2PPCA

Oxidized wild type afnir exposed to no (nitrite bound)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
336
structure length
336
Chain Sequence
b'ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
molecule tags Oxidoreductase
source organism Alcaligenes faecalis
publication title Stable copper-nitrosyl formation by nitrite reductase in either oxidation state.
pubmed doi rcsb
total genus 90
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2007-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ppcA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ppcA02
1BYOA 2UXFA 5I6OA 4BK5C 5B1JC 3TU6A 2A3TA 3AZUA 3NJFA 4YSOA 2HRHA 2J57A 3NJHA 2BW5A 1PLCA 3ASOB 2HX9A 2JFCA 3GDCA 3NJMA 3CZUB 1L9PA 1KV7A 3SBQA 2J5WA 2P80D 2HX8A 3UADA 2UX7A 1GS7A 4DP0X 1JVLA 1KDJA 4HCFA 1AOZA 3IN2A 5PAZA 1RCYA 1FWXA 1A3ZA 1AS6A 5D4IA 2I85A 4A2GA 1GSKA 1AS7A 3HB3B 3CVCA 2ZWNA 4UF7C 4E9SA 1IKOP 7PCYA 3N55A 2ZONA 1E65A 4Q8BA 4DP1X 3S3DB 2OV0A 4F2EA 4JKNA 3T9WA 1A4CA 1GY1A 2PP7A 3ZX1A 2W88A 4KNUA 3EHBB 4AZUA 1CURA 3NSCA 2ZXWB 3OMAB 3QQXA 2PCFA 2FTAA 2Y69B 2AVFA 4E9YA 1L9OA 3EF4A 1M56B 1W8EA 2XXFA 1ETJA 3TA4D 2EIKB 3OMIB 2BW4A 1IBYA 1PZBA 2FQEA 5E9NA 1ASPA 1J5CA 3IBOA 3ZDWA 3AG1B 3OD3A 1PAZA 1I53A 2OJ1A 2FQGA 5EHFA 3NSFA 3FU7B 3EH3B 4CSZA 3D12B 2IDUA 2YAFA 2BWIA 2J55A 3DIVA 3OMNB 2YARA 1AZCA 1J9RA 1SNRA 2BP8A 1NWOA 4YSRA 3ZIYA 4YSUA 1JZGA 3ABMB 4UAHA 1GY2A 1PMYA 4FA7B 3QPKA 1ID2A 1AG0A 4GXFA 3MBWB 2Q5BA 2WSDA 1ILSA 2FT6A 5B1KA 5I5JA 3NJLA 3WNIA 4G70B 2AZAA 1NDTA 1F56A 2IDTA 3FQ1A 1BQ5A 4KO7A 3T6XA 1MDAA 4YL4A 2PPEA 2VM4A 2YXWA 5TK4A 4E9TA 2GHZA 2EIMB 3PPSA 4HHWA 4QLWA 5I6NA 1ADWA 4DP5X 3S8FB 4HCGA 1PZCA 5B7MA 4GP8B 4E9XA 1OCRB 3QJTB 3ERXA 3PAVA 1N70A 3PXLA 5PCYA 2WO3B 2OCCB 4AI7A 2DWSA 4GYBA 4N8UA 3DKHA 2IDQA 2FWLB 3FT0A 4E9VA 1OCZB 1J9TA 2XX0A 2QDWA 4QKTA 4TXVB 5B7FA 1ASOA 1CYWA 4G7RB 4YSCA 3TBBA 1AZBA 3WI9A 1RZPA 1IBZA 4K9JA 3QJQB 1TEFA 1AG6A 4A2EA 1NINA 3PAUA 1AR1B 3CG8A 1QNIA 1PLBA 4F7KA 1T5KA 4X4KA 4M4RB 5AKRA 1B3IA 2VM3A 3X1BA 2DWTA 1UATA 2VW4A 2XU9A 5B1AB 1AAJA 1PNCA 3OM3B 1BQRA 2EILB 3MX0B 2BHFA 2XXGA 3FPXA 4BWTA 1PZAA 3NSYA 1JZEA 4BXVA 4BWWA 1V10A 2HX7A 5I28A 1AZRA 4A66A 2PLTA 1A8ZA 2RACA 4Q89A 4A67A 2YAMA 2GC7C 2IAAC 1PLAA 2XV3A 2MTAA 4HAKA 1V55B 1WA1X 1XB3A 4F2FA 2VW6A 2FQDA 1JVOA 2PP8A 5I6PA 3S8GB 1HAUA 4KOBA 4YSDA 1R1CA 4YVUA 4GP5B 1M9WA 1JZHA 1CUOA 1DZ0A 1ET8A 1X9RA 2B3IA 3QJSB 1AZUA 3X1NA 3SBPA 1JOIA 1NWPA 2GBAA 1NPNA 2R7EB 3NJKA 3TBCA 1EZLA 4AX3A 1FFTB 2PPAA 1BXVA 4PCYA 1AQ8A 3H4FA 4KOCA 2H47C 2BP0A 2TSAA 4L0PB 3CVDA 1N68A 1SDDA 4BDVA 1OCCB 2P80A 2BZCA 2IWFA 1OV8A 1NIFA 2PPFA 3FU9A 6PCYA 3JT2A 4YSQA 2PP9A 1A4BA 1KCBA 1NPJA 4A2HA 4DP7X 1J9QA 3GYRA 1WS8A 3NJGA 2XV2A 3JTBA 3QJVB 3ASNB 5F7BA 4KNTA 3H56A 2YAPA 2NRDA 4JHVA 1JXFA 3SBRA 3EH4B 3SQRA 3V9CA 1SHWA 2E86A 1AZNA 1GS6X 3IN0A 3PLYA 1M57B 3PCYA 2J56A 4P5RA 2JKWA 3WNJA 2YAHA 4DP6X 3QJUB 2QT6A 5B3SB 3T6VA 4GY4A 3FS9A 4DPBX 1ZDSA 2FT7A 2BP8B 4E9QA 1TU2A 2W8CA 4MFHA 2XLLA 1JZIA 2XUWA 2PCYA 2TSBA 5I26A 2YAEA 3GXUB 4ZK8A 4AKQA 2FJSA 1KGYE 5A7EA 1JERA 3FSWA 3CDZA 2IH8A 5D4JA 1AANA 3X1GA 2VN3A 2I7SA 2VW7A 1PCSA 2HLEB 5ANHA 4DP4X 1L9TA 4UANA 4HIPA 2JXMA 1TEGA 2GSMB 3BQVA 4GP4B 4NAJA 5AZUA 1E67A 3WIAA 4KNSA 2CCWA 3FYEB 4M3HA 2XYBA 4P5SA 2DYRB 2FT8A 5FC9A 5I6KA 2UXVA 5B1BB 1L9QA 4A2DA 7PAZA 4AKOA 2FQFA 4NERA 1E30A 4FAAB 3AG3B 4DPAX 5B1JA 3UAAA 1BEXA 3FYIB 4HALA 5F7AA 3HEIB 1ET7A 5IY5B 1ET5A 1BAWA 4CSPA 3FSZA 1JZJA 2XX1A 4W1TA 5D4HA 1GW0A 4BWUA 1NIDA 2GC4C 1SJMA 1NIBA 1OE2A 2UXTA 3WKPA 2CALA 2ZOOA 3NP3A 3TASA 2LLNA 2XVBA 1BQKA 2UX6A 3AY2A 5B7EA 1MG2C 2XWZA 1XB6A 1ZDQA 8PAZA 1WA0X 9PCYA 1FA4A 1WS7A 2YQBA 2HZHA 1NTDA 2QPDB 3X1FA 4DP2X 1DYZA 2BO0A 4JHUA 1XMEB 2EINB 3KW7A 2GIMA 3FQ2A 4WKXA 2H3XC 4DPCX 2EIJB 3CVBA 2CUAA 1YLBB 3T6ZA 1ZPUA 1SFDA 4EF3A 3UABA 1OCOB 3V9EA 5I6MA 2QDVA 1URIA 1KDIA 1KBWA 4YVNA 3FPYA 3U25A 1BYPA 1QHQA 1KYAA 1AS8A 3IE9A 1SF5A 3ABGA 2H5UA 1A4AA 4E9WA 5I6LA 3FSVA 2IH9A 1JZFA 2X88A 5LDUA 2MRYA 1GYCA 2GI0A 4HZ1A 1ASQA 2VSMB 2VSKB 3ABKB 1OOWA 1BXUA 4N4YB 1PF3A 3AG2B 1VLXA 1KBVA 3T6WA 2PPCA 4KO9A 1GR7A 1SFHA 1V54B 3NT0A 1J9SA 4DP9X 5AFAA 3KW8A 3C75A 3AW5A 4WTQA 3X2QB 1EHKB 1IC0A 3T71A 1AIZA 2YAOA 5TK2A 2UXGA 1PY0A 2IDSA 1MG3C 3ABLB 1X9UA 1GS8A 3FU7A 3PAZA 1J5DA 1SHXA 3RYMA 3S3BB 6PAZA 2N0MA 3G5WA 1SF3A 1W6WA 3UAEA 1ZIBA 4E9RA 2DV6A 2WO2B 1NICA 2AZUA 1CC3A 2BWDA 2X87A 4PAZA 1HFUA 3WG7B 2IWEA 4BXSV 1E5YA 3ZBMA 1OE3A 2HRGA 2XV0A 3UACA 4ENZA 4YSTA 1CYXA 3N2JA 3NJIA 1IUZA 3NYKA 4KO5A 4AKPA 2YAQA 2YXVA 3BVDB 2CJ3A 4BDVB 1E5ZA 1A65A 2QPEB 1WAEA 4HCIA 1OE1A 1JXGA 4KO6A 1AACA 3OQRA 1QLEB 1MZYA 4G72B 5I5IA 2DYSB 1WA2X 1KCWA 1SDDB 1TKWA 1RZQA 3DTUB 3H4HA 1XB8A 4G7SB 2BP0B 1BXAA 1ILUA 5I5MA 1RKRA 2Q9OA 3IEAA 3L45A 2AANA 2R7EA 1NIAA 2CBPA 2Y1AA 4YSSA 4DP8X 1JXDA 2FNWA 2GB2A 2B08A 3NSDA 1ZIAA 2PPDA 1L9SA 1PNDA 4NB7A 3WKQA 2HXAA 4G71B 2BZ7A 3UGEA 3X1EA 1W6LA 3NJNA 2AFNA 2I7OA 1ZV2A 4W9ZA 4RH4A 2IWKA 3AG4B 3EH5B 2VMJA 3FU8A 4A2FA 4YSEA 4G7QB 3S3CB 3FQYA 2DY2A 3QJRB 4YSAA 1NIEA 4HHGA 1L9RA 1MZZA 3CDZB 3FSAA 3NJJA 3NP4A 4A68A 1HAWA 2CAKA 1NZRA 1OF0A 4YSPA 2IDFA
chains in the Genus database with same CATH superfamily
5ACZA 2CK2A 2ZWKA 4ERSH 4QY8A 2CGZA 3KYOA 1IT9H 2YMTA 5TDNA 4NDMA 1S7TA 4PJIE 5DQJA 2HJLB 3OKLA 4H1LG 3LD8B 4V1DB 4TL5A 3OR6A 1DVQA 3MA7A 2DQUH 5D72L 3UYPB 1XIWD 1CDUA 2BVOB 1BVZA 1KENH 3VCLB 3BH4A 4KH9A 1HK6A 4U4BA 4KRPD 3H7BB 3FCSB 3VDCA 2A74A 5D2LB 3FQRA 1CO1A 1GHFL 1NBYA 4CKVX 3I85A 2ZOWA 4X7DC 2YEZB 5H37A 4JQVA 4P2QB 5D5MA 3FB5A 1GTFA 2D3NA 5F89A 5CGYD 3WBDA 5JPMB 3FT3A 4ZFQA 3G5ZA 4YHMH 3ETSA 2ZCLL 5AAMC 3QAZB 7PCYA 1BREA 1UKQA 4XPTH 1KYFA 2P5WA 2XN9D 4JQIL 1KGXA 4GW5B 4Y19A 1KLUB 5FKAB 1ZGLB 4NQED 1DVTA 2LLLA 2QHRL 3CXFA 3ZX1A 3QUXC 4FXKA 4PW3A 4XBPA 4R8WH 2X44D 1MAMH 4X6DB 2X42A 5F1IB 4KKCC 4TLUA 4ZBJA 4L8BB 4C59B 2ZXWB 3H3PH 1TVDA 1ERNA 1N6UA 2YD5A 4KK9D 4M6NL 3WFCL 1NCCH 1R3KA 4AYFA 5JLZB 4PIRF 2ORBL 2V5TA 1IC7H 1P9MA 2NTFB 4MRCA 4PY8I 4ZS6D 1H3XA 3TJPA 4JR9L 2F1AA 5BZXA 2LQRA 3TCLB 4UDTB 1KN4H 4LAQL 2VQ1A 1F1GA 4J2XA 3FN9A 1YPZB 1C5CL 4ADIA 4I2XA 3JV5A 4Y2OB 2HVKA 2C3XA 1UACH 4X7TB 4OH2A 2ALAA 4LHUG 4J1UA 2HT4C 1NANH 4GUQA 3NCJL 5LGYA 5FYJL 5JHMA 5GRYA 1RFDL 4BFKA 1TJHL 1XCTA 4AUUA 3MNWB 3BKJH 3E1ZA 2P8PB 3FTSA 4NKOB 1T66D 2VDML 3WNLA 2AERT 3TV3H 3KBHE 5T1MB 4MD4A 1I7UB 2R56H 3H3KA 1P5VA 4LLWB 2HJLA 3OKLB 4YO0A 3VUAA 1UGNA 1JGUH 2EIDA 3L3OB 3T6XA 5I1DB 5L8LB 3VNYA 5IJVA 4BZ1H 4EDXB 3MLWL 4CL7A 5GS1A 4BUGA 3WDHA 4NO3A 2HVJA 4MJ5B 1JYXA 2Y6TE 2Z9TA 2J8UA 4JFYA 4MGXA 3VYNA 3LEXB 5I1LA 1DSWA 4YDNA 2F5BH 3HS0A 5FW6A 1TJHH 5IUSA 2Q86B 5B7MA 12E8L 1NEZG 3QJTB 1IGIH 3MRGB 2OCCB 1SBSL 3QA3A 1FYTD 4WJ5B 5BUGA 1P7KA 2IDQA 5I73B 1D5RA 2FWLB 5HHVL 3BKML 1Z66A 1YAZA 1J9TA 1FHNA 1S8DB 1UB6B 1HSAB 2NNXA 2Q76B 4MA8L 4NJ9H 4PBWD 4U0RC 4URTB 5AKTA 7FABH 1GW6A 1CT8A 2WUCL 3S5LG 3QUML 3GSVB 4YSCA 4U6XB 2Q3XA 5EC1B 3N44F 4IBLT 4ELKB 3REVB 3ZGHA 5AENA 4P2RA 2JB6B 4JFZH 4GKZA 4M4RB 5CN2A 5CO1A 3MRKA 4B3VA 3ZUNC 5C0JB 2AHIA 4ZZFA 5C7XH 3MX0B 2XPGA 4L8CB 4KMTH 3EFDL 4NNYB 1UXSB 4ZYKA 4IRZA 1LMIA 5LAXA 4X5XB 1MEXL 3CSTA 4ODXB 3QUMH 2HX7A 2YUXA 1YEHH 4MX7B 3CGTA 1Z9SA 4U2YA 4GKSA 3MRCB 5HI5C 3WY2A 5KVEH 1I8IA 1YPZA 4JKMA 4F2MB 2G30A 3RG1C 4LNRA 2VW6A 2NPLX 3VXNA 4ZFZA 4KHXL 2Y2WA 4W4OC 3QVAA 3GMOA 2EUWA 2C3VB 4NQDA 2I69A 5HBBA 3BW9A 3NCBB 3B9KB 4PJEA 1R5WA 3OKNB 4JRYA 2VRKA 3ZW3A 4M8QB 4Q97A 2XNAA 4XC3L 5I66A 1EA9C 1NPNA 3F2LA 3GEFA 2KBGA 1ID5I 1LO3H 3DTXA 5E2TH 4OZ4A 5TQ2H 3VFRA 1LNUB 1UFUA 3JV4B 3Q8FA 4PCYA 3P11L 2B59B 1UD3A 1YPZE 2XN1A 3IDJB 4WW2B 3SZKC 2XG5B 4LRIA 5IQ9B 4NNXA 2OL3B 1WAAA 2BZCA 1KYDA 2ZD0A 4QRFA 3BP6A 1BFOB 2C9AA 3I2CH 2ZWZA 2NW3B 4B0MB 5I15L 1X44A 4FNQA 2P5WB 3HC3H 1C08B 2IJ0C 1NGWA 1SGKA 4WKZB 3VQ2C 2DL2A 1WS8A 4M02A 3UBXB 2WXLA 5E4IA 3HNVH 1JFQL 1T3FA 2X3BA 3MCYA 3FH5A 5E2TL 2YAPA 4MAUH 5JPMA 3H54A 3HAEG 1GHFH 4HWEH 3RDTA 5F6IB 4NGHH 4MAZA 1BOYA 1T1ZB 2QGCA 1S9WA 1AZNA 5HDBF 1MPAH 3WFHA 3Q01A 5BUAA 3W5NA 1M57B 1YDPA 1MIMH 3Q2CA 4IMLA 4HLEA 4KZDL 1CLYL 2YAHA 4LVHC 2CR0A 1F97A 1QBAA 1AXSB 3NFNA 3FHEA 2X9ZA 1QTPA 3MRPB 1MAML 1JZIA 2VDLH 3V7MA 3NABL 1ZVSA 1JGDA 2PCYA 5IW6B 1RURH 4Y2OA 1FVDB 4AJVA 4N2IA 3OC5A 1M2OA 4RCAA 3EXJA 1KGYE 4KJWC 1T04B 1HJCA 4YPJA 4Z7QE 2WVVA 2CO6A 5KSAC 3SE6A 2VW7A 4BH7B 2YPVH 4R5VA 5E8NA 3R4DA 2AJYL 4F8PA 1OLZA 1FJ1A 1EXUA 3MREA 3ZYJA 1AGFB 4HH8A 5E8PA 5E7BA 3KR3L 5AW6B 5C92A 1UACL 5GZOC 2GSMB 4RRPA 1XHHA 4A7TA 3UBGA 1KSRA 4BBWA 4TQIA 3GJFK 1E67A 1C9SA 3BVUA 1KXQA 4RX4A 5D7IA 3O3BB 4M3HA 1AE6L 1WFMA 5D1XC 2IGFH 2XZQH 4ACTA 1BDYA 4N2OA 1E9QA 1D2OA 1UURA 5BRZA 4H8HA 2LU3A 3VGBA 2DKUA 2JI3A 4M1DL 5FUCC 4FAAB 3DO7A 3CPLB 4XVJH 1ET5A 4H5SA 3VD3A 1BGXH 1G7PB 4RMVA 3FSZA 2HT4D 5HYSG 2WC7A 3BVTA 3KCPB 3D48R 5D70L 1OAQH 1UQSB 3I6LD 4G3YL 5D6CB 4FA6A 3LXCA 1C7SA 4NN5B 4PWFA 4OF8A 4Z7QF 4YC2C 3VFMA 5DMKA 4TSAH 1BEYL 4RZCB 5CD5C 1SRDA 2VDQB 1L6XA 3GXFA 4APQB 4TQ8A 3T04D 2F58H 5EU3B 3PF2A 4Z7WE 1SHSA 2NR6A 3ARXA 1I8LA 1AGEB 3PL6A 5CSZA 5T3ZD 2HZHA 1XO8A 4G42A 3O3DA 2HFGL 1HL9A 5C09D 3GXDA 5JW5A 1QSFE 1L6ZA 3SKJH 1NSNL 5AW2B 4QRSA 3K5SA 2ESVD 3SYPA 2NX5E 1YY8B 4EUPG 4IRSA 3SDYH 3TCXA 2HN7A 3COOA 4CVXA 5FWQA 5F6HI 2EVGA 4Z7VB 4WV1C 3S7GA 4NN7C 2VISA 2HFFA 4BFJA 2NLJB 4Z76A 2OXGA 4ODSH 1X5XA 3LEYH 4DHLA 1EDQA 1U8CA 1QPXA 3A6CH 1NDGA 3GBNH 4MA3A 1AD0A 1LO5A 4I9WE 2Q7YB 4E0RA 1JPGB 1OM3L 4D0CB 1TJGL 3OPUA 3D9AL 5DLML 3K4DA 5LNDA 2Z64C 3UOAB 5B38G 4E5XA 4KGJA 1P7QD 5I6LA 3FSVA 4XNMA 2JXMB 1D6VH 1C7TA 1LP9B 3UO8B 3WAKA 4JFZL 3L1GA 4HJEA 3GUTA 2VSKB 3NPSC 3DVFA 1CQYA 2W59A 2A5UA 1IGJA 2B9BA 2IOMA 2IXQA 1XGQB 1IM9B 4JZOA 1PLGL 5DZJA 3WN5A 3WHE0 3AABA 3QIUA 2R8SH 1F4YH 1R5VA 3ZMNA 2BSTA 2E3VA 2PN5A 5BRQA 1LO4L 2VMDA 2VLJA 3PWUB 4GO9A 4UM9A 5EU6A 3ULVC 1MY7A 2GSGB 3RVUC 3FBKA 3D50A 4PLOB 1S7WB 4Y9FA 5CINH 5DJXA 4OKVB 1U8IB 2WLIB 4GKNB 3ROLA 1AI1L 1VF5C 4FRWA 4Y16B 3ZE0B 1LJMA 5EO0B 2VLRA 4HJUA 2X87A 5C0DA 4Z5RB 3GI9H 1HZKA 2BIPA 3G6AA 3SPIA 3UDWA 2GT9A 2VLJE 5EU6E 2VZOA 2XRAH 4HF5L 2HKFL 2HRGA 5FYKE 3U30B 4O4YH 2V3DA 3U4KA 4K5LA 2FL5B 1A5FH 5K59F 4XO5A 3QUZD 3MLVL 4PV9B 4P3DB 4FI7A 2R69H 3RAJH 2WXKA 3JBG7 1P4LA 1WAAF 3FUHA 4G80B 3GMLB 3LKRA 1IGYA 2X40A 1SM3H 4M8RA 1ZVYA 1UCTA 1ZJBA 4HCIA 2NY6D 1TZ8A 1SQMA 1WYJA 3S36X 4FQXC 3GZOA 3AC0A 4YBQC 3IFOA 1SDDB 4A7GF 2M83A 3H4HA 1H5BC 5HHQA 2DQMA 2F19L 3OXSB 1ZT1B 3BP4A 3QUYB 3FF8A 1U3HD 4XPBH 1BD2B 2HSIA 2ED9A 1COBA 3GRWA 5E4EB 1K3ZA 1NIAA 4JGNA 2LFGA 1Z3GH 4GSRA 1N12A 4PRDA 3A22A 4B3EA 5J1TC 4GEJA 4J3BA 4NRZB 1QTSA 4GSDL 1IM3D 3GMMA 2KMWA 3SDXA 4H25B 1USQA 3PNRB 4XTRC 4NBYB 3CX2A 3KWWA 4X99B 4RA3A 1F6FB 1A21A 4P4KC 4GSUA 1CICC 1XZ0B 4UT9A 4BGDA 2A4EA 4UYQA 1FBIL 3MLYH 3DECA 3D0VB 3D85A 4OJYA 1A6TB 4XPAL 1OHQA 4HHGA 5BZZA 1ZLDA 3QZPA 3FSAA 5LCVH 12E8H 2H9GB 5E9DB 2CAKA 1NZRA 1URLA 4LNVA 1OF0A 4G8IA 2ZX6A 1DQQB 3BSGA 3BMVA 3L3IA 4L5FH 5E51A 4OZIE 4BK5C 2OX5A 5SWZA 3VFVB 4IU3A 3TU6A 1A6WL 1WWWX 2A3TA 5SWZB 3MJ7B 3MLWH 1T5WA 2ENPA 1J11A 2V9RA 2OS7A 5DHXB 3WFEL 2DEXX 4PJCF 1L9PA 5DHVB 1B6UA 1U8NA 4MQTB 4EI5D 4P23B 3DC0A 4M7JL 2CSPA 5JIDA 5D2LF 4G80A 2I26N 3VRIA 4LESA 4X5WA 3WMQA 1HNGA 2ZF8A 4ZS7H 4YUEH 1J18A 2VLKD 1KGCD 5HJ3B 5K33A 4A2GA 1AS7A 2CPUA 4E9SA 4EQ2A 3QUYD 4UM8A 4UAOB 3L95B 1XAUA 4MLSA 3KGSA 3NFSH 2LU4A 3BMWA 3N3EA 2WXJA 4XXWC 1HJBC 3ZMRA 4R2GB 3O9WB 4N85A 2Q2EB 2FB4H 4XNDA 1SUHA 3QEQD 2V7HA 4WU7B 1FZOA 1QFWM 4XAWH 1G9NL 5K5YA 1D5XB 4HWZB 1CMOA 4AEHL 3KPSB 3HG1A 1BLNB 2VQ1B 4AE1A 4GXUM 1QLFA 3WIFA 1E9PB 1X5HA 4ONFH 5ETUB 1SY6A 3G5VB 2M2DA 4MMXA 4C83A 1EMTH 4KI5E 1JG9A 3W81A 4N6RB 1DVZA 2X4QB 4NWTH 5HGBA 1CD1A 2Q0ZX 3UG3A 3HE7C 1AOHA 2CMRL 3EJJX 4X6BA 3V0DA 1MCHA 5T1KB 3FQ4A 3QZWA 3A67H 4CDHA 1IQDA 4N0RA 3HA0A 2COQA 2CIIB 3BCFA 3ARBA 2O93L 3S5LB 1NWOA 5ERWA 1AQMA 4I88A 4EKXA 1S7XB 5BOPA 3QPKA 1AG0A 2BS8A 4LLVB 4UV7L 3U9PL 3UTSB 1X5LA 4FMKA 2N59A 1O5PA 1F8TH 1KGIA 4N2BA 4Z77A 1Q94A 4ANWA 2HFFB 5INCB 2X2UA 1IARB 2NY5H 1M53A 4ZX3A 2I32A 2WLLB 4PRIB 4UTBH 3BZEB 3F7YB 4MS6A 4KKCD 3WNOA 1RL1A 4HHWA 3RVWC 3B6SA 4JO5A 3HIZA 1RK1A 3S8FB 3FQRB 4HCGA 5E03A 4Z7UB 1CTNA 2F0CA 4NUJA 4APXB 4AZ8B 3A4DA 1EHAA 4YS4A 1JXKA 2R4SH 4NZUL 2GW5A 3U0TB 1C5CH 2WN2A 1BHGA 3QDMA 5L88L 4HLZG 3PDOA 2IXQB 2R0WL 2Z1KA 1CGXA 5EOCL 3LHPL 4I48B 3UZVB 4LHQB 2CO7A 1PZ5A 3ZE1E 1GZPA 1FORH 3GTNA 1LXMA 4I77L 2Q87A 1FNEA 1WK0A 4JK0D 1LQSR 4C58B 4RWYH 3SKOB 2J21A 2D7TL 2R0ZL 2IC2A 3Q6GH 1JZ4A 3MOAL 3ZE1B 1UG9A 4LZKA 1I75A 1S9KC 3L4TA 2HH0L 4F7EA 4F7MB 3T1FB 5HPMA 4X9GA 3MV9E 3S97C 1OP5K 1JBJA 3WUWG 1GPOH 3FPXA 5FF6B 2E75C 2WCPA 5IOPA 4UU9B 2PYEE 3G6DL 3L4YA 2BVYA 3QDJE 4ZUSB 4KVPA 1ZPLA 3Q6FB 1QYGL 2J4WH 2X1OA 5I28A 1NGXA 2AQTA 3FUIA 3WTWA 5DO2C 5J3HC 1OPGL 4APQD 4EUPH 5IMMA 2VIRA 1CFMA 4A67A 4GS7C 5D7IB 2J5LC 3SGJC 3O4OB 4KTEL 3IKKA 3BGAA 1NGZB 4L1BA 4MBRA 4ZNEE 4MYPA 1NMCB 4R5XA 1PZSA 3JWOH 4FOMA 1DQDL 2J20A 2FL5A 2YJQA 3GNMH 1FZMB 1FO0L 5KS9E 4UYPA 5EOQH 3GB7B 3HE7B 1UH3A 4HHAB 3SDDC 5EN2B 3OB8A 1VFBB 2FYYB 3V4UH 5J12B 1ADQH 2GBAA 4WFEE 3CFCH 5IGXL 2AEPH 2DBLH 3WEXA 2R2EB 2KQMA 2EACA 5IFAH 4M29A 3NCEB 4KVNL 4WY7H 4F91B 3BAYA 3TJEL 2PR4H 3L7EA 2GCYB 4OVVA 1NIFA 3X3GL 1A6AA 1S7VB 4MVBD 2PPFA 2ROYA 3PGDB 5GGRY 4WEUD 3BAJA 1OW0C 5JR1L 3RWCA 4D0DB 5F1OB 2X5PA 4AYBA 4P0DA 5JOEA 1A7OL 3IMUA 4W9JC 4XP1L 2FUTA 3EGXB 2GBVA 4OM1H 1SN0A 3H56A 2W91A 3BVNB 2ENSA 2K7QA 2X6CA 3RVVC 5LQBH 4BELD 1HEJC 3EOAA 4MDIB 2IPTH 5HD8D 1K2DA 1V7NL 4LIQH 3LN5B 4LB8A 4IKIA 4FXLA 2HT2C 4X6CF 4L2LA 4GMSH 1E5BA 1JUFA 4GRLC 2XA3A 2B16A 1X4XA 1CGUA 2Y0SA 3MLZH 5DR5H 1AD0B 1LO5B 5LDSA 3JWDH 3O0LA 2RR3A 4MVBC 4PS4L 5F96H 3VRLE 5EIIB 1KPUA 3G5XB 3OHXB 4LDOB 3RUGF 2J8OA 4PLKD 4DVRH 4LSSL 5MEOB 1HQRA 4FD0A 1RULH 3ZDYB 3ZY7A 5HYJA 4FQ1L 1PLGH 5MHSE 3ARFB 3P77A 3X1GA 5IB4A 1S9XA 4FNTA 4KKRA 3MV8D 1HHHA 2JJWA 3QRFM 1LEGB 2BM3A 5J4MA 5B8CA 5LKNA 1UXMA 2HLEB 4YXHH 4AYDC 1FQ9C 3BVVA 1WJ3A 2OSWA 1KJ2A 3HMXA 2QQLL 4Y19D 3K80A 2C3VA 4NQDB 3WNNA 3VWJD 1CXIA 4FHBD 1UFGA 3V0VA 3O2VL 3NGBB 4HKXA 2ZPKH 5CEYB 4ATWA 4NAJA 2KL6A 3OV6A 5EU7E 3APMA 2EDLA 2YD1A 4Y9BA 5HYIA 3KYNB 3LPFA 1EWHA 4G82A 4YK4C 1W0WA 3G6JF 3PE9A 4L0ZA 3N6YA 3W9DA 2Z7UA 5E8DH 1NAMH 3L4XA 4Q6IC 5I6KA 2XT1B 1NFDF 2FQFA 4CGUB 1OHZA 4JBSA 1OW0A 3MBXL 4KDTC 1E30A 2KT6A 2YUVA 2ARWA 1C5BH 5DZPA 3UXFA 3SYOA 3BUTA 2KZKA 4I0PB 3LSOB 5IB2A 4E42B 3ILEA 3QAQA 1CTOA 5KSAB 3HC4L 5T1LD 2GC4C 3T0EA 2DS4A 2F1BA 3WUWB 2ZOOA 4ZFGH 2O5YH 3TASA 4U4IA 5GZNC 2CQVA 2DJ4A 1UASA 3N43B 3VFSB 3K4AA 5HGDB 4BINA 4OF5A 2JCCF 2BVPA 1DEDA 3CVHA 3DX0A 3W1ZA 3ZJAA 2YQBA 3QA3B 5HSFA 3ZE2B 1LQBC 5FCUL 4OCXL 2EH7L 2Y6SC 4YLBA 4U2ZA 1WV7T 1QG3A 4FP8H 4K5NA 4CC4A 5C70A 3EOBB 1B4TA 2VE6A 5HDBB 2XWJA 1SFDA 5CJOL 1VERA 3WEAA 2VITA 3RI5F 4ESKA 4N9GA 2ICEC 2WKOF 5HDQH 3HPLB 5E1AA 3V9EA 3SBWC 5C6TL 3GMMB 3MX0A 2Z93B 3MGTB 3MRFB 1XF1A 2P44B 1MN4A 4NQEB 3ABGA 4AQ1B 4HCRH 3VU1A 5I17A 1RV6X 3MRNA 3VFWA 4OGXH 2YGPA 4FEIA 3ET9F 2GI0A 3BZDA 1V7ML 3AADB 2YMOA 4ORZC 5JPNB 5SWSB 1CE1H 2GUOA 2DQFA 2VN5A 3MQIA 4L8SB 4OLZL 1G0YR 4JJHA 3L13A 5BV7H 3DO7B 4QYOB 4FNSA 5AOZA 5DJ0A 3Q9PA 4P46D 2AKRB 4NYLB 4I87A 1GYVA 5EU5B 2VN6A 5HI3C 3KW8A 3C75A 1MFBH 4BZ2A 5DTFB 4XVOA 1OOAA 2H26A 5ENWB 5AW1B 3H9ZA 2LR4A 4JDZB 5CGMA 3PAZA 4PEEA 3FU6A 2OQJB 3RY5A 5JHLH 3G04B 3KAAA 4I0PA 3NIGB 2N0MA 1TTAA 4PJAE 4JFFA 4Q2ZB 2E9BA 1SF3A 1U8PB 2ZJSH 4ONGH 5FO8B 3VXSB 5KBDA 2ICCA 3WXWL 2Q3ZA 2BWDA 4FLHA 2R0KL 2WUCH 2NOYA 4IOFD 4L4VE 1CR9H 1F6LL 2XQYK 3LNEA 4YGVA 5TFSL 5D7EA 4KKQA 4WUUE 1AD9A 1OTUC 3VXNB 1S7SA 2BSRA 4X7TA 1TSRA 3TZVB 1I8MB 4JFSA 3U79A 1F4WL 3TJEH 1CFVL 4ISVA 3OAZH 3QP3A 2VO8A 2CJ3A 5D7KE 3MV9D 3K8LA 3CE1A 4FNLH 3BRFA 3UBHA 2X28A 3WEOA 3TX4A 3TO4D 3WS3A 1TKWA 1Z0MA 2DQEH 4DNLA 5L2KA 3LH2H 2IV8A 1OAUH 1C1EH 2G3XA 3EADA 3Q2WA 4MMZB 5DO8A 5FO9B 1WFNA 5IOKA 2R8SL 1U93B 3NK3A 4I5BB 2A0LC 4ICXA 5LG6A 4KKLC 3TF4A 4E5XB 4Z23A 3QXUA 4L05A 3OAUH 5D7LB 1GIGH 3QDAA 4U6XA 4PJGA 2ODIA 5GSVA 3UBXA 3SKMB 4ZMLA 1PL3A 3HI6H 5EF1A 1Q4NX 1PD6A 1HXYA 4I18C 4ZPTA 1G6VK 1G9MC 3UJTL 1OIOA 2CIIA 2TAAA 2C9RA 2F7PA 3HZYB 2QQLH 3LKPB 4KWUA 3TEWA 1NAMB 3NJNA 5C0CB 3EZ8A 3RL1B 2VDKB 2EVIA 4RH4A 2VIRB 5CCKL 2KZBA 2VZSA 3ULSB 3V5DA 1JYNA 4NAMA 3C60C 3V0AC 1AY1H 2I60H 3WFCH 2WLZA 2X38A 1DJYA 3NRPA 5LJYH 1ZT4B 2MKWA 3X12B 2IADA 4GI8A 3GRWL 1MZZA 1EGJL 3M86A 2HVJB 2L4OA 1H5BB 1FYHB 5J06A 4DKFH 5FW7A 2Y3NA 1F3DJ 3BN9D 5K39A 2NSXA 1ROWA 3SGKA 4FFYL 4FKEA 3MACL 2ZXEB 5DEGB 4D9LL 3LXAA 4KQ4L 4QXVA 3R06B 4JFPA 3MHZA 5K9KA 3H9SB 1RK7A 2HRHA 3BQUD 4PJ5E 5F7EH 5I1JL 2CLVB 4WNQA 1PLCA 3FUJA 3HPJA 3PHQB 4YEEA 5E0QA 5F9JA 2HAZA 4XXDB 1RI8A 3ARGB 1UQSA 25C8H 2HX8A 2HVKB 5DZNA 5HI4C 1JF1B 2R83A 2ZUVA 1A3ZA 5GIRB 5L2KD 1AO7E 2NY4D 2FO4A 1VEPA 3SPVB 4RA0C 2N3JA 3CSBA 4R4BA 4PJBE 3UTSD 2E7LA 2RD0A 4EO5A 3KJ6L 4XPAH 1QW8A 1L0QA 3TVMB 2C4FT 3MRIB 1ZCRA 3PJNA 1P4UA 2B77A 1KIPA 4JFQB 2O5YL 4JMXA 3UTTE 3APCA 2A2QT 2YA0A 4PBVC 2VERN 2CJUL 1Q0XL 1QSFD 3JWOL 4FXKB 5F0LB 1TXKA 1A47A 1A9BB 2R29H 4F7MA 3O6FD 1A4KB 4PJGB 5HDOA 2Y69B 3L8QA 3M8OL 4OR1A 3KWXA 1WBYB 4YDJA 2MCG1 1KELL 2DW5A 1EV2E 5HYSA 3EGSB 2G4EA 1S3KL 2BSCA 2J3SA 2UY6A 5E95B 3TL5A 5IB3B 1U3ZA 1BP3B 5EEVA 1YC7A 2EUXA 3JWNC 1XZ0A 1KY6A 3AACA 5KYUA 3T3ME 5DJXB 3UBFA 2V2WA 1EZVY 5CD5D 4G8EB 4XMLL 1PDKB 1S9VB 3LRSA 1GGIH 4OZGA 3DV6A 1RIHH 1PX3A 2ZKYA 4GB9A 3C5SB 3I3DA 2X1WL 4J3OC 5DWUL 1IBDA 1ZWIB 3R1GH 2A83A 1JZGA 5H2BA 3KPSA 3RA7L 5BRZE 3GSQB 2GI7A 1RUMH 1Z5HA 1S5IH 1G7HA 2C9QA 1XSJA 5C2BH 2VDKH 5SV4A 5FKPA 1CBVL 3F6JA 3G3LA 2FT6A 2DPKA 1X5IA 4LLQA 4ANKA 4G7YL 1CDHA 3LRSB 1RMFL 4OZGB 2IDTA 4HBCH 4E36A 3KPLA 1AFVL 2PF6A 1E27A 2IAMB 4HMEA 2ADIB 1N26A 1NOFA 3QQ4A 4PRHD 5HHQB 1P69B 5DMGC 1IEAB 2R9HC 4UM8B 1FVCA 1ZT7B 3QCVL 5I1HH 4RFEB 3VXTB 1G9EA 2ZX9A 4FCAA 4PSPA 1JGEB 3SDDD 3SKJL 1KCSH 1YMMB 4YHKL 1BVKA 1J1XL 4XP1H 4Q56A 4QYAA 3TP4A 4OZFG 4XI5C 5T5FL 1E8XA 4WU5A 4DQOH 3QZLA 4U6HB 4N0UB 1E90A 4XAKE 3GT6A 2FJGB 2H32A 3EJTA 2XWEA 3HAEH 3QZNA 3QUYC 1T0NA 1B4JL 4ATTA 3ARFC 3CLEL 3ME0A 5EU5A 4N2GA 3DSFH 3G5VA 4UNIA 5J12C 1KCKA 1JNHB 5EEYA 3ZDYF 3IMBA 1E9PA 5ISZA 1PLBA 3WS6A 3CZJA 2AJUH 4QXTB 3GXMA 5DMJB 2NY2B 2KZ1B 4HV8A 4PRNA 1FCCA 1X5JA 4MLIA 2VW4A 1N64H 1OKEA 1U8OB 4ZG1A 5JW4M 1ZVNA 5I15H 3BWZA 4Q9RH 3DSNA 2WZAA 3QJHA 4QRAA 5FA3A 1HKFA 3MLTB 15C8L 1H6TA 1O9WA 4HUVA 4M6OH 2JKXA 4GUPA 4MX7A 2BNQD 3LYRA 4OFDA 4IRSC 3R7QA 3M45A 3BAWA 5CEZD 2XTJC 3EYUL 2XN9E 3NEEA 2RBLA 4U6YA 5GRUL 4K3JH 4HAKA 3QDGA 2ILLA 3QNXA 1NMBH 2FQDA 3BGFC 4QTIL 5KZCD 1HESA 4LSPL 1OAUL 2O6CA 3ARDA 2Z0UA 4K23H 4I77H 5FDYA 2B3IA 3D85D 5ISZB 2AS5M 4NNPL 4QRBA 5BQDA 3ZQXA 1MHCA 4YHZL 3BC9A 2VDOL 4M7LH 5E6ID 3PP3K 2DN7A 3FQNB 3BKCH 3UYRL 1CT8B 6FABH 3TH3T 4NT6B 2YKLH 3D3VB 4UTCA 4JFHD 2A38A 2PNDA 1SDDA 1L9NA 3P3RA 3MPCA 2Y1YA 2OK0L 4OLWH 5CUSL 3WKML 3HKFA 2DEWX 1YMMA 5DD6A 5IHWA 1HI6A 4P07A 5EFIB 3MXVH 4P2OB 5AVXB 4GRMB 5F88A 3GHBH 4UQ2A 1V3MA 4ES8A 5KJ7E 4JKKA 3PGCA 4NO3B 3O6LL 3UERA 4BFBD 2H2SC 5GJSH 4X99A 3ARDB 4CMHB 2OMNA 2X2IA 3FFCD 1RUKL 4IW4C 4LKCA 4R97B 4MHHG 5TF1H 5I2IB 1I7TB 3WJLC 5FB8A 3MDJA 2AEPL 2DBLL 2Y24A 2ZUTA 4TNGA 4X9YA 3MJ9A 1OT4A 4U6TA 4KQ0A 1IGTB 2LAGB 2P48B 4L5FL 4HWBH 4WEEA 2AQNA 2YLKA 2YAEA 4GI9A 5DDHA 1I85C 1MHHB 3KR3H 3MBEB 1LEKA 3CDZA 4WHDA 1LK2B 2HJFA 2WO4A 5FFGA 5E00B 4XGZA 4EZMA 2LOEA 4FQXA 1UT9A 4OLYL 4MCYB 1IM9A 4JZOB 4N6QA 5DS8A 2NSMA 2CPCA 3A4FA 4PJFA 5I71B 4OZIB 3ZL1A 4Z8FH 1SN2A 1A2YB 4G6KH 1S7QB 5IUCA 3V6OE 2ZXQA 4YHLH 3QFJB 4AVJA 3UG5A 2JJVA 1N59A 2GTQA 3B1TA 2YD6A 3SCMB 3W11D 4AUJA 2QKIA 4NP4H 3TVMA 1BVKB 1O7SA 2FT8A 3QRGH 3G6JE 5EOCJ 1ZLVH 4F92B 5MEQA 2OXGB 1YECL 7PAZA 4TUKL 4HCRA 4EE2A 4OW6A 1DANT 2D9QB 3QFJE 3SO5A 2ICEB 5B1JA 3BSZL 4MQ7B 3EO1B 5F7AA 1ET7A 2H45A 1ZEAH 4GKSB 4XPFL 1UD8A 4ZI8A 3QDGE 4XMKH 1G6RL 5GISL 1F5WA 4LPXA 1BXXA 3U1QA 1M7IB 3SQOH 2R0KH 1MJ8L 2ZSWA 1LO4H 3QG7L 2CKNA 1ZHKA 2XVBA 3GC3A 1CICD 3WNPA 4AVIA 4XN5A 4XNYH 2YFNA 3O8XD 1BQHG 5B7EA 5L2KE 1N4XH 2BIOA 1SYSB 3UPRB 1KOAA 4LKCB 1IVLA 5I5RA 4QY8B 2KDGA 2JTYA 1NUGA 3BT2L 3N0AA 4K94C 2QFRA 4N9GB 3E0GA 3DX6A 3AY4C 3ARUA 1HL8A 3DUSB 5DRNA 3GLAA 3RWEB 3RDTD 5E8DL 3BXNB 3E2HB 2H3NA 1KMGA 4R90H 1WT5A 4FS0A 4DT2A 4HJJH 3SOTA 3PWVA 3IVKB 5K9QI 2YD3A 3J07A 4KUZL 4KX7A 3D87B 2H3KA 4U3SA 5CEZL 1MREH 3I6KA 4CMMB 5F3HB 2HWZH 4P5KA 1IE5A 1TEYA 5HHMB 1KDIA 1NFDA 1NKRA 4UAOC 4GG6A 3QB7C 1LD9A 4LSSH 4ZO7A 5ILTL 5IB1B 1KYAA 4P4RA 2UZYA 4XZ4A 5DC9B 4NPKA 1EJ6A 4NM8H 3HJEA 2YC1B 1GGBL 1LP9F 5JHBA 2Z0BA 1G9NC 4P06A 3MLVH 4RBPK 5ANME 2YEQA 2OMZA 5JA9A 1ASQA 3LXBA 5BO0D 1K6QL 3V4PH 3PWJA 3IPBA 3C8KB 1XGPB 1FJ1B 4JHBA 3CQFA 4M3KB 1RUAH 5GPRA 1GR7A 2JCCA 1W15A 3X14B 2JE8A 4DP9X 2WXHA 5AFAA 2DL9A 3BCDA 1RIUL 1DJSA 1JN6B 3VWJC 3NABH 5DGQA 2BNRD 4ODXA 1OT2A 3UTZB 2BCKA 4QGTA 3X13B 2DDQL 4P3CH 3U7AA 4F7TB 1T7ZA 1R33A 3ISRA 1KJVA 1MFAH 2VR3A 4K7PX 2XPGB 2NQCA 4ODHH 4KV5F 4Z78A 3TYGL 1YZZA 3PWPE 2H6PA 1CVSC 4J6RH 4NC2B 1XX9C 4X5RA 5E5MA 2CXGA 2ZICA 4L1LA 2H1PL 2IFFH 3II2A 3LQMA 3GSVA 1AGDB 1IEHA 2VWEE 4PG9A 3VM5A 2AXHA 5IR1B 3JV0A 5MP6H 1NCGA 3B56A 4DN4H 3US1A 4N2KA 4FMFA 3G04A 4J3OF 2ADGA 3MRQB 3EH2A 4XPGH 3WKMH 3CFQA 2ISDA 1RU9H 3TESA 2EDHA 1N0XL 3WTYA 2PW1A 4OD1H 4I2XE 1YNTB 3FRPB 4ZMZA 5IQ9A 4L8SA 5FLUA 5JIHA 3QXAA 4F7PA 3ZHDA 3HS8A 2EIBA 2PCPA 1U95B 2E7HA 2V5RA 3SYCA 5GQBA 4RVBA 1FFOA 1ZIAA 4HUUB 4OV6F 1J5OL 1I1AC 2IQAB 1Z2KA 1YA5A 5DVLA 1Z9OA 2BLFA 5HDWA 2DBJA 3LKNA 1BQHB 3T0EC 5DS1A 2AFNA 1I9IL 3K81A 2IPTL 4MQXC 1D5BB 2K45A 3PFQA 5KYUB 1MCKA 4JY4A 4H1LH 2RHEA 1RZGB 3D2UB 2LVCA 4RGNE 1ZTXL 4EIBA 3TWCH 4HOWA 3MJGX 4GW1B 3QJXA 4QHMB 4ZODA 3OGCB 1R24A 5CEXA 2F7OA 1MWAB 2ZYIA 3MJ6A 4G1MB 4RGOH 1MI5A 4M1CC 3PNWA 3Q9QA 1D5MA 3ULVF 4M7JH 3W9EA 2P24B 2C7UA 5EBMB 3ARVA 3KGUA 3B8YA 2EADA 3ZTCC 1MCWW 2FCBA 1Z5LB 2B5IB 4MJIE 3R8BB 3UTOA 4KI5F 2YMXL 1JWUB 2J7LA 3W3BA 2GIYA 2WYZA 4NZJA 4ABUA 5TQ2L 3TCTA 3ULUD 2AMUA 5TPWL 5IMMB 5I66B 1TJMA 3O9WD 2F68X 4R90L 5A2FA 4K3EL 1T20A 4GMTL 5JHDD 4GRWE 2H8PB 4YHKH 1NC4D 2RB8A 1S2EA 2JKIS 3GMOB 1KFAL 2ENQA 4CMMA 2XWXA 4CVWA 4U3SB 5IEKB 3KD4A 4RAVA 3ZTEA 3MRGA 4LL9A 3HVDA 4XO4A 2VAAB 4G7VH 2EC8A 5DD0H 2G2RA 3N41F 3N40P 3UTTB 1G7IA 1I1FA 3MUY1 4ENEC 1WF5A 2Z31D 1EIBA 4JPWH 5FA4A 3U30C 3S5YA 1S5HA 5E2UL 1UD6A 1U4EA 1TZHA 4WNQB 4Q6IB 4YDKL 4JRYE 1P2CB 2VAJA 3EHBB 1CQKA 1P5UB 5GGRA 4ODVH 2J73A 1I7UA 1JNJA 3OX8A 1U8OA 3FU0A 5C0JA 2WKLA 1CLOH 3BIKB 3HPLA 4HUUA 1R3LA 1HHJB 3HI1B 5I76A 4L18A 3VFTA 4XVUD 4JN1L 3NACH 4UBDC 1RIUH 3IKCA 3NBNA 4ELKA 4PJCE 2BW4A 1AQDB 4LHJB 1RHFA 5CXPA 5AW5B 1PZBA 1QX1A 1II4E 5AVVB 5HGHB 1OP9A 2FECI 4PSRA 2DM7A 4H0LC 1J5CA 5LUMA 3LHPH 1G1CA 3APDA 5KSUA 3IJHB 4IKKA 1UWXK 4IQHA 3KH4A 3CVHB 4YLCA 1CXLA 2QPUA 1CLOL 1XD0A 2W94A 3Q2NA 4UOW0 2YWZA 4TNFA 3BH9B 3KPSD 1CLCA 1DDHA 3G5YB 5I24A 2VDLL 2YPVL 4TQPA 3MJ9H 3WXVH 1JHTA 4AC4A 1KEGH 1CCZA 1ES0B 3RWFA 3GJFH 1F02I 3POCA 4HJTA 1NDTA 2F54D 4IBSA 4QMEA 2CBTA 5JHDA 4YL4A 2PPEA 5GS1C 2ICWI 2VDRH 4NHCH 1KEML 1X5YA 2YXWA 5D6DC 1QLRA 1M05B 3H7LA 3REWB 4AY0A 1JPTH 2DQCL 2F8OA 1IC5H 3DO3A 1SEQL 1W72H 2OTWB 4J6RL 3IBEA 3JTTA 2ZXBA 1T2JA 4HOZA 4LU5L 1KT2A 3IJSB 4HGMA 3IU3B 1OCRB 4KUCD 2KH2B 3WY1A 1CICA 2BH0A 3B37A 4BZ1L 4IYKA 3EJZD 2NY6B 1E4KC 3IWUA 2ITEA 1HZHL 3PL6C 3VO0A 1YY9D 3FT4B 3MBEC 3MUZ1 3AAZA 5T3XD 3WEXB 1KULA 3F84A 2O6DA 3U83A 3IFPB 4ZOCA 2F08A 1WWCA 2C9PA 1DVUA 1RZPA 2EE3A 3QJQB 5JLZA 4A2EA 1D7CA 2IG2H 3MR9A 3VE0A 1RP9A 4Y5VB 2NDGA 4FQLH 4GAYA 3LCYA 4O9HL 4S0SD 5L2JB 4HIHB 1E2ZA 5D1ZI 2NY4C 4RWHA 3BEWA 2WCGA 2BDNH 4XNMB 5TE4L 1ORQB 2QQNH 1WDAA 3HRZB 3RNKA 3PWNB 3VX1A 4U6HA 2A99A 2BNQA 1QFPA 1OGAD 1JZEA 2MOVA 3NFSL 1RD6A 2VDPL 3FTGB 5DQ9B 2J8UF 3B7SA 3DX8A 4XBGA 3F7VB 4Z7VA 3VWKB 3WOVA 3KPRE 5IVXB 5KSBB 2FNBA 3GXPA 3QQ4B 5EZLA 2QLVB 1K85A 3HZKB 3W37A 4FHJA 4LCYA 5DJYA 4FA8A 2DD8L 4EN3B 1OAKH 1MAKA 1QSVA 3QIWD 4NC1E 2ICWB 1KNOA 1MCDA 1ZXQA 2AK4D 4DERA 4BEIA 1XR9B 1N68A 2V37A 2AQ3A 4JGMA 4NO5B 5IESL 4F7CA 2I25N 4XVUC 3DK2A 2KI6A 3FQWB 3NPSB 3QULB 4W9EC 4DSYA 4GAGH 2NUPA 1BZ7A 1J9QA 4FDWA 2XN0A 3O6FA 5CCHE 4LVOB 1IZJA 3HHMA 1N3NA 1MFDL 2JV6A 2XV2A 3GJFA 5KANI 1QP1A 5FA3B 1KTRL 1I3RB 3QJVB 4GS7B 1KC5L 2WLLA 2JVUA 4HFWB 3SN6N 2ZWLT 3BZEA 1LO3L 3MZTA 3CIQA 4I18B 3QYNA 3BDBA 1NKGA 4UTBA 3SGEI 1A9BA 5IESH 3AQZA 3PCYA 1E4WH 2IFGA 3UTSA 1MF2L 1XDTT 3MBWA 2QT6A 4JG1L 1Q1JL 2CJTA 2H1LM 2Z35A 1F45A 1WD9A 4Y4FA 5GRUH 3K6FA 4FQQA 1U42A 1UC6A 1IL1B 3KM1A 2W8CA 4MFHA 3QZBA 4CVZA 2C5DC 4PS7A 1OGTB 4QGYA 1ZTXE 2C7UB 3DX9A 5I26A 4DPRA 5E8OB 2MQ3A 4JKPH 3TS8A 4YIQB 2NY4B 5LWYH 4Z0BH 2AI0L 1BJ1J 1SPDA 1JERA 2A9ML 4A7GA 4CGTA 1AANA 3T1FA 4DJMA 3BKCL 1YO4A 3UYRH 5I6XC 4F7EB 1JD7A 1QBMH 1U33A 3JYBA 1EERB 1E3ZA 1PCSA 2EZ0D 3FKUS 2WB7A 3IGFA 5ANHA 5C0IA 4OCWL 3VWKD 1U91B 4JR9H 4OJFH 3HN5A 1PFCA 3U4AA 5CLYA 2O5XH 2XIIA 4WUKH 1FVEB 4CJ1A 3JWDC 2R69L 3RAJL 2CDEA 2E9IA 3F6IA 1F00I 3S35X 1TEGA 5ICYB 5GS2H 3V0VB 4ZRGA 3GSXB 3T1WA 1A5FL 1R3IH 2KZWA 3GLDA 1G7MA 2VQ4A 4PWKA 1BM7A 1VGEH 2HKAA 3UIZA 1AJ7H 2G5UA 2WD0A 4MD5A 3DNKA 4D2NA 1XIWC 3E80A 3IU3A 3LVTA 5IFJB 1WHOA 2JQAA 3QQ3B 2CU9A 5AG9A 5IQ7H 2C4XA 2GBUA 4A2DA 5GGVY 4DOHB 4OZGF 5CD3A 3ZR5A 1BJ8A 4X2UA 2CDFA 2LU7A 1DBJH 2J1ZA 4N8VA 3WD5L 1JK9B 2ZG2A 4I0KA 2R29L 1W9XA 4TLTA 1KPUB 3G5XA 3OHXA 2FGWH 4OVUA 4TTDC 1HHIB 4LFHG 4LPVA 3T77B 3ORJA 5I16B 2A6KA 4RGMC 1MNUH 4OTXL 4CBZA 2Z31B 4R7LA 2NY6C 1CFNA 2CGYA 5IB5A 3SGKC 5BJTB 2CDGB 4RAUB 4TUUA 4HU2A 5JOFA 4UT6A 1BIIB 1KB5L 8PAZA 3DYPA 4FNRA 3CLFL 1IGFH 1TKWB 3BVNA 3VH8B 2CRZA 3TFKC 2YN3A 1TJIL 4PJ9A 1DLHA 2VLKA 5CIPH 5BMFH 5CD3B 5E08L 2B39A 4OAWA 4G8GB 5LCVA 3FOMA 1HWWA 1A6VL 1MCIA 4PGJA 5ETUA 5KG9B 1R3HA 1JJUA 3O3DB 4PMFA 4NN7B 1OCOB 2R27A 5DEZA 5E1AB 5AB1A 4IIQC 3QQDB 3NPZB 4JUTA 4LEOA 4XOBA 4R4FL 1RIVH 4LASH 1DLFL 2R29A 1W0YT 3PL6D 4TVPL 3RTQA 5F9JB 3VW3H 3D9AH 3ARGC 1AR1C 3DV4B 3V4VB 3K6SB 4P2CG 2FEDD 2WINA 2ZUQB 4XE5B 4KDWA 1UEYA 3L7FA 5A2AA 4YHYC 1TVBB 3QORB 3ABKB 2F1EA 3UBXG 1OCWH 4GLRI 4WWKD 4N4YB 4OFYD 1VZGA 3BWUC 5GS3A 2R9HD 1YPZF 3IMRA 1T1WA 4MRBA 5IMLA 4Q52A 4TUOA 4G6JL 1NMAL 5C0AE 4A6YB 4WTQA 1E5UI 5DD5H 4TUJB 3HVNA 4W9KC 4AIZB 1LD9B 4AM0Q 4EBQH 5J9PA 3IJYA 3L2MA 3JVGA 2IOIA 1GCFA 4P2RE 2E56A 4IEFA 3PUUA 3M1OA 3K91A 2OX5B 3KGTA 4KRNA 3DSFL 1CC3A 2ZWYA 1TMCB 1XGRB 2OMBA 1AGFA 3SKMA 1ZMYA 3MV11 1E8WA 1DJHA 3CDCA 2A1WL 3P0VL 1PEWA 1ACYH 4S0HA 5C0DB 1TLKA 1KENL 2ED6A 1MHEA 4XOAA 4Z7UF 4B9FA 5F7FA 4UM9D 3C2AH 4Y16A 3U9PH 3WNMA 4XNYL 1QASA 5J1AB 3KPNA 5FGSA 1P5VB 3US0A 3IDIB 2WLNA 2G0LA 3AU1A 2Y7QA 3NJIA 4XC1L 3U2JA 5E6IA 4P9HC 3HI5L 3BESR 1PW3A 5H2BB 3N5AA 4IDLA 2FIKB 3KH3A 1UZ8B 4G59C 2FLMA 4Y2NA 1DJIA 4L8DB 3N85H 3PGDA 1JYVA 1RK1B 3T65A 3IF1B 1U8LA 2GPZA 6FABL 5I8OL 5CCJA 2VL4A 2DQTL 5EF3A 1VJSA 1BXAA 4LCYB 5DJYB 1QUPA 1TENA 3VI4A 3WTUA 2Q9OA 4ONHA 3TZVC 3BFOA 2A77H 3V6ZA 2Y1AA 1E6JL 2J1KA 4EI5C 4M5YH 2QKIB 2QMKA 5B4MD 3HMXH 4QD2E 4H2CA 3INUH 1JD9A 4BE5A 4HU8A 1JGLH 3TO2B 7TAAA 2EDXA 1XWVA 4QF1B 2O5XL 4PRIE 4PRHE 3S3JA 3UGEA 5K9QG 3T4YB 5DF0A 4PV1C 1SVZA 2FAUA 2WQXA 3CZKA 4V33A 4X6BB 1YEIL 3EH5B 5L0QB 1J5IA 3V4PL 1HE7A 3B2VL 4XNXH 1Z1WA 4PG9B 3RZWA 4AIZA 3FQYA 4BZ1A 3VFOB 4L5FE 1RHHB 4XVSL 4YSAA 4M1CD 1AMXA 3RVXD 4B0MM 5I8KH 1DSFH 1LO0L 3MXVL 4HCRL 4UT6H 5EZJB 2UUDH 1EX0A 4QYOA 2LHAA 1QVOB 2Z92A 1T03H 2HCZX 4AM0B 2QSQA 2FDBP 1KXTB 3II3A 3N1FC 1OB1B 4JKLA 1W0VA 1BSIA 2I24N 1C8PA 4CW1B 2W0LA 4MCZA 2DQDH 3ECBB 5E8EA 3C60D 4LSRH 3L6FA 2J2ZB 2GVYA 1A0QL 1I82A 3KBEA 4KRLB 4U6VH 1AJ7L 3CFBA 3TA3C 1E3FA 1L7IL 1UJ3A 3D39E 4WI7A 3QEGL 2OTWA 3SGDH 3AS3A 1HEZB 3Q5YA 5EEZA 5I19L 1XF2A 3CDGA 2W9LA 5E6IB 3FZUD 3RWJB 5AALA 1OTUD 1MXGA 4OAWB 1WCBB 2BNQE 4ZTOL 2VUYA 4MKTA 3VD5A 3W39B 2WWOA 3DJ9A 4UF7C 3DI2B 4UT7L 3MMEA 3K74B 3T8XB 5FECB 3F7RA 1PKQA 3KPMB 4PJBB 3B9VA 3EG9B 4NI6A 5JW3L 1TITA 4HXAH 2BPBA 2K7PA 1QHOA 4P5MA 3BP5A 2NXZB 3PWPA 5SV3A 4IJ3C 3BP5B 1JS4A 4AZUA 2D4DA 4CUCA 3NEXA 1OTTC 4XNZC 2XETA 4V1DD 1CN4A 4OIIH 4NEHB 2Z7WA 2DQJL 2PCFA 1JTOA 4GRWB 1L9OA 2XN2A 3QORD 1YECH 1FL3B 2X1XR 4I3RL 5CP3H 1BFTA 3ESPA 2BJMH 3QR0A 1JK8B 1LWRA 2CK0L 3MLXL 1L7TH 4P57A 2YPVA 2XKNA 4G9FA 5DFAA 1G1KA 2WP3T 1KPRB 1NFAA 4N90D 4PJIF 3V95A 5JXAL 1JV5A 3OD3A 1TVHA 4POZC 4TPRH 3PL6B 2GY7B 3U0TA 4DAGH 1WEJH 3ATEA 3EYOA 4MMXB 4PD4K 4WHYG 5JDJA 2YAFA 5GGRB 1CDCA 1Y18B 1SNRA 1XR8A 3VI4E 3CLEH 5DMKB 3QEQB 4YPGA 4WO4B 1N5YL 4M48L 4ECNA 4U3XA 1XCTB 4HKZB 4PMEA 4FA7B 1RERA 4Y19E 3LH2L 3QUMB 5DMIH 3UC0H 2I27N 5C0AA 4EUPA 3NJLA 4WI9A 3H6JA 4L4TB 1BQ5A 3L3OC 4JFDE 3VXUD 2PWHA 4QHKI 2XN9B 5F7MC 3P0VH 4JVUA 5TK4A 1XSIA 2XIBA 3TCLA 1ITCA 2XDHA 1D7DA 4GQ9H 1CJYA 3FOMB 4YDLC 1INQB 1T66C 1SLVA 3X11B 2K6WA 4LMQI 2GAZA 4S0TD 3IMVA 1HDMB 3CXDL 5JOPE 4AI7A 4LSPH 5GS0H 4Y4HA 4N0UA 3QFJA 4Y4HB 1Y6MR 4WFGE 4RZKA 4I4WA 1A3LL 2B1AL 4YHZH 1Q9OB 1V27A 5F3FA 5A3ID 1EQWA 3MV7E 4KQ4H 3BEWB 3MRLA 1E0OB 4KJQC 4LHUD 5HVGB 2AJ3A 1A3RL 1Z9LA 1M7DA 4X6DE 5IHBA 1WFOA 4HFUH 4AMWA 2BIQA 3H8NA 5KSVB 1C5BL 4NKQB 1AAJA 5CLZA 3EJSA 3HNSH 3O9WC 5E2VL 1OARL 2BHFA 2V2TA 3VTMA 3KJ4B 2AQ2A 3EYVB 4JY6B 3ULVL 3KLHC 3L9RB 1D5BA 3K0WA 1KB9J 2KDYA 1HIML 2GEEA 5FK9B 4XNUL 1IC7L 4BZ2L 4YMPA 1F86A 5F9DC 4F57H 2KPNA 1AZRA 3MNVB 4A66A 3WTVA 1CFBA 4WI5A 3KLQA 2VDOH 4M7LL 5HJ3A 3GMPA 3INUL 1A8JH 2D4FA 5C6TH 1NEPA 3VYPA 1KJ3L 4RSYA 4LQFL 2Y36H 1VHPA 2DMGA 3ECUA 3MNDA 5CF3A 3HE6B 1J0ZA 1HAUA 3IDYB 4QOKE 5JO5B 5DS2A 4QPEA 1DZ0A 2GKIA 5IW1B 1U3HA 1UWFA 3D3VE 1CFNB 4PIBA 3DOSA 1GOHA 2HFEB 2WGNB 3WN6A 4TV3A 4IOIB 5I1CH 3MYZA 1VCAA 1FFTB 1G4RA 3GSNH 1UA6L 1XEUA 1T5WB 1O6VA 2GBTA 3GHBL 4OJDH 3QHFH 2R1YA 3NIFB 4YL9A 3C9NA 5H35B 3ATDA 5IQNA 3ESUF 4YBHA 2P80A 4M7LT 2WQRA 3THMH 4AEFA 1TNMA 1VEMA 6PCYA 3RL2B 5IEHB 1TCRA 4TMPA 4BJLA 3U4EB 3B9EA 2GJ6A 4AITA 3MMEB 1OGAB 5HYJD 3GYRA 1AQKL 4NS0A 3VFNA 3WLBA 3V6OC 3ZE2F 3JTBA 3QUHA 3GMQA 1QSEB 3ASNB 2YUZA 5DRXA 1TYEB 4N2CA 1K4CA 2Q6WA 3SE8L 5IZ7A 3FN0H 3V9CA 5HPMB 1SHWA 3HC0A 4OGQC 3DGCR 5DVOA 4QRRA 3R1GL 4NBZB 4DGVH 3I50L 1EDHA 2J56A 4P5RA 3TFKD 1X6NA 5H37H 4NQXA 2XSKA 3UTZA 3K2MC 5IM7A 4KFZC 4JFPB 1KCSL 2XFXB 3LS4H 4Z1PA 1MIEL 4PJDE 3KHQA 3UTTA 3U4BL 1QSFB 2MCMA 2Y1ZA 1EPFA 3U46A 3MV01 1P7QA 2GITB 4JDVA 2BERA 2PYFA 3WLBB 1J1OL 1IBGL 3RKDD 4DUWA 2Q1EA 5IB4B 1T20B 3NAAH 1UM6H 2WMPA 4R0LC 4H8WC 1MFUA 4UOJA 3H0TB 4PJHF 3V5HA 1FG2A 2V0AA 3GPEA 3O3EB 4ZXBC 5DQDL 43C9A 3IAGC 2B4CC 2LVEA 1JZ7A 1W72A 3EO0A 4HUXA 1P84J 1GIGL 1T80A 2X89D 1MCWM 4AMXA 4KNSA 4I18A 5C0RL 2VLJD 5EU6D 2MQCA 4OM0H 1BAGA 2D31A 1YNLH 1TTRA 2AJSL 2EQDA 2BMKA 2B9AA 4IK6A 1I8KB 5JQHC 5JIKA 1H9VA 2BCMA 3T2NL 4AKOA 4WJKB 5E6IC 5HVWA 4NRXB 3FT3B 4MAUL 2BRRH 1UYWH 4OQTH 4DPAX 4ORGA 2X3AA 5DZAA 1UOKA 3UBXI 4LSDA 4NQCD 3L3HA 3T65B 4PLJC 2XX1A 2H1XA 4KTGA 3GRWH 1KTBA 3O4LA 3VXSD 5AYQA 3GKZA 5JW5B 3VM7A 3E8VA 3EO9L 4ZZKA 3GZKA 5I18H 2BSSA 2UX6A 3HW7A 3OX8B 4ODUB 2XWZA 3EYVA 4JY6A 4CU7A 1RUAL 2UY7B 5FEBA 1YMMD 1AD9B 4TLSA 4C56D 4IMKA 4KMQA 5HHPB 4I2XB 3WFBH 4DP2X 3SKNB 2ZF9A 1BBDH 3KPOB 2DQGL 4WKXA 1ZOXA 2JI2A 4NN6B 4JFDA 1DP0A 1TMQA 4NUGH 1AP2A 3RWGB 1A1OA 3OKMA 4HKBA 5H4YA 4ELMF 4M43H 2ARJB 5CLWA 5DEJA 1X9LA 5LBSL 1GGCL 5JHDB 1QFOA 1IM3A 3L1FA 1XCWA 2YGNA 3LS5L 4X8JA 4YVNA 4GBXC 1P4IH 1ZV9A 3B5GA 1WQVT 3U25A 3BSZA 4U1LA 1AGDA 2X2YA 4LCWE 3P1VA 2O61B 1FG2B 1KYUA 1JPSL 4NKDB 1SF5A 3F12B 2CO3A 4MZ3A 4A63A 4DF9A 4E9WA 3MJ7A 5AZEL 4M5ZH 1DQKA 3LQZB 1FO0A 1M3JA 4XGZB 3H9SE 2W65B 3D2TA 4E41D 1K8DB 1F58H 2I9LB 1GAFH 3V7AE 1E4HA 4TQEL 5EZIH 1K8IA 4D9RE 4KQ3L 4LNRB 1XSKA 5AW8B 2Z3FA 2V9TA 2FYVA 4LSTH 3BPOB 4BA8A 3I9IA 4X4YA 3QARA 4V11A 1EHKB 3O6FB 3KWUA 4A7UA 3UTPD 5FIEA 1PY0A 2IDSA 2YZ1A 1GXEA 1A7QL 4ZPVA 5FB8B 3S9DB 2BOBA 4Y4KA 3AREC 4X80H 1T7WA 5D7LD 8FABB 2MNJB 2PTTB 3MLSL 1ED3A 1W6WA 2CJUH 4UB0H 3OL2A 3HNTL 3CU7A 5T1LB 4LLUB 1UKSA 5TDNB 1GGTA 1FCGA 4AE0A 2X4SB 1KF9B 1OGSA 5KYXA 3RWIA 1K4CB 2Q6WB 4UINL 4JRLA 4XN7A 5C0FB 3QRGL 4BXSV 3D6GA 4KZEH 1OB0A 2WYIA 3MTRA 2IV9A 2R2HB 5DHYB 1OE3A 2K3TA 4UOZA 1JI2A 1BIIA 3RX9A 4PB0H 5D2NE 3BLBA 1LK3H 2CM6A 3BYYA 1TTCA 5CN3A 3HJ0A 1F13A 1ZE3C 3QUXD 1SY6L 2O6FA 2VISB 2YAQA 3CHOA 4TM9A 5G4OA 2QLYA 2G60L 3LRMA 4U1NA 2J71A 1JXGA 4X6DF 3TIDB 4AEIL 4J28A 4NQDD 2AXJA 3MV8E 1CR9L 1KV3A 3GS4A 2ESVA 3DUSA 4FTVE 4DKEH 4EN2A 4AGQA 3JV6B 4FCHA 2BP0B 5GGSY 5I5MA 5DUPH 4FZEL 3GBML 4Z9KB 1ZVSB 5ECGA 1B4RA 3GSWA 2AJVH 5ESVB 5AW9B 4Q0XH 1SYSA 4L1HA 4WUUB 5KYYA 4FI6A 1BLNA 4PR5B 4JS7A 2H7WA 3KVPA 4UQAA 4LCIH 1M7IA 2OSLB 5DJZA 3MRMA 3P4LA 1PG7W 4LCUA 3DX3A 4LT7A 3IPFA 2IWKA 3QJHB 4AM0A 2AV1A 2P4AB 3UTSE 4CNIA 1RJZA 3BEVB 2ZXCA 4PJAB 5AB9A 2R0LH 2WNXA 3MRBA 4JANB 3NSXA 1CGTA 1S7RB 4NZFA 5F7UA 3PP3H 3LRLA 1VESA 1SVCP 4EI6A 2APVA 5EPMB 4F8QA 4J4PC 2KC0A 1AKPA 5E8OA 2IO5A 3GSWB 4GMTH 5ESVA 2UWEB 1OGTA 2F5AL 4WCYL 2JLLA 3ZIMA 3TO2A 1ACXA 1CIUA 2OLDA 3ARTA 1A4JB 2FIRT 3NIDB 3NJHA 4EMZA 4O2EA 4BQ8A 2HX9A 3SO3B 1ZKAA 5EWIL 1ETZB 1DBBH 2R4SL 1G4MA 3GQFA 2J5WA 1JGEA 1CU4H 2XZZA 3FU5A 4RFEA 2OK0H 1SDAB 5CBAB 1Y6NR 4ZUWA 2C34A 5IKCB 1BBDL 1U6AH 4W81A 1HKLL 4M1GH 4KJPC 3HG2A 4GKOA 4OB5H 4WV1B 3C09C 1FPTL 2EDWA 2WBJC 4PYHA 4XMPL 2EUZA 4P9MH 1ECYA 5D9SB 4AQEB 2A74B 5C0NC 3QQ3A 1OGPA 1PCXA 3EDFA 1MFMA 4ELMB 2CWRA 1HVXA 1Q9LB 4B9IA 3DX7A 4M5ZL 5FHBL 2EAEA 5KW9H 2L7QA 2BVOA 3EFOB 5DFWH 1NBQA 1SMAA 1N7ML 2P7TA 5BRPA 1AO7B 2PUQT 4H25A 1OP3H 3TT1H 5KBKA 2K6YA 3PG2A 3PY9A 1J0JA 4PJXB 5AOIA 3M7OA 4E9YA 3TM6A 4HDIA 1RJYB 1T3FB 2NTSP 4WF7A 3T8MA 4WI8A 3TT3H 3VFGL 4N0CD 4MJIB 2QADD 4R4NC 5I30L 2YQGA 1DQDH 2QPSA 3ZTNH 3VFPB 3SDDA 3QI9C 4KQ3H 2ATAA 4CSTA 2FEJA 1WFUA 4UDTA 1JGLL 1BBJA 4JO4H 3EJYC 5I6XB 2BC4B 3UZQB 2OJ1A 3W0WB 2H8PA 1I4FA 3NSFA 3SDAC 4DIXA 1PZ3A 1R3JA 1UJ3C 2XQYA 4XP9L 4YDLB 1UOWA 3VGFA 4ZW6A 1AZCA 3HE6C 2NZ9D 5BS0B 1IL1A 3H42H 3M6DA 3QFDB 3E9TA 1IGYB 1MAJA 2R2HA 4K94L 3EBHA 4HWUA 4RMBA 5IMLB 2XY2A 3WGVB 3U4BH 2H0JA 1HOCB 1MHCB 1ORQA 2NXZC 3HRZA 3QUXB 3ARWA 3GIVB 2YUWA 2W9EH 2AZAA 2WNWA 4NZDA 2FBOJ 3LZFL 4G1MA 1MWAA 1FNAA 2GHZA 4F2MA 3WXWH 2ZNXA 3VA2C 3VG0L 5C9KA 1S5IL 5I6NA 1CBVH 3CUPA 3UX9B 1P4BL 1E2VA 4ODWA 1P0SE 5J13B 4JY4B 3LZRA 4JO1H 4RRPM 1F42A 1A7OH 4LO9A 4JL2A 5T5FH 4IBVA 1A7QH 3V0JA 3L3GB 5DJDA 4JZJA 1VKXA 3AM8A 1IE4A 3TO4A 5C71A 4MB5A 4NC1C 2QDWA 3C8KA 4JMNA 2EZ0C 2WGXA 1CYWA 1KNOB 1PG7H 4NN5C 5BW7C 1FO0B 4I0PD 4K8RH 4K9JA 3CZFB 1AR1B 1F2XK 4LCIL 3EOYG 4HS8L 4O58L 3DVNB 2EICA 3DX1A 4JB9H 5EO9A 3GXNA 4YFEA 1MCCA 4X6EA 5IB1A 4MMYA 2VH5L 1UB5B 2EUVA 4E41B 1M71B 4FYQA 3FCBA 2VXUL 4Z7UE 2EIEA 2KLSA 2DH3A 2Y3AA 1VFAB 3GI8H 4QRUA 2B8OT 5BO1H 1QPPA 1V10A 2Z4QB 1U92B 4GT0A 5HHMD 2Z4QA 1A64A 3NZSA 3C60A 3ABZA 4Z7OB 5CEZH 1MDTA 4Z7OF 2J8UB 3U48A 4LRIC 4C54A 3MODH 5DURB 5F3BA 2PP8A 4ODBD 4Z0BL 3CH8A 5KSBF 4FFZL 5FFOA 3VD1A 2CHZA 2DQGH 3HRZC 3NIGE 1ET8A 1V05A 3OWRA 1RJLB 1YEKL 5EWIH 3RVTC 3PHSA 3IF1A 1JP5A 3K8MA 3C6SB 2E9JA 2XTSA 3U2SA 1J0YA 4WW2F 4BK8A 1U6AL 4IGBA 5KJRH 2AXGB 1ZA6B 2IMNA 2N0KA 3ULVH 5ACZB 4LSQH 2BOBB 4GW4A 4MQ7A 1HOEA 1NGQL 4M7KH 3B2XA 5EOCH 3PU7A 3S4SG 3EF7A 4P9ML 3O4LE 1I1AD 2KUTA 4MNHA 4NO2A 3WFDL 3E7JA 1EBAA 3Q6GL 3KPSE 1KLGB 2MMXA 3MBXH 3ZDXE 1VFBA 2FYYA 4X6FB 3GTTA 4ZUTB 4L4JA 2X4OA 2HPOA 3B2UD 5DO2D 5J3HD 2IBZY 4NM4L 4HJGB 2NY2D 1YEEL 1CD9B 1M7XA 4U1GC 2FHFA 5T3XE 1ND0B 4K8RC 4LLYB 1NGZA 4FG2A 4NLAA 4LGPB 4J12A 4DP6X 3HUJE 3DPBA 2R15A 4ABWA 2FJUB 3BZFB 2CGRL 2VSDA 3P9MB 1L0XA 2VMFA 3BPCB 1Z3GL 1PS3A 1NDMB 2V8LA 3RZCC 3FQUA 4B41A 4BRJA 4BKTC 2NY2C 1F1DA 5T5NF 3UZQA 2WY3B 2C4FU 2NY7H 2ODHA 1SDYA 5D5MB 4EJ1C 1EJFA 1LL1A 4X5QA 4WGWB 4CU6A 3QORA 3QXWA 5C0ND 2WVVB 3H1ZA 3ETBF 4FJYA 3RVVD 3D69B 4Q6KA 3V0HA 4FMVA 3V4UL 4JY5L 5TGBB 3FHQA 2GJRA 1JPSH 1KB5A 1KXHA 3LX9A 1QYGH 5AD0A 3LKQB 2N56A 3S4SA 4NQXB 3KLAB 1QFWL 3WTTA 2OCFD 1FNLA 4LARL 4GOSA 1UXWA 1YYLL 4LQFH 7FABL 2CG9X 4E9LA 2W9DH 3QQDA 5E9DE 1P2CA 4LLDA 1PYWA 3KYOB 1YN6B 2NYYD 3T0EE 2XYBA 3FSOA 2DYRB 1OF2B 3B9AA 1G7IB 4KTDL 4O02H 1G0DA 5DUML 1IGIL 4GRMA 4Q4EA 3W57A 1BA9A 3EYFA 2F5BL 1AQHA 2AQSA 4BQBA 2Z8VC 2PR9A 35C8L 4MA8H 2DLTA 5K9OB 5IY5B 3RL1A 1T2XA 3TN0B 3WFEH 1EK3A 4CADA 4BWUA 3DJTA 2E9GA 1F3DH 4AYFB 5JW3H 1A1MB 3VDBA 2AJ3B 1SLWA 3OR7B 3WN5C 3FQTB 1MRFL 4OLEA 2XCMC 1CGVA 1YY9C 1JVKA 2ZJSL 2ZUQC 1YYML 3ZT6A 4QHUA 4K3DL 4TOYL 1FL6B 3QJOA 2Z4TA 2VJXA 3O41B 1WEJL 2BFVL 3OR7A 5JZ7D 3FZUC 3W82A 4PGDA 1E8ZA 3BHBB 3QEUB 4B9YA 3CBRA 4N1EA 4N6RA 1LE5B 1K4DA 5MERB 3B9KA 5KN5A 2VJ0A 3P4OA 3RHWK 5KZCB 1JWSB 5L8JB 4YXHL 1KB3A 1P53A 2XA8H 1TQVA 4NCC1 3UABA 4KY1L 2WANA 3NQIA 2JNZA 2BX5A 2IAMA 3P73A 2JKRM 4ZOBA 2PWDA 4MBOA 4L4VB 3SY6A 5BO1L 4AUYA 5AL8A 5DJZB 1ZSHA 1IZKA 2JELL 2Y06H 4IK7A 3L4CA 4QRPB 5IJKA 4FNLL 3GSQA 5DLMH 2E5EA 5GRZA 5KS9A 2BK8A 3VXSE 4X5XA 1KLFA 2X2HA 4QRRE 1IC4L 3Q06A 3D18A 4DEPB 1E5AA 4GUCA 4LOEA 1AZZC 2DQTH 4R3SB 3HLAB 3NJVA 3GUTB 3MRKB 3MV7D 5JUEH 3AG2B 1PF3A 3MRJB 3A6BL 4OLVL 2PPCA 4F9PC 4I4WB 1U8PA 5E1HB 5LAPA 4D94A 2A9MH 4PGEA 2OXHB 3BWUF 3PRZA 5IP4A 4WWKC 3X2QB 3IFLH 3T71A 4WSKA 3TIEA 2EKSB 1FL3A 3HMXL 4YHNA 4BFIB 2Q7YA 1I7ZA 3SD5A 1MG3C 1R3JB 1QFHA 1GS8A 3NESA 4P59H 5H4ZA 1YEGL 4OZHE 3S34H 3BPLB 2V5SA 3CXDH 1BJMA 1KTDB 4OCLC 3VACA 5HHOB 3F58H 1UJTA 2BHYA 2PXYD 4Z7IA 4E41A 1D3CA 1HILB 2AEWA 4R7NA 1FDLL 4ODTL 3BKYL 2ZCKL 4AQ1C 2J8UE 5I23A 4U1SB 1VA9A 4H1LA 3WG7B 2YPKB 2H0FA 4PRHB 5L4FA 2J5LB 2PW2B 4WAFA 3TJHC 2Y7OA 4GBXA 4XO3A 2VDRL 5D1XA 5FV1L 1EXHA 3WJLA 2MEJB 1F58L 4FL4C 1DBJL 2VR7A 2W95A 4N2DA 2C7FA 4NKMA 1P7QB 3JYCA 4RZCA 5FFLA 3GXIA 3BVDB 1W72L 1YEIH 2X7LB 3MNWA 5E94B 4CBPA 2H32H 5TGBA 5ID0A 5CZRA 2XWJB 4K7PY 2AJYH 1DQML 3OQRA 4YC2B 3BD4A 3CFBB 2L8AA 3G08A 3RUGB 3EFFB 1GAFL 4G72B 1MW1A 3QDMD 3IDUA 5EC2A 5HVHB 1JCVA 3AXLB 4JFVA 3WKNA 3GSNA 1K8IB 4JM2A 5BV7C 5CJOH 1I1RA 3DIFB 2DWXA 2AK1H 4AIXA 4F20A 2I9LA 3CN1A 3B2UC 4OZFH 3IAQA 4J8RA 3IEAA 5JXEA 5IW3A 1KPVB 2DJUA 3NCJH 3PDGA 3QUXA 2FNWA 5KBMA 1FFPA 1BV8A 1GYUA 2FBJH 2PPDA 1J5OH 4LEXL 2WXOA 3N06B 3QR2A 1MW0A 3WKQA 4HWNA 4JRXD 3TEXA 2JF1A 4UZUA 2QVFB 1UZGA 5H94A 5JHAA 2NXZD 3D1MC 4PBXA 3IMSA 2UUDK 1OGAE 1JF1A 3ESVF 3IXTA 2FX7L 4L3CB 4K9EH 5DI8B 3S3CB 1ONQA 2HFGH 4PBDA 1WIPA 2Z91A 1P7BA 4HIHA 1R34A 3C5XA 4M56A 5DYOB 1I3GL 2JQMA 1HHKA 1QRNB 4TYUA 1W0WB 3F7KA 3NCYP 3QZOA 4RIRB 3HLKA 5ID1A 1ROCA 5LN4A 2QGBA 1JGDB 1PZDA 5I6OA 5IW6A 5FYKL 1TFPA 1HH9B 3GSOB 5C08D 2ZOTA 1YUHA 1H3WM 4YSOA 2EVJA 2VUKA 3VSQA 4PJEE 3ULUF 3K4ZA 3GDCA 5TPWH 4U1HA 1HXMB 3GHEH 5B8CB 4MZRA 4PJGE 3ASWA 1SEBA 3JUYA 3AY4A 1NSNH 4F27A 3NFPA 4TNWK 2W60A 3NZ8A 3ARFA 2VR8A 2ZXDA 4DEWA 4DTGL 3S8WA 1RCYA 4MD0B 4M5TA 5I0WA 4AYEC 3RIFK 1VADB 2ZG3A 5D4IA 2DQHL 3HBZA 3P3SA 3CSYA 4PV8A 2D7PA 5DYOA 2I85A 5KSVA 3T4YA 3HB3B 3RWDB 1RLWA 3CVCA 3ARQA 4YFLI 3INOA 1IBGH 2BMKB 4AT6A 2DD8H 4UNUA 4F2EA 1AKJB 1KIUB 3LN4A 2XQBH 4FHKA 1NGPH 2XG4A 4Y4FD 1WBZA 1A6ZA 2OZ4A 3UJTH 3QWQB 2D7QA 2WZPA 2JJTA 1CF1A 3PWPB 1NOLA 4TTDD 3TV8A 4ETQA 2IQ9L 4ZD3L 4Q2ZA 1CURA 4TVUA 2VT0A 4AEHH 2NX5D 4J39A 4UMGA 2P3YA 1OT1A 1DE4A 4BHUI 4JJOA 2AVFA 3RJDA 4IIZA 4HAFA 5B38A 3SY0A 3BPLC 1MKFA 4HUMB 1AQDA 1QA9B 5CZKA 4WGKA 3A6BH 3VXUB 5I8OH 1UZ8A 1BVLA 4D0BA 5G5DA 4UNTA 1NC4B 2XYCA 1HHJA 3HI1A 3G7TA 2IVFC 2Y9RT 1XCXA 4U6YB 3U46B 2B1HH 3C6LB 3QNYB 4J3OG 3RDJA 1QQDA 3ULVE 2YSTA 1DDTA 3IDIA 2AI0H 1QRNE 4DGWC 5IVNA 2AITA 2ZE0A 3LHAA 2YOAA 4KK5D 1QKZL 3IS0X 5GGTA 4PS8A 4P3WA 2CLVA 3LPWA 3OG6B 3Q0HA 4KKZA 4HAGA 2DJMA 1OARH 4HQQL 1BAFH 1SBBA 4HPOH 4HLJA 1ZS2A 4MAYD 5EIIG 5D6CA 4B7LA 3DYMA 4X8CA 5B1KA 1H8SA 1V3KA 1GKEA 1K72A 3DBXB 1HX0A 2LLGA 3EJPA 4NSKA 5T5FA 3RB7A 3SDCB 4KO7A 5DA4A 3TEUA 4JFEE 4NPYB 5GS0L 4I9WD 4NZUH 5KUMA 1OWWA 2EXWD 2Z92B 3N04A 5D55A 3SGJA 4KZDH 3L4VA 4E9TA 1T83A 4FQPA 5D9SA 5M7QA 1SUJA 3PREA 1F2QA 3FCTA 2AGJH 4C4KT 4DKDC 4PFEA 3D07A 3QSKB 4FEMA 4KGLA 4WW1B 4P5KB 5LGJA 5EOTA 5F0PB 3STLB 2ZAIA 2NQ3A 2YZ8A 2ZP9A 3BFQG 3QW9A 1NAMA 1ITBB 4GAFB 3TO4C 1KIRB 3FFCE 3LIUA 4J23A 4QF1A 2XX0A 5KSAD 3HZMB 2XQ0A 3RFZA 1IC5L 4IRJC 5B7FA 1J05A 1JPEA 2FSEA 1KXVC 4KRMB 2FWSA 3DETC 4M93B 3W9EB 1IVTA 1DQQA 1I1YA 3BKYH 3GKWH 3L3IB 4FLOA 5D7LA 2CHXA 2A6KB 1MCNA 1QNIA 1ODUA 5AKRA 4WTZG 1T1XA 3B3IB 2QELA 2XU9A 3CZSA 3L2NA 4G83A 1PNCA 3LPPA 2WXPA 3TBYA 4FERA 4I48A 2UY7A 5EPMA 1RP8A 1FSKC 5J5EA 1XFPA 3LDBC 1ED3B 3F85A 4BWTA 1FVDA 3EGXA 1G7HB 2Q2LA 3TBSA 4BV1A 1XF2B 2O5NA 3QO1A 3VGEA 2N7BA 2J6EH 3C5SA 4RETB 2GK0A 4GUPB 1RVFL 2FIKA 3K71A 2HMIC 2J2ZA 2ZSVB 5C7XL 4KV5E 1AVAA 1PLAA 1WAPA 4G8EA 5C0GA 3TF7C 2AABH 1X7QA 5C08E 4FG4A 4XWGH 5HDRA 3WTSA 5T1JA 4YUEL 5L6YL 3IDMA 1TSHA 4YSDA 4YVUA 5IBUB 1SY6H 3OXSA 4OZHF 2Y23A 2HRPH 4DKAA 3LNDA 2X0UA 2LTQC 4U33A 1XBRA 5CHNB 2R7EB 3G9AB 5BVJA 5E6YA 4M62H 3D25A 4L8BA 3SO3C 1KBGL 3GJEB 3OLEA 4AQAB 3QORC 1YEJL 2BP0A 3KDMB 4ZOEA 4HK3N 4LEEA 1JHLH 5I74B 3BPOC 4PY7B 2AQPA 1OV8A 2R39A 3K6OA 4Z95L 1IAMA 3DBSA 1NCHA 5I9QC 3IU4L 3O6KH 1LP9E 2WNGA 4IHOB 5L4IA 1T2QH 3TBTB 1P1VA 1QD0A 1MRCH 1EHLL 1DTUA 1MFDH 1LK2A 2OYMA 1M6UA 1U0QA 3BYTA 4M62L 3FUFA 4AC2A 2CMRH 4O51A 4LCUB 2YXMA 3EH4B 5K1VA 3I2CL 1OL0A 4JPIA 1S46A 4MDIA 1AR2A 1ZLWK