q0XL 5J8OA 2MNWA 5EU6E 1G7HA 1I7ZA 3BKCH 4WSGA 3G6JE 2X44D 4PMEA 2OR7A 4GG6B 3IU3B 3ATFA 3MRPB 4XPHL 3SDCC 3IWUA 5IMOB 4M9OA 4UV7L 5F1SA 5GGSA 3V5HB 2O5XH 4QRTB 5TK2A 4JE4B 4Z77A 1PD1A 4Y2DB 3HUJF 2B1OA 1ZRUA 5GSRA 5DEFA 3WTWA 1JPSL 2FWSA 2R29L 5FA4A 4CADB 3LXAA 5D2NE 5E1AB 4KDVA 3K2UH 4F33A 5A40E 3LN9A 4A55A 5IKCA 2HFEB 1QRKA 3U36B 4JFOA 4M6ML 2ISDA 1LEIB 3ZL4L 1XAKA 3Q2VA 4PRIE 5AOJA 3SBWA 3RX8A 4HDIA 4Y2DD 3UGUA 1JPTL 1CGVA 1ZE3H 2JXMB 3OQRA 5EU6A 4ZTEA 4D9RD 1WP6A 2ADFH 4CKQA 3I50H 1EH9A 3O6KH 3RGVA 1GS8A 3GRWH 2LLNA 3VRIA 4YK4C 5GRUL 3TT1L 3US9A 4BH7A 2YZ8A 2ORBL 5CR1A 3RNQB 4DGYH 1AANA 1H8NA 2PWFA 2CCLA 5ICZB 3BGAA 4NP4L 2BVUA 3QHFH 1Q9OA 1ZVYA 3L08A 4IOIA 3T8MA 3T0EC 1FO0B 4LLQA 4I87A 3MTRA 2GTWA 1H5BA 3MA9H 3M45A 4JGMA 4AJVA 4FCHA 3MUZ1 1XB8A 2YWYA 2GUOA 1SYSB 3FK3A 4J8QA 4OGAC 2A6IA 4C59B 4O2EA 1KT2B 5CUSH 5KBMA 3WJLA 4YDKL 3HI5L 1RUKL 4EDXA 3V0JA 2DM7A 2ICWJ 4ZFOA 3ZGHA 3BLKA 2W0PA 1CLOL 1WBYB 2I07B 2XN2A 2IBZY 4PW3A 4BWTA 4W9CC 2HVJA 4UQ2A 1QRNA 3AU1B 4XB3A 5FGSA 1C12B 4OIIH 3WNMA 4HK3N 5CWSB 5T3XH 2NNAA 3QUZB 2ROYA 1M7IB 2IH1B 4YPGA 3GHPA 3RU8L 1I1FA 4ZZKA 5I1IH 4AGQA 5EBLB 1PL3A 4FD0A 3DUHA 3H56A 1WD8A 2XC8A 2DM3A 3CVHH 3TWCL 5AW6B 1ROCA 1BBJB 3EFFA 1IB5A 3OTTA 2NY5H 5B1CA 4F2MB 5DVMA 1L4IA 5GGSY 3RB7A 2QV4A 2PCFA 1ETZA 1CGYA 4YDVB 5KYYA 4WWOA 4XO8A 1YPZB 3KYNB 2YUWA 4N22A 2A6KB 3TCLB 3BPLC 5DJ2B 2X4RB 2GKIA 2A1WH 2C3GA 1W9XA 1JFQH 3LNIA 4Y4HB 4AEIL 4OY9A 5I6PA 1LK3L 3FAWA 1I3GL 3GHBL 2XVKA 2DWTA 4HALA 2JB5L 3L4ZA 3IETB 2VDLB 1IIKA 4F91B 2EDWA 4ZW7A 5B1JC 5C9JA 1TF4A 1YNLL 4RAVB 1PG7L 5GS0D 1JYVA 2XWCA 2HTLC 3NQIA 3L4CA 4R7DA 3QI9C 2AERT 4LU5L 5F7YC 2P80A 1XZ0A 4DN4L 1ZVSB 3AAZB 1GC1L 2PW1B 3RWEA 2DMCA 3UC2A 2X1WL 3GTTA 5IHLB 2J5WA 4ODSL 4XMPL 3N43F 1HNGA 5HYSB 5CZVH 5D9SA 4BIKA 2YEZA 3MOBH 4OIBA 1BBDH 3LH8A 5JHBA 5JXEA 1KGYE 2BHFA 5GSVA 1JNHA 4ZAKA 3VDAA 1F0LA 1BOYA 4G6ML 1GGIL 4MAUH 3WS3B 1ZDQA 3CTTA 3JV6A 3TNNA 1A1OA 1BAWA 3N42F 1VJSA 4WW2C 5EN3A 1EFXB 5IQ7L 1QI4A 3UACA 4D8PA 2DZEA 2JJUA 2AJSH 2J6WA 4TTDD 1RJYB 5KTEL 1MXGA 2NY0B 5A2BA 4M1GH 1DJIA 1CU4H 1P7QA 3F7LA 1EO7A 4Y8AA 2RCSL 4ZMTA 1MHHA 2HP4A 3BE1L 1IARB 3IKKA 1QTSA 2MNUA 3QORA 1A3RH 2X7LB 1MFBH 1IBDA 3GDCA 4NHUB 4RBPK 4R5TA 3T0EE 5I1DA 2NY5C 1IGFL 4C58B 4FX5A 4K8RD 4LPVA 4AUUA 2BRRH 2MPVA 2R69A 2ZKMX 1KBGH 1Q9WA 3CFTA 2I85A 3GC3A 3GPEA 4WFHE 1BQLH 2PW2A 5C7XL 4JHUA 1K3ZA 3CSPA 2HLFC 3VSQA 4LAQL 4Z7NE 3KBPA 2VLKA 4CRPA 5IP4A 3QQ9C 2IDSA 1OAXH 4N0FA 2C4FU 2PTTB 3MLWL 4M62H 1KJ3H 4YDMA 3BISA 1H3XA 3WEOA 1JGEB 2AW2A 3IJ8A 4WWKA 1RUQH 4GNKB 5AENA 5TF0A 4Y16C 3TBVB 2IPUK 1F00I 2ID5A 4YX2L 3A47A 4KRPD 4S1QL 2EDLA 1LL1A 3PIQB 3ULVE 5IF0B 4TLSA 3ES6B 5C0GA 1YEEL 1A9BB 2F7PA 4J8RB 4R90L 2DBJA 4RDQG 4XBPB 2YA1A 5FDYA 2V6HA 1B6DA 2FR4A 2Z35B 1LNUB 4ACTA 3EH4B 1BVNT 4WTZG 2OTWA 3U4AA 4PY7B 5AL8A 4NM8L 3KYNA 4M1CC 1CFTA 2QSCL 3QIBC 4RX4A 1HS6A 1KULA 2VH5L 3DHMA 1DCEA 2NY2B 4I77H 1CPUA 4MA1C 3V0VB 1ES0A 4FNRA 4LASH 3VRJA 3CHXA 2EDYA 2P26A 3RAJH 1KZYA 4XP6H 4YK4B 3VGFA 4PREA 2JV6A 4GAYB 1AIFA 4RGNC 3QUXA 5DHVA 1DANU 4WTZA 1IBGH 5DZLA 3WLWC 1GMIA 4Z3HA 5I8KL 3W5MA 3IKCA 2IGFL 2X0UA 3RWHB 4NOFA 3RWGB 5EN2B