2PPDA

Oxidized h145a mutant of afnir bound to nitric oxide
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
336
structure length
336
Chain Sequence
b'ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWAVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
molecule tags Oxidoreductase
source organism Alcaligenes faecalis
publication title Stable copper-nitrosyl formation by nitrite reductase in either oxidation state
pubmed doi rcsb
total genus 89
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2007-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ppdA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ppdA02
2AZUA 2RACA 2BWIA 2FT6A 3C75A 3AY2A 1L9SA 1PNDA 3BVDB 5D4IA 1TEFA 1L9RA 2CBPA 2A3TA 3H56A 4YSSA 4HHWA 4KNTA 3NJJA 1TEGA 5AKRA 1OCOB 3UACA 5EHFA 3X1NA 1AZCA 2BZ7A 3N55A 2X87A 4YVNA 2BHFA 1PNCA 3UGEA 1GS7A 1PZCA 2EILB 2ZWNA 4A2EA 3OQRA 2IDUA 5B7FA 2HZHA 4BXVA 4KNSA 5AFAA 1BXVA 1SFDA 5B7EA 3WNIA 4YVUA 2PCYA 1YLBB 2XX1A 5PCYA 1ASQA 4E9RA 3WKPA 2VW7A 3ASOB 4E9WA 2FQFA 2PPEA 1XB6A 1X9UA 3AW5A 2BZCA 3FSAA 2FQEA 4CSPA 2B3IA 2IDSA 3X1EA 2QPDB 1L9OA 4YSTA 4HCFA 2N0MA 2IWKA 4DPAX 3ABLB 2HRGA 3X1GA 1J5DA 2J57A 3QJQB 1J5CA 1VLXA 1GY2A 4HALA 4NB7A 2UX7A 1B3IA 1NIAA 1NWPA 2FQGA 4UANA 2VN3A 3ZDWA 2QDVA 4YSEA 2ZXWB 3BQVA 1IBYA 1OCCB 2IH8A 2YAMA 4G7SB 1CUOA 1HAWA 1JXDA 1SF3A 4DPCX 3T6XA 1AIZA 2CJ3A 3IN2A 3TASA 2IDFA 2EIKB 2OV0A 1F56A 1A8ZA 3NSDA 1KGYE 4UAHA 1ZPUA 1KBVA 4E9QA 1BAWA 1AZNA 3FU7B 1OE1A 1AS8A 2CAKA 1BYPA 5B1BB 1AQ8A 2UXTA 3NT0A 3FT0A 2FJSA 3FSVA 4F2FA 2HX7A 1WAEA 4BDVA 1PZBA 2W88A 3FYEB 4A2DA 2IDTA 1FFTB 3AG2B 2GIMA 3PCYA 2PPAA 2QPEB 3GDCA 3FSZA 1JXFA 4E9XA 1A4BA 3UAAA 3ZX1A 1XMEB 2VSKB 2VM3A 1ET5A 1OCRB 2UXFA 1A4CA 4BXSV 5I6PA 1I53A 4HIPA 4L0PB 4CSZA 2UXVA 1QLEB 2FWLB 5E9NA 1MZYA 2BW5A 4M3HA 1IC0A 1NIBA 2VSMB 1AZUA 3H4FA 3S3CB 4QLWA 9PCYA 4W1TA 2IDQA 3SQRA 2Y69B 4YSAA 4AKOA 4DP7X 4N4YB 5B1AB 1JVOA 4AKPA 2TSAA 2AZAA 5PAZA 3V9CA 1GYCA 1AG0A 3FQ1A 3ASNB 3NP4A 4HZ1A 2W8CA 1MG3C 3PLYA 1WA0X 1OV8A 2HX8A 2VMJA 3OM3B 2J55A 2PP9A 1BYOA 1HAUA 1WA2X 1JZFA 2VW6A 4ENZA 1NINA 5B1JC 2YAPA 4WTQA 4BWUA 3X2QB 2GSMB 4X4KA 2I7OA 3FSWA 4YSQA 1T5KA 2PPDA 3CG8A 5B1KA 2DWSA 1CYWA 2YAOA 4N8UA 3JTBA 1SHWA 3IBOA 3D12B 1PCSA 2GHZA 3GYRA 5AZUA 2YARA 3NJIA 2QDWA 4E9YA 4A68A 2AFNA 2EINB 3FQYA 2VM4A 2H47C 5I5MA 1PF3A 2IAAC 1E5YA 4YSDA 2DY2A 2BP8B 1ADWA 2BP8A 5D4JA 2NRDA 2BW4A 2JXMA 2XLLA 4KO9A 3S3DB 1ZIAA 3EH4B 2FQDA 1RZPA 4HAKA 2MTAA 4BWTA 1PLBA 4HHGA 3AZUA 2YAFA 1J9QA 4DP2X 3NJFA 4F7KA 4Q89A 2H3XC 3NJNA 1AOZA 1W8EA 1BQKA 4F2EA 1W6LA 2VW4A 2GI0A 3FPXA 2XU9A 1SNRA 1AANA 1OF0A 1ASPA 1L9QA 2GC7C 4YSUA 4AX3A 2YXVA 8PAZA 3FPYA 3QJSB 3QJTB 4NERA 3T6VA 2DYSB 1AAJA 3PAZA 4YSPA 1NIFA 3X1BA 1NIDA 4DPBX 2GB2A 1GSKA 1FA4A 5B7MA 1NPNA 5D4HA 3TBCA 1WA1X 4JHVA 3EF4A 3QJRB 2ZONA 3QJUB 4KOBA 2GBAA 1ZV2A 1EZLA 2FT7A 1RCYA 2E86A 3FS9A 4HCGA 3G5WA 2EIMB 4KOCA 3T6WA 3KW8A 4W9ZA 3UAEA 1V55B 2GC4C 2TSBA 1KCWA 1AG6A 3TU6A 3JT2A 1KV7A 3QQXA 1CURA 1E65A 6PAZA 4BK5C 1BQ5A 2XX0A 4GYBA 3HB3B 3OMIB 4G7QB 1V54B 1ZIBA 1AR1B 1ILUA 3DTUB 4YSOA 1PLAA 5B1JA 5I26A 1ETJA 3WKQA 5FC9A 2EIJB 1ET7A 1RZQA 1NTDA 1CYXA 1OE3A 1WS8A 3FU8A 1BXUA 3EH5B 4P5RA 1OOWA 2FT8A 1L9TA 2P80D 4DP8X 4K9JA 3FU7A 4WKXA 4FAAB 5B3SB 1PMYA 1NDTA 5F7BA 3NYKA 1JXGA 3WI9A 1BQRA 7PAZA 1SJMA 2XYBA 2BWDA 5I28A 3EHBB 1UATA 4BWWA 2XWZA 1IKOP 1AZBA 2YAQA 1KYAA 2PP7A 1KDIA 3QPKA 4A66A 3ZBMA 2YQBA 2HXAA 1EHKB 3FU9A 1JOIA 1JZGA 2XV2A 4TXVB 4Q8BA 1NPJA 3T71A 1FWXA 2WO2B 1N68A 1GW0A 4GXFA 2PPFA 1PY0A 1SF5A 1M57B 1MDAA 2JFCA 3NJLA 2HX9A 1BXAA 4MFHA 3SBPA 2XXGA 4G70B 3MBWB 1E67A 1TKWA 3CVCA 1JZIA 3EH3B 2XV0A 5I5JA 2UXGA 3S3BB 3ZIYA 4DP4X 2AVFA 1TU2A 1A3ZA 2IWFA 2XV3A 4KO6A 1MZZA 7PCYA 4KNUA 3NP3A 4PCYA 4M4RB 2Q9OA 1A65A 2Y1AA 2IWEA 2FNWA 3T9WA 1ID2A 1AS6A 1PAZA 1JZJA 3UADA 1JVLA 1GY1A 4GY4A 1NICA 1JERA 1JZHA 4JKNA 3H4HA 1L9PA 2J5WA 1E5ZA 2DWTA 1KBWA 3HEIB 4AKQA 1MG2C 2OCCB 1J9SA 2YXWA 4QKTA 1NWOA 1ILSA 4AI7A 1JZEA 4RH4A 1AS7A 2PCFA 3RYMA 1KDJA 3TA4D 4HCIA 3CDZA 4A2HA 5I6KA 1ET8A 3AG1B 1M56B 3AG4B 4GP5B 4KO5A 4AZUA 5IY5B 3ABKB 3SBQA 3CVBA 3PAVA 1OCZB 2B08A 4P5SA 1SFHA 2WSDA 4YSCA 1X9RA 2MRYA 3FQ2A 2R7EA 2CALA 1SDDB 3PAUA 3ERXA 3NJHA 1NZRA 1IUZA 2H5UA 4DP0X 5LDUA 1SHXA 1KCBA 1WS7A 4G7RB 2I7SA 1BEXA 2Q5BA 2X88A 1ZDQA 2AANA 2I85A 4E9TA 3NJMA 3NJGA 2LLNA 1XB3A 3NSYA 1QHQA 4GP4B 2XXFA 2BP0A 1AACA 1XB8A 6PCYA 1DYZA 1W6WA 2PP8A 1QNIA 2PLTA 4ZK8A 1NIEA 1N70A 3CDZB 5I6LA 5F7AA 2HLEB 2UX6A 3KW7A 3V9EA 3IN0A 3WNJA 1ZDSA 3ABGA 3OMAB 1IBZA 3ABMB 3TBBA 2DV6A 5TK4A 3IEAA 2BO0A 3WG7B 1URIA 1M9WA 2PPCA 4E9VA 2OJ1A 4G72B 4G71B 2DYRB 3CVDA 2YAHA 4YL4A 3X1FA 4DP1X 4JHUA 3OD3A 4UF7C 3DKHA 4BDVB 1ASOA 4DP5X 3QJVB 2BP0B 3T6ZA 2J56A 3U25A 4DP9X 4FA7B 5I5IA 3NJKA 3OMNB 2IH9A 1AZRA 2XVBA 1R1CA 1GS6X 2YAEA 3GXUB 2R7EB 3PPSA 3NSCA 4KO7A 5I6NA 2JKWA 3SBRA 2XUWA 5I6MA 4EF3A 2HRHA 2ZOOA 1OE2A 3AG3B 3N2JA 3NSFA 2FTAA 2CCWA 2QT6A 4YSRA 5TK2A 5I6OA 1PLCA 3CZUB 1J9RA 1RKRA 1DZ0A 1HFUA 4NAJA 1A4AA 4A2FA 4A2GA 5A7EA 1V10A 4E9SA 2P80A 1E30A 4PAZA 3WIAA 1CC3A 3MX0B 3IE9A 3L45A 3S8FB 3UABA 1J9TA 1SDDA 2WO3B 3FYIB 4A67A 3DIVA 2CUAA 1GS8A 1GR7A 1PZAA 4GP8B 4DP6X 3PXLA 5ANHA 3S8GB
chains in the Genus database with same CATH superfamily
3IFOB 4EDWH 2XXMB 1XGPA 3LD8C 2EIZA 2OCJA 1NMCB 2F8VA 3GQFA 2AP2A 2WXHA 1EFXD 1NCNA 3LNFA 1IM9B 4AEEA 1P2CA 4QRBA 4GT7A 5IKCB 3T0ED 2OM5A 5FA4A 1JG9A 4Y4HC 3EFFA 5JOEA 1V27A 3SDAA 4XNUH 4D8OA 2VLKE 2EILB 4RAUA 5C09E 1C8QA 43C9B 1EJ6A 2EO9A 3GSWA 2VR6A 1G7QA 5GS1C 4RRPG 4U0RC 2WNWA 4KVCH 3VQMA 2WZ0A 4KJYA 1KIQB 1WAAF 4LVNC 5J89A 3X13A 4AVIA 1YEIH 2IAND 2V3FA 4JQVA 2AJXH 1YPZE 1OKEA 5FB8B 3NBNA 3LPGA 3G6DH 2DWYA 2XRAL 1UT2A 4U4IA 4MNQB 4MKMA 5JIQA 2ZOLA 3MKGA 5JXAH 1M7DA 1JWSA 4WFED 3S8WA 3BKJL 2DQDL 2FECL 3PP3K 4KVNL 3KDMA 1KT2A 4X5QA 4FLRA 4PJEF 2Y0SA 4WI6A 1EAQA 4QHMB 4UNVA 4UM8B 1CT8A 1W0VA 1HIMH 2DQFB 2Z4QA 4I0KA 2CO2A 1T6BX 2FECI 2O93L 2IH8A 2B5IB 1MY5A 2AKRB 5D2NA 3S34H 1AH1A 1EHAA 1J9CT 1TQWA 3VFNA 4F92B 5AKTA 5JIKA 1DEEA 5AW0B 2G5UA 3EUUA 3TPUB 4HVBA 2IDFA 2ZQKA 2DKUA 1C9SA 3GHPA 4XRCA 3G6DL 1KNOA 3ZHDA 5FA4B 4X5RA 1MIMH 3A21A 3JZYA 4QRQA 5D72L 1QG3A 1WBYA 1WTLA 3L3DB 3ARBC 3TCLA 4OLYL 5KAQG 2X5PA 3ETTA 4UYQA 3VDCA 5EU5B 1F1GA 4ZW6A 2ED9A 4GRLA 1VFBA 2DQJH 2WLLA 1INQA 3VD9A 1DN0A 3GMPB 4HCRL 1LEIB 5IM7A 4IGBB 3Q01A 4YAQB 5E6ID 3TF7C 2IDTA 2G9HA 4KUZH 1OZUA 1RK7A 2PPAA 3ETBF 5KS9A 4WW2A 1WCBB 3O81A 3QZOA 5EU6A 3QYNA 3WLWC 3DXAE 5ICUA 2QQNL 1OSZB 4Z7VA 4YHKL 4MD4A 3EYVA 2X44D 3US1A 1WH0A 4HIPA 4A7VA 1A6UL 2JJWA 3DA0A 3QIBB 4A7SA 4BFOA 2ZUQB 3IF1B 2Y6TE 4OLXH 4UQAA 2CGYA 1TJIL 5E00B 1MXDA 4MCYA 4MMXA 2IDQA 1R5VB 3OKNA 4N26A 2N0KA 3QXAB 4JFFB 1JVOA 1Y0LA 2A9ML 1WO2A 1A1OB 1BWWA 3L7FA 5IMKA 5TF1H 1WV7T 3GMOB 3T0VA 4MJIE 3FT4B 2A77L 1DBBL 1I8MB 4J8RA 4TLTA 4NUQA 1JYNA 4OZ4A 3LCYA 3RZCA 1XGZA 4GSDH 4D7PA 3UYRL 1KB9J 3T1FA 1TJHL 3V6ZB 3MLTB 5CZVL 4QJ3B 4MXQC 1HHHB 2NQCA 3EH2A 3MSPA 3X2QB 3ZYOA 4QOKD 4PV9A 3SE9L 5INDB 3UTTE 5LHDA 5BS0A 4B9KC 4E41A 5DJXB 5LAPA 4ABVA 2L4OA 4QRPE 2CMRL 2YZ8A 4PJXB 4XCCL 3V5KA 3VH8G 4PJ6A 3SQOH 4IHOB 2DMCA 2HTLC 4AYFA 5I0YA 4CL7A 1F11B 4HC1A 3TBVB 5E4IA 4PWJA 2XBZA 4BA8A 1HILA 2E75C 2GK0B 3HI5L 3NIGB 3HAEH 3VFRB 2EYTA 5DA4A 2BM3A 4H2CA 1HXMB 3SGJC 1D5MA 2BW4A 2W65B 4Z7WE 1TZHA 3ILDA 3NH7H 2D31B 4NJ9L 4F1SA 3QIWC 3L6FB 2NMSA 3KE0A 3A6BL 1IAOA 3OHXB 2A1WH 2EDMA 4J3BA 5M94B 1VEOA 3QFDA 1B3JA 3L3OA 2G2RB 3MUUA 4DP2X 3CZGA 1HNFA 1CD1B 1SYSB 5IF0B 1U6AH 2NNAB 3OMZA 5DZJA 2PYEA 1W8EA 4ZW3A 5JHLA 2VYRE 1IJNA 1W6LA 3TN0D 2XU9A 1T1ZA 1INQB 1ASPA 2D3JA 3DOHA 3WAKA 5BJTA 4YDVB 2JB5H 2WYZA 4O2FA 5IJDC 1M4KA 4IRSC 4DZBA 1UWXH 5FGRA 2HRPL 1BOGB 2KERA 3ARGA 4QY8B 2J12B 2FJUB 3O6FD 3QUXD 4MA7H 5C9JA 5I24A 2Q7YA 1ND0A 2ICWA 2KPWA 3MLZH 1PSKL 1UACH 1KMGA 4KI1A 3G9AB 3MV8A 4PB9L 4OD1L 5E2VL 3X3GL 1S7XB 4IMLB 1ZV2A 2J1YA 1GYAA 3AUVA 5CCKH 1A7NL 6FABL 1UTDA 4Q0XH 2ZICA 3GBMH 4FS0A 4PJGF 4CN6A 1EAPB 4MRBA 5HYFA 1JZ5A 2WJ7A 2I69A 2BVYA 1MCLA 3LNGA 3RJDA 1TQTA 5FYKD 1XWVA 2BMKA 1NC4D 2IAMD 2YC1A 4TLKA 4XE0A 4FHJA 1AOHA 3S4SB 5CCJA 1CFVH 1IBDA 1KXTB 3VXME 2F5BH 1ETJA 3NCMA 5HYEA 3RVVD 1PLGL 4OLWH 3KLHC 4N2CA 5CCKL 2FIRT 1C5CL 3EH5B 5GSVA 4KXDA 5J57B 5B39B 2P80D 3B6SA 2YD1A 4L9LC 4AJWA 4X4MA 2DLEA 4Y19D 4BM7A 5LKNA 4PGCA 2XYBA 5IQ9B 3MV01 2R29L 4S0SD 1LEGA 3MGTB 5TDPB 4P2CG 5SWZD 3TBYB 4S0TD 2E4TA 5BMFL 1IFHL 2YQBA 4UI2A 2Q6WA 1NPJA 1J1XH 5GZNC 2A6DB 3F5WB 2GUOA 1N68A 3KXFB 4ZUVB 3U6XS 1YEJL 1NGXA 5BV7B 4RNRA 5BO1L 3GRWH 4GUQA 3NJLA 3MZGB 3FULA 1GCFA 3U1SH 4Z18A 2NYYD 5KAQF 1LP9B 4U1MA 5IW1A 5IVNA 1E67A 1ORQB 1YAIA 4K3JL 1MCPL 2ORBH 4ZPTA 2BNUA 2XV0A 3LRMA 2WUBH 3ECBB 4DP4X 2M26A 3GMLA 2ZCHL 4BZ1H 4L0ZA 3MR9A 4LP5A 5C2BL 2ZWSA 3H53A 4H88L 1NC2A 3F64A 3CFDA 5EG6C 1CXEA 3NZ8B 4M4RA 1NC4B 2IAMB 4PCYA 3ZIMA 5FO9B 4WTXA 1OY3B 5IV2A 3PNWB 2CKBA 3OF6A 4RWHA 3ECQA 3U0TB 2V2WB 4IKLA 2CDFB 43CAA 2P46B 2Q86B 1VRSA 5LGHL 5BXFA 4PTTB 1KGJA 1QKZL 1JVLA 1NFAA 4U1NA 3PJSA 4G43B 3MO1A 2YA0A 1KCUH 1F4WH 5CD3B 5F6IB 5C0CA 4MYPA 2LOEA 4A7GA 1MLBB 1JWMA 4PGEB 5DYOB 2CO7B 3CAFA 3LYRA 1NWOA 1EZSA 1UD8A 1A3QA 5IB5B 2PCFA 5KBDA 3GIVB 4KX9A 3ZQ9A 1QW8A 2V6HA 4KMQA 2JQMA 1XBDA 2FEDD 3NSXA 1QRNE 2JI1A 3F7VB 1EQWA 3IGAB 2VLKA 4M8UA 3S98A 5ID0A 5F1KC 3BXNA 3V0EA 4PY7B 1LEKB 4I2XE 3FT3B 4WUUA 2QV2A 2CDGB 5J9PB 3OHMB 4KHTL 4L3CA 4BKLA 1PZDA 2E6QA 3BLKA 3L7FB 4X4ME 3ECBA 4HUVA 1NZRA 3DPBB 4FNLH 3V0IA 4DP0X 5IGXH 3RKPA 2O5ZH 1AQKH 4ODUA 4P46D 4WY7H 4W9EC 4FZEL 2GTWB 3D87B 4XMWA 4JLRB 2X2IA 4OV5B 5ALBH 3BD3A 1A1MA 2XXFA 3CVHL 3MHZA 5K9KB 1AJ7L 3KXFA 4ZUVA 4X9HA 4F57L 1CLYL 3VWKC 5BW7C 1NFIA 4HBCL 2FIKA 3RPIA 2C34A 2JJUA 2EZ0C 1YEEH 4WWKA 5E8PA 4GKOA 3DUSA 4WV1A 5DC0A 1TIUA 1ZDSA 3BEVA 5DQ9B 4FLOA 1UB6B 3ULUD 1IBZA 2WVVA 4RMTA 3ZMRA 2VZ1A 5DMIL 2ICEC 2R2BB 4GS7B 4XVJH 2PPCA 3R0NA 1MCJA 1A0QL 3SDYL 5L6YH 1MJ8L 2E27H 2OXGA 3BZ4A 4JEGB 3T0EB 5ANME 1EZVX 3FUMA 4HLEA 4JPWH 3X1FA 3FL7A 1FGNL 4JHUA 4FE9A 4LPWA 1IEAA 3J07A 4QHLB 3DHUA 3CMOH 2DMGA 3HZVB 4N2EA 2LE9A 4RMSA 4B7LA 2OFQA 3ZRCC 4HKZA 4LIQH 5IHHA 1EEUA 1F3JA 1DANU 1FAIL 4MZRA 1MWAB 3HBZA 1DBJL 1REIA 3MV11 1ODUA 4OCSL 1HZHL 5FCUL 3UJIL 4AE1A 1QI3A 4DZ8B 4Q97A 1DZBA 5CLXA 3RUGE 2DH3A 1LL1A 3EJYC 3GHEH 4OKVA 2KL6A 1TQBB 1QZ1A 3M7OA 1U92A 4P9HH 3EOBA 1PLCA 5TK2A 4URKA 4NM4L 4XBPB 1YC8A 5JORB 1BSIA 1J8HD 4A2FA 1XF5A 3CSBA 3WN5C 4KAQL 4HIIB 1NFIB 2ZXGA 2C8NA 1PX4A 1S8DB 2DYPA 3NIGE 5BV7H 2EVIA 1I3GH 1E28B 1E3XA 4Y5YA 1KLFA 3CDCA 1ZVSB 4FULA 2GY5A 1JGLH 3MNWB 2CK0L 4HJGB 1F90H 1GZHA 1QO3B 1CF8L 4CA4A 4LQFH 3MV7A 2RACA 3WIHH 3O8XC 3FTWA 3K6SA 2X9YA 1JNHA 3F7PC 5AZ2L 3RWJA 1OHZA 2CBPA 3NABL 4OM1L 3CE1A 1W72H 4MB1A 1SYVA 4YSSA 5C71A 2YJLA 1MIEL 4ELME 1NANH 4C4UA 5GRJL 3UP6A 4ESKA 5DJDB 4H25B 5J7CC 3GGWA 2R23B 1J7VR 2PO6A 4LGPB 4UQEA 3AQYA 1GS7A 3QQ4A 4L3EE 4UM8A 2NX5A 3GSRA 2C9SA 4NCC2 3C2SA 2EC8A 5E0FA 4F8QA 5DLML 1R3HB 1T1WB 3BWSA 3C5ZA 4BZ2A 2X70A 4JHZA 4LDCA 3GJFA 1MVUB 2RALA 4HPOL 1Q4NX 3KJ6H 2CBQA 1CS6A 3C6LD 1B0IA 5SX5K 4Z77A 3KHQA 3RFZA 4X6DA 4GW4A 3VXNB 4IU3B 1KB5H 1U3HB 2BZCA 1H8SA 2WUCL 4KHXH 4YE4H 1TENA 1JPGB 1UOWA 1U3NA 2ADFH 3EO0A 3WTWA 5DZNA 1CN4A 4JY4B 1NGWB 1BQLL 5IQNA 3X1GA 1XCWA 4OLZH 2J57A 3NIFB 3CSYB 5LVEA 3MBWA 4LLVB 4FKEA 3D5OF 3OXRB 2W60A 4IMLA 1XIWD 3D08A 3V7MA 4R5XA 1YMHA 3O41A 4CNIA 1EERB 2R0LL 2YGNA 5JMOC 1OK0A 2OYLA 1FSKC 1X9QA 2DQIH 1AIZA 3D51A 5CZXD 5DZ9A 5EIIB 2CBMA 4ZO6A 4K2UL 1EEYB 4QNPF 1RZKH 5HGBA 5EEYA 3L48A 4U1GC 3ZXAC 1XGRA 1PAMA 1ZHLA 3S37H 2ZX9A 1CG9A 1E5AA 2K7QA 5JHMA 4XZUA 4BSVA 3X17A 4ANUA 2VJ0A 4TSAL 3B5TA 3VE0B 1ZRUA 1K8IA 1NGYB 2HG5B 4KUCD 2DIJA 3TN0A 1BAWA 3KL3A 1KLGA 3IJSB 1TJGH 3GXFA 2E7BA 1JHLH 3GTTA 5IQ9A 1U3JA 5CZXC 4PJCA 1J0HA 4WI0B 3UYRH 4H20L 2CM5A 1WZAA 1EEZA 1CD1A 1SYSA 4XX1E 5ITFB 5LWYH 4LRIC 4X5XB 4XVUD 1UZ6F 3VJ6B 1G9MH 2YFNA 3WN5A 2ZKMX 2W88A 4PIRF 1XIWC 1O9WA 2G2NA 3DX7B 2L7UA 2PO6D 2QPEB 3Q3GA 1IAII 2JLLA 2FE0A 3FRPB 3L6FA 5IBLC 1DBAL 2EEBA 2Y07L 3Q44A 3FU0A 1QVOA 2A6JB 4GW5B 3U7YH 1S9VB 1AQMA 1T03H 4RA3A 1FVEA 1QSVA 3EYVB 4WWKD 4LXFA 4ZX5A 3GXMA 35C8H 3UAJA 4ZFFA 1C5BH 1KB3A 5ISZA 5C07E 3VFMA 3DOSB 4HJ0D 1FI8C 3MV7D 4C56B 3ZDXE 1J12A 1OCWH 3VFVB 1KFAL 5DI8A 2W95A 5E8EB 2NY2B 2NY3B 1EFQA 5F70A 5I1IH 3PABA 4RBPK 3S3CB 3UBXI 4APXB 2DIEA 1MFAL 4GKZA 5GGQH 4OZHA 2Y69B 3QDJA 5G5DA 2G5BB 4CILA 2B8OT 4GKSB 2TSAA 2Y7LA 4MJ2A 4GAGH 3K4AA 2DQHH 5C6TH 3ZKND 1UJ3A 1G1OA 5PAZA 2WM0A 1IGIL 4U6TA 2W0FA 1YDPB 4E41E 1F42A 3BN9D 4B0MB 5EZPA 2D9CA 3AAZB 3MJ9A 4FNPA 2XSKA 1U3HD 3P77B 3RY6C 2CNZA 1R47A 1AXIB 1WA2X 1G43A 2DLHA 1D6VL 3VFUA 5IVXB 1IQDA 4UOZA 4KI5F 1BZEA 3O2DA 1KPUA 3T0WA 4G11A 2O5XH 5AB9A 4Q6IA 4GBXB 1A1OA 3CVHH 4PJ5B 2YAOA 4I2XA 3RIFK 4N2GA 3V6FA 2GI7A 3SQBA 4JDTL 3MLRL 3HN5A 2OMNA 4X5PA 3OKKA 2VR9A 3WFZA 2XKNA 2B20A 3GI9H 5AZUA 5A1AA 2R0KL 4X99A 4NP4H 4FFVD 3F2LA 2YD0A 2OSYA 5A2AA 4C56A 4ZUTB 2BDNH 4TNFA 1XZWA 5E1HB 1YJDH 3OJ2C 3T77A 5GRJH 4RGNC 1MFCL 3QNFA 1GC1L 1J1PH 3U1QA 2PCPA 3WY4A 5EC1A 4HT1H 2H1PH 4YH6A 5BRZB 1AFVH 5IQOA 1ZIAA 5MEPA 2CSPA 3ECVA 1NGZB 4QTHA 5MP6L 2MTAA 2EDEA 3V8CA 4QF1A 3QUYC 1IAIM 1T21A 2LV4A 3GS0A 5BQ7B 1URLA 1LO2L 1T6WA 2R4RH 3KPRE 3VFPA 5EULV 3T3ME 2DKSA 1M6UA 5I0VA 3TJEH 5I19H 1I1YB 3BIBX 5E2TL 3CCHB 4KKRA 5F7KC 4HQQH 4V11A 2W38A 2WLYA 3FPXA 4B53A 4E41B 1GJUA 2AABH 2GC7C 1ZT1A 4X7CC 5GISL 2OR9H 3N9GH 2VWEE 5HHOE 2JH2A 3O8XD 4MNGB 1U2YA 4F15C 4YZFF 2VLKD 3VFGH 4A6YH 5FHBH 3BH8A 3DURB 1FA4A 4QLRA 4D0CA 1Z2KA 3MA7A 2I07B 2R4RL 3N42B 3X11B 2WAQA 3MXWL 1M6OB 2CM6A 3VXRA 1HHJB 3INUH 3P0VL 1AHMA 5FHAH 3SGKA 2B39A 4FFTA 4J3OG 5AOMA 1YEGH 3W1ZA 4JB9L 3SZ6A 1ANUA 5LCVH 3MNZB 3U7WH 4LCUB 4GG6A 2EDJA 4U1IA 4W9ZA 4YUEL 5IFAH 3HKZA 4JPIB 2VLRD 2F19H 1IGJA 2OBGA 4X7EC 4JQIH 4BK5C 3BKCL 2E8ZA 4CRPA 2YUVA 2YHGA 3SBWC 3RY6A 3I2CL 5C0IB 3MRNA 2BVTA 5EZJB 3FNKA 1OGAB 1FJ1A 5H2BA 2R56H 3CVIL 5FYLH 5ABDE 2DQMA 5ERWA 5JOPD 3WFDH 3DTDA 3DBXA 4G80B 5DJ0B 2EIJB 1FFQA 1JN6B 2VLJA 4PS4L 2R69L 1OE3A 1CICA 5AZEH 1KJMB 4W9JC 3EDDA 4ODTL 3P4OB 1MFEL 3W9EA 2BOLA 3MROA 4AIZB 4WEUD 1B0GB 3AU0A 2VZ3A 1KGXA 1KCLA 1U8PA 3EOAB 4FYQA 3G5ZB 2OMWB 4EZJA 5F7BA 2AGJH 2P48B 3DK0A 3P9WB 2BWDA 4NENA 1EAJA 2XHNA 2YAQA 2PABA 1NKRA 3D9AH 1A1NB 3SYPA 3ZDZB 1RZIB 4HQQL 2EZ0D 3CN0A 5GS3A 1NOLA 3FTGB 4Y4HA 4KKBD 3S36H 3FN3A 3O6LH 5DJCB 5F1SA 1BJMA 4J3WA 3ZE1B 4AG4L 4GXFA 3JWDC 4Y1AA 5BRQA 2XTSA 5BZZA 1N19A 2F08A 4CMHB 3CFCL 3KYMB 4EEEA 4MFHA 4HWBH 3BZEB 5TE4H 4JG5A 2AQSA 3CHRA 3EBIA 3QDGB 4K9EL 3B7TA 5HYQB 3ULUH 2GT9B 4GQQA 4P4RA 3D0AA 3C8HA 2H2SD 1S9KC 3EF7A 2ITEA 3H42H 4FMFA 4GG8B 4I7ZC 4LCYB 4KKCC 1P7KB 2ITCA 4FG4A 1N67A 2Q8AL 3HG3A 4X6CE 5D7EA 1KACB 2H2PD 5ALCH 5AVVB 5K33A 1CFVL 4R4BA 5T3ZD 4PJHA 2CKBL 1FF5A 5HVWA 4TOYL 1NCUA 1VGKA 4ODVH 4Z76A 2Y1AA 3ARZA 4FTVB 4WHYH 1W15A 2ZOLB 4N8VG 1D5RA 2WLIA 1Z1WA 3MLRH 4QPEA 3IS0X 2ZX5A 2GSGB 2D2OA 3DPDA 1GY1A 4YDKL 4YDNA 1QVOB 3GBML 2OULB 4N25A 4XNZC 2I32A 3RBGA 3VI4E 1L9PA 3BQUD 1GZQA 4ISVA 5JQIB 3HEIB 1NM9A 4N2MA 3LZOA 4KY2A 2GAZA 1WFUA 2EYRA 1BLNA 5ESVA 5EOTB 5CEYB 4ANKA 5C8JB 4FN0A 4OD1H 5K93A 4M6MH 3OR6A 3Q0HA 1AS7A 1IIKA 4AYDC 2D3LA 5EZIL 2ZXQA 3TA4D 5F93C 5CEZD 3P30H 4MWFB 4XCFL 2BS8A 2W81C 1QFUH 2NDGA 1MUJA 2F1BA 1OCZB 2P5PA 3FSOA 1K8IB 1CK0L 1SFHA 2LQRA 4O02B 1LE5A 2BY2A 2WSDA 4X7FC 1MJJA 5KJ7E 5DMGC 4WFFD 2UY7B 3MYZA 4IBVA 1IGYB 4UTAH 2F7QA 4ICXA 2OW6A 4ZMWA 5J0BA 3V0WH 2J88H 4P46B 1A22B 2ITCB 3Q7JA 4NPKA 5DMJB 5FA3B 2FAUA 5T3XL 1I85C 1Z3GL 1X6NA 1ZDQA 3B34A 1TVHA 3LN5A 2R39A 2AAVA 3LPOA 3L3OC 1SEQH 3DGGA 4HS3A 1TVBA 4HH8A 3VMPA 3RNKA 3VH8A 2BRRH 3I6GA 4BKLB 2YPLB 1LO4L 2GJ6B 5FHBL 4OZGB 2LLLA 4Y2OA 3FKUS 3U0WL 2UX6A 1IU1A 3CPLA 3V9EA 4YHNB 2ZWYA 5FF6A 5D1QE 1RJLA 4Y16D 3IM1A 5C0AA 3AFLA 1URIA 3FUKA 5D96B 4HXAH 4XB8A 2P8MB 2JE8A 4RCAA 5IHUH 1KF9B 5ECJE 4H0LC 3THMH 5J11C 4DCQB 3ILQC 1I1AD 4M8RA 2HVJA 5I19L 5KJRL 4PRAB 4A1RA 4DP5X 3QJVB 2PNDA 4AXWB 4EZLA 3M88A 1MIEH 1KGIA 2OW7A 2PWDA 3KPOB 3OMNB 4LAQH 2IH9A 1ZA6A 4FFYA 4D8PB 5E6YA 1KIRA 4X0KB 2Y2WA 2VSDA 3SBRA 5IR1A 1NCGA 5C09D 3MJ9L 3ATBA 2W9EH 3FCTA 2Q2LA 1MDTA 2Z93A 3TZVB 1ZGLP 2AXGB 2J8HA 1UG9A 3NA4A 1YN7A 5EZJA 3VDAA 4A7GF 3N43B 4RRPM 1MHHA 2LAAA 1PQZB 4NRYB 3THML 5IHUL 1PKQE 2A74C 2AJYH 1A4AA 2IF7A 1I8AA 2OL3B 2P44B 5A7EA 3KNBA 2WQ8A 4PV1C 4HEMA 1KTJA 4KKCD 2HTLD 2GW5A 3AXLA 3UJJH 1JIBA 2CLVA 5D7SL 2WO4A 1HKFA 4MNHB 4PRPB 1IVTA 1PDKB 1ZT7A 2A4CA 3HG2A 4ATTA 1QP1A 4F58H 3LN9A 1BECA 1J05A 3AY4C 3F7VA 3IGAA 2R1WA 2UV3A 1TEFA 4RZCB 5KSAD 1P4LA 1OCOB 4P07A 5AOZA 5IB4B 4XO3A 4C56D 5CLTA 4LCVA 2DLIA 2EDFA 1S7UB 2W0PA 2W1NA 2KLTA 5C0ND 3GUFA 2QPSA 4MNGE 3LS5H 2CCVA 3G04A 3O4LE 4TQEL 2EIBA 2IGTA 3BVTA 3L3JA 3SDAD 4HS6A 4EN3D 2H41A 3WNIA 1E4KC 4G6KH 4GEJA 4K94L 4E9RA 4HCRH 1O6TA 4ADIA 4IGBD 4YS4A 2JTDA 4WNQA 1MRCL 2LTQB 4X2UA 2OKMA 2PPEA 4NO3A 1R3JB 1MEXL 3KPRB 3ZU8A 3AW5A 4AGQA 1F2XK 2D7OA 2H6PB 1L6XA 5EEXA 2A0LC 2J1ZA 3QG6B 1CFMA 3IRPX 3ABLB 3APCA 3I6KA 3ULUF 4DUXA 1CTNA 3GMMA 1A02N 3B8SA 3HLKA 4MDRA 3MA9H 1GY2A 3L9RB 2UX7A 4ODHH 2FQGA 4LP4A 3WJMB 2QDVA 3ARVA 2AJZB 3BQVA 3VWJA 3ZJAA 4Z7OB 3G9VA 3ZGIA 1U3ZA 5JPMC 3CDFA 3FN9A 3GZOA 3C6SA 4IQHA 3NABH 4OM1H 1ZOXA 4WJKB 1F00I 5L2KA 5BUGA 2EXYD 2H26B 2VT0A 1W2KT 5A6LA 4LQFL 1OPGL 1T0MA 2W94A 3FFDB 4K2UH 1MAML 3WL9A 5BZWA 4G7VL 4S10A 4AQ1B 3U82B 2FJFB 3NT0A 3ZGHA 3HR6A 3US0A 4FFYL 5FUZL 4KTGA 2PCFB 1AI1H 2NY4D 3TH4T 1PIFA 1QRND 2GIMA 1JXFA 3PNRB 2WLIB 1U2HA 2AK4D 3KM2A 1QSEA 4FA6A 4I18B 2XZZA 4HFUH 4AQ8A 4BGLA 3B7YA 1DVFB 3DDFA 3QQNA 4KHXL 2WUCH 1E27B 2N01B 5DD6A 1KY7A 5KYUA 1TVDA 3FHQA 3ZE2F 3BN3B 4HC1H 1QBAA 5LGYA 2WN3A 4JM2C 1QLEB 5CD5C 1ZJAA 1UWEH 2F74A 4K3EH 3SOBH 3QISA 1RY7B 1JPSH 2FVNA 2VSMB 2Z31C 1AZUA 5H37G 1T7ZA 3CUPB 3S35X 1HHJA 3KLAA 1A2YA 2ZUUA 4KFMA 4L8BA 5DJAA 1KWKA 3IJ7A 5GIRA 1GPOH 5F6IC 4DVBA 4UV7H 1YZZA 1JFQH 3L9YA 3MJ6A 4NZRH 2Y6SC 4UOJA 2HFGL 1PZ5B 3ES6A 3I6KB 3QPXH 4EKXA 3RVXD 1UEMA 3WNPA 4WI0A 4P2QD 3CFJB 2OYMA 2AEQH 2H3NA 2VMJA 3HC4H 3S88L 2I5YL 2WD0A 3QUMH 3RZCB 1VFAA 2ZPKH 4I77L 3WEOA 5CF3A 3QDGE 4RISL 4GRWB 3ML9A 1EVUA 4H0HB 5EBMB 5AG9A 1X7QB 5AAWC 1R19A 1QSED 1Z9PA 3QEQE 1A2YB 5JHDB 5B1KA 1CYWA 4PRNA 2WINA 5F21B 3ECWA 3RA7H 4XN4A 3SPGA 2OYKA 1DQML 2BOCA 1PCSA 3VXOA 3QFDB 1M53A 2NX5D 4ZXBC 1AGEA 2OMTB 3MOBL 2WXFA 1BFVH 1T7YA 3PHSA 1J11A 1SOKA 5ENWA 3VO0A 4BKSC 5I6XB 3EKCA 4U1GB 1A7BA 4KI5D 1NMBH 2KZBA 3S35H 3U0PA 1ADWA 2W59A 4KV5E 3MV8E 3K80A 2X89D 1AR2A 3T8MA 1A9BB 3TONA 3VFSB 1WHOA 3ESPA 4BWTA 1QRNA 1WBXB 3POCA 3B5HA 3LSOA 4UAOC 4S0HA 3VGFA 3TEWA 1AFVL 1BAGA 4JMXA 1JRHL 4JFVA 4ENED 3VSUA 5KN5B 2ARJA 5K5YA 3MRMA 2AV1A 4GBXD 2DQEL 2EAEA 4YDJA 2H3XC 2TRHA 3VRJB 2NTSP 1C8PA 5DC2A 2X0VA 3P0YL 1JL8A 4WKZB 2ZWZA 3RDTA 3GI9L 3B83A 1TITA 2B4CH 2GITA 1HQRA 4CJ1A 3QJTB 1KJVB 3NPSC 3G6JE 4PJBF 1VSCA 3LXUX 4L3ED 3CZFA 2Y24A 4IU2B 5FKPB 1J8HE 2APWA 3G5VB 5FDWB 5BZDB 4LHUA 5EN2A 4U1SA 2YSSA 2Y6SD 5JQ6L 1AO7A 2MIZA 4W9GC 5E5LA 3L9RA 2NY0C 3MRMB 2R2HA 1KXVA 4NLHA 4LARH 1B4JH 1WP6A 4NZUL 1RU9H 2Z31A 2QVMA 2NNAA 2DM3A 2AITA 3VGGA 3ARUA 5CZKA 5KW9H 4XPFL 3NEOA 3G5WA 4F5CE 4OUUA 1FE8H 3D25A 4R5VA 3RGVC 3KW8A 4DO4A 1V55B 2TSBA 4M5TA 2BSDA 2JKLA 4X98B 5DWPA 5T1DH 3AXIA 3BE1L 3KMDA 5D7KD 2F9BT 3VM7A 2IFGA 1ZAGA 1D9KC 1UZ8B 3M17B 5BVPL 4NQEE 3FUFA 4FTDA 4R4FH 4W6YB 5EU6D 4XBMA 3L1OL 3WMPA 1V54B 1YY9D 3OGCB 3TNNA 1PLAA 1TZOA 3WKQA 1RHFA 4EN3A 1HL9A 3DSNB 3WKNA 4A63A 4Z78B 4CVXB 5ESQA 2YN3A 2ETWA 4I48B 3UYPB 5B22A 5LBSA 5BRZE 1KYFA 4N90D 3KPSA 5B38B 2EXWC 3L5JA 2FT8A 4P5RA 5IROC 1F3JB 3W0WD 4J2QA 3AWFA 3H6AA 2PXYB 1A6WH 3QRLA 2HKHH 4G6MH 5GHWL 2ARWA 2NW3A 3G5VA 5FDWA 3EBHA 3PP4H 1NDTA 1NAMA 4L2LA 3EHBB 2XWZA 1IKOP 4MDIA 1KYAA 1KPVB 5I1CL 2LAGB 3VB9A 1XGPB 4KXBA 3HUJF 4JFUA 2NXYD 1NCWL 2ZCZA 4IRSB 4MX7B 1RK1A 3QSKB 2WXQA 3OLIA 1I1CA 1JGVH 5TGBB 1M3JA 3OR6B 3BUTA 1E2VA 1SF5A 3CC1A 5DJ8B 4LT7A 2CQVA 4TTDD 1F3DJ 1HSAB 3KCPB 4NQDB 1J8RA 1CL7I 2OJZL 3GRWA 1KG0B 2XXGA 1GZQB 4ISVB 4L29A 4DN4H 5HD8D 4PIBA 1G7MA 3LIUA 1I1AA 3T2NH 4XVSH 3WY2A 1EZUA 3KDMB 4ONFH 1HNGA 4QTIL 1BZQK 3QEHA 4JQIL 5E4EB 4BFJA 4FQ1L 3WTTA 3UMNA 1IAIL 3HIZA 2G60L 3TYFA 2ATAA 3AUWB 3CN4A 3B3BA 4AM0Q 3GIVA 5IW6A 1TTFA 2P8LA 3DBSA 3VA6A 4Z9KB 1P4BH 2EE6A 3KPOA 5GZOC 5ADOH 1LEKA 3T0AA 4KQ4L 4KZEH 1C12B 2VDNL 1JZJA 2WJ5A 1OSEA 2E3VA 1QFPA 4NC0B 3V0VA 3NESA 1NICA 4C58B 1JERA 2CR6A 1YEHH 2XZAH 3DI3B 1G1CA 1O0VA 2XIIA 4U1LB 3VTMA 3OB0H 4Y7OC 1FHGA 1DQLL 1UGKA 5BZWB 2ZSVB 2HG0A 4CGTA 1BA9A 2X4QA 4L8CB 2OX5A 4G3YL 4OZGA 4UV4L 2H26A 1K6QH 4KU1A 4OJAA 3UBHA 1TTUA 2LTQC 4K8RL 4LVOB 2XV6B 3TVMD 5DS1A 4FHKA 4X5WB 2CIKB 3B2XA 2EH8L 2HT3C 1SDDB 2WGNB 1G9NC 3O45B 3DVNB 1CLCA 4P9MH 1QLEL 1MAMH 2ZNWA 4WDIB 2C9PA 2NZIA 4F9PC 3WJMA 3IDNA 3LZPA 3S36X 3QORB 4PRHD 4TS6A 5M7QA 1BIHA 1PIGA 5D8JL 4M5ZH 4JM4L 5I0WA 5D5ME 4FEIA 3DVGB 4HT1L 3V0AC 2E56A 5D2NC 5CSBA 3P69A 3A6OA 5F0MB 2DIAA 4JB9H 5I1LB 4AVKA 5ES4B 3WE6A 3X3FH 3U4KA 1JGEB 1IBGH 3N0PB 1R3JA 2X4OA 1IGYA 4IU3A 3ALWA 4LCWD 3DGCR 5FFGA 1QI5A 3BGAA 3GBLA 3E8UH 1RUKH 4WJ5A 5DT1L 5F8QC 3D3VD 2NDFA 2XY1A 3QZWG 4HC1L 1YEFL 4E9VA 5B8CC 5CNHA 4MMYA 4RFOL 2ZOUA 4TYUA 1D5XA 1CLOL 4DAGH 3P3YA 1P9MA 1X44A 3GM8A 3MBXL 4IHBA 2A9AA 2NZ9D 1DJXA 5DMKA 1RPUA 1HEZA 4UZUA 4GMSH 2MQGA 1QQDA 3B9KD 1UXWB 2FSEA 4GOSA 2BRQA 5TJWK 4IBSA 4Z5RA 3IDJB 4FFZA 3PP4L 3D85A 5DJDA 2BNRE 4MZIA 4RFEA 4OTXL 5I6NA 2GSIB 3KPPB 4AV5A 5KSAC 4BE6A 5I6MA 4IEFA 2X6AA 3ARBA 4PJEB 4PYGA 2HYMA 2ZOOA 3IKCA 4WEMB 1JV2B 3QQDA 3PFUA 2YRPA 4XP1L 1A7PH 1VGKB 4EQ3A 5HPMB 5IESH 3ZO0A 4CC4A 3K2IA 2VDKL 3DX9B 3IDMB 4OIAA 5DHVA 5HDBF 3T2QA 4IK7A 3BGFC 2Z8WC 4I9XA 2VXTH 2Z31B 1H6FA 4JO5A 2B1AL 1JDCA 2UY6B 4KMLB 3NN8B 2FJGA 5CZRA 3P4NB 4XTRC 3S8FB 3NQIA 1F13A 1QPKA 3ZTCC 3BHBB 5DJZA 3T8VA 1UKTA 4LHUB 5EN2B 4XB7A 5I1HL 5GRUH 3MLVL 4DGVH 5FOBA 4AENA 5BS0E 1NAKH 3ATAA 3MXVL 1WFTA 2HKAA 1I7RB 4QYAA 3NA9H 2AZUA 1OM3H 3WUWB 2BWIA 1VFMA 4NO3B 2YD8A 4EOWL 3IU4L 3QXDA 2TRYA 3BVDB 3T77B 2Q3XA 2KUTA 2NCMA 1BM3L 3MTRA 5IG7B 4QOKE 4D7BA 4CUCA 4D8PA 3LXAA 1QD0A 1U30A 1JYXA 3JYBA 1RFDL 1XR8A 2O61A 1JTOA 3ENEA 5AVYB 2G75B 2J1WA 4KROD 1N7MH 2IDUA 4G6KL 1PS3A 4H26A 3N0AA 2HPTA 5KBKA 1SMAA 2ZUXA 4KROC 4YVUA 4BZ2H 3V79C 2JI3A 4NRZB 1O75A 1FNAA 2EDDA 4IBQA 4QOKA 3MV9D 3RAJH 4A2LA 3CIQA 1K72A 1ZPLA 2L8AA 5JUEH 2VKWA 4GW1B 1LMKA 2LU5A 4Z7VF 2UWEF 1WPCA 3MNZA 3FSAA 4BQCA 5E2UL 4P3DA 1EBAA 2IAMC 4JY5L 1MI5D 1RUAH 1WK0A 1T22A 4DPAX 4MNHA 4WFGD 3GSXB 3OJVC 2IFFH 5C0BD 2HJLA 1K2DA 3KVDD 1N5AB 3BGMB 3D34A 3L3IB 4H8UA 4YE0A 5L2KE 5MHSE 1SJHA 5FO7A 2YS4A 2VN3A 5TDNB 4TUJB 3ZDWA 5J11B 1SY6A 4F91B 5TPWL 2P5EE 1KEMH 4GRWF 1R5IA 4ZD3H 3V0HA 2K6ZA 5EUOB 5FLUA 4Z7UA 1YSOA 4IKKA 4TNVF 1CVRA 3MLWH 4ZTOL 5BS0B 2AJYL 3F84A 4PLOB 4UDUA 1MCPH 4JKPH 4HIHB 3KJ6L 1XGUA 5AAMA 4QRTA 4AM0B 4HX1B 4D0BA 3ETBJ 5IJKA 4XCEA 5GXBB 1T83C 4E9QA 3VA2C 5F97E 3BVNA 1MRCH 4MJ5A 1BMWA 3P73B 4HK0A 5SWQA 4JM4H 1ZTXL 3FT0A 4KY1H 2CCLA 2DI8A 1XBRA 4L37B 1O5PA 1QFHA 3K6DA 2PXYA 4WK2B 2VQ1A 4N2FA 4OY9A 5EDXA 3R8QA 4OD3L 3LZFH 4HX1A 4PV8B 3KLSA 5FFLA 3W11C 2AXFA 1LK3L 1YEEL 4O9HH 4IRJC 4I87A 3F65A 4F93B 1E6OH 3DJTA 1CF8H 3DX3A 2MCG1 5KYUB 2M1KA 2DTSA 4ZFGH 3DJRA 5C0FA 2BVPB 2R1YB 3VXUE 2AJXL 5I76B 2IPUG 4B3EA 2CGRH 1RUMH 4G9FE 1MFDL 5E9NA 2V0AA 2JJVA 4XVTL 5D7IF 4JG9A 5AYTA 2XICA 3KBPA 1TVHB 1AMXA 3JUYA 3LN5B 4QTFA 4GBXA 1KCSH 3RBSA 1DANT 5DQDH 5AW1B 4AKOA 4DT2A 2F1EA 3UJJL 3RX9A 2CJTA 3UIYA 2IADA 5CEZE 4XMLH 1N5YH 2BX5A 1S7TA 1NBVL 3BCDA 2WZPD 2J44A 2NQ3A 3TEUA 1A7NH 1DDHB 2WQWA 6FABH 4FI7A 5T5FA 2X4NA 4LL1A 2YGOA 3OZ9L 1KCVL 4LKXB 3AB0B 4BFBD 3BFOA 4JY5H 4POYA 1WGVA 4ZMTA 4PB9H 4PH8A 1HVXA 2CDEA 4DUWA 2JCCB 4I5BB 3L5WB 4N8VA 1KXQE 3WFHB 2WHVA 1URZA 3CHXA 1I8IA 1A66A 1X4XA 3BWZA 2CHXA 1KJMA 1BMGA 2G2RA 3IBOA 1QBMH 4HPYH 4BV1A 2C9AA 1IKNC 3VD7A 5CN3A 4YMPA 4TSCH 4YIQA 3GYRA 1GJIA 3VU1A 5I16A 3KWTA 4JE0A 1OXYA 4IRZA 5F9AC 1QSZA 1RZ7H 2F2HA 5DHYB 4FADA 1LNUA 3W37A 2GJ6E 4M5YL 4L1LA 4FQXD 1BGXH 4XE5B 2VM4A 1W0VB 2DQFA 3NCCB 4GQ9L 4LEOA 3CFUA 4TKWA 4PJHB 3L1EA 3GJEB 4UIKH 1K6QL 2JXMA 3Q8AA 1ZS8B 2EE0A 1G5AA 3IETB 4KO9A 4Y4KB 2X4SA 3CLEH 4RFNB 5KS9E 4Y4KD 4F27A 2X6MA 3MNWA 3WTUA 1LD9B 1S9VA 3EAKA 2YAFA 3V5KB 4MA8H 5C0RL 3BZEA 3GMRA 5KBNC 1YEJH 1DVUA 1YA5A 1QUPA 3D50A 4B97A 2A7BA 2P28B 3L7EB 3GDBA 4R3SA 5IJVA 3FRUB 5I1GL 5HHMB 1ES0A 1HZHH 4Y1AD 5BMFH 4YEEA 3N1QC 5KYWA 4XPGH 1EGJH 3EGSB 5IVOA 1AE6L 3WFBL 3WY3A 4NOBA 1RK0A 2ERJC 4CSTA 4P2OB 2VR4A 4JJ5B 4U1KA 2R1WB 5T33H 4JREC 2VMDA 2ZSWB 3FTUA 3SKOB 2NXYC 1OLZA 2BP5M 4EBQL 1Z5YD 1IM9A 1BX2B 4PCKA 7TAAA 3IDJA 1AAJA 3X12B 1AXSA 1J8HB 3C6LA 3F62A 3D9AL 4HS8H 4P59H 4ZMLA 4DTGH 4NKOB 1JF1B 3ZQWA 4WAFA 1SDAB 3ZK0A 5IB3A 3QJRB 3ZKNC 3MJGX 4TUJA 3LKNA 5JOFA 2VLJD 1IC7H 3S3PA 3BFWA 4WFEE 2GBAA 1HH9B 3VI3B 5KYWB 5LN8A 1IAKB 3HNTH 5JW4M 5T1KA 4DVBB 4LSQH 2NY1D 2VR5A 1DSFL 1YRKA 3GPSA 3QJHB 4HJ0C 4L4VA 2J8UF 4ZZFA 1AG6A 1CDYA 1ZMYA 4OJFH 1W72B 2DM4A 1RSYA 4O5LL 4BQ8A 1FFPB 3MUGB 3QQXA 4RX4D 4IKNA 4Z0XA 2FYYA 3LEVH 3TJPA 3OMIB 1U8QA 2Y5QA 4IJ3B 1ZLVK 3BKCH 1IT9H 4RZKA 4NRZA 3RTLA 5GZOA 1AR1B 2F58L 4HJEA 1U8OA 3N06B 4YSOA 5B1JA 1EO7A 4AQOA 1O5DT 4Z77B 4TUKH 1A6UH 2N7AA 1RZQA 2VITB 3VXRD 4QWWC 1CYXA 3VXRB 2ADJB 1JGIA 1ED3B 3F7KA 1M7UA 3WIHA 4XNZB 4HWBL 3FU7A 5I66B 2YWYA 3FZUD 1QLFB 1KBPA 4G1MA 4RGOL 4BWWA 1V7ML 4PP2B 4Y4HD 4FMKA 2JMRA 1AZBA 5FF6B 5D9SB 1C08B 4YHYB 3QPKA 4YHPB 1N5YL 2XBDA 1ZTMA 2HVKA 3B4NA 4F15B 2DQJL 4Q8BA 3F8UB 1WD8A 4G9FB 3I6LE 1UH4A 2FLMA 4FJYA 3WBDA 2P43B 5DGRA 4G6JL 1D5BB 4JCLA 3STZA 4M6NL 1RULH 3V0VB 1XR9A 2DYPD 3QXAA 3PWJB 4XNMB 4H26B 1S2EA 1RZ8B 3D7PA 4KRPB 5TFSH 3V5DB 5AAPA 5D72H 25C8H 4U1NB 4ENEC 1OF2A 4OCXH 1JNNH 2R69A 1F3RB 1DQQA 3FQXB 3CZSA 3E38A 2HMID 4X7DC 4EO5A 2XZCH 3WXWH 2RJMA 1KGCD 4W9KC 1AO7E 2JK5B 4BK5A 2IQAB 2Z92A 2NLJA 4JM2D 3IBEA 4M5YH 2L04A 3HE6B 1PZ3A 5I76A 1L3WA 4Q0XL 4ZOBA 4N22A 4ZNEE 1FDLL 5I1AA 5IBLD 4Z7QF 1MVYA 2XPYA 2G3XA 2QEJA 2AXHA 3IAPA 1N64L 4HKZB 1JV5A 3E2HC 4ACTA 1OPOA 1A6TB 2ZXCA 1X5GA 2PXYD 3EO1B 4GY4A 4JFDE 3GLZA 4R8WH 3VWJC 4IS6A 1P7BA 2VJXA 3NN8A 4ONFL 3NIDB 4QTIH 4ZXBD 1SN0A 2XWJA 1EXHA 1BV8A 4NN6C 2KZ1B 3VVWA 1WRFA 2W9DL 1OP3H 4YDLB 3KEHA 4OF0A 1VFBB 5HHME 8CGTA 2X1QA 1XEDA 4Y19B 5I8KH 1WHPA 5DHVB 1CLZL 1QBBA 1KELH 4JRYB 5L0QC 1ET8A 3BWUC 4R4BB 1JGVL 5FW6A 2FWSA 3T3MB 4UUJB 1CL7L 1JUFB 4P2RE 1WBZA 1M9SA 5DS8B 3HS9A 1X9RA 1UA3A 4OLEA 4YSCA 1OAXL 2R7EA 2CALA 3G5YB 4XNYL 3MLUL 4QWWD 5JHDE 4EN3B 4ZUSA 1TQSA 4AYSA 3MLXH 3IDNB 4R96B 1TNNA 5F9JB 5E2TH 3H54A 4L4TD 1CFNB 1AACA 1MI5A 4WUUB 1ZXKA 4X5WA 4YHOH 3O11B 1HQ4B 1JWUB 4X98A 3OF6D 1IBFA 3DPBA 4O9HL 2R2CA 4TUOB 3V5HB 1ZSDB 4HWZB 2ZX8A 3ABMB 3TWYA 1CFQB 2QSTA 3U1PA 2PTTA 1PW3A 2FK9A 2BVQB 1MWOA 1E8ZA 4PTUA 5IT2H 1HCVA 4LCYA 3O6LL 5CUSL 3TO4A 3ZZ1A 4J3VA 2PWHA 1G6RH 1S7WB 3SKNA 1IGCH 3WMQA 3MRKB 3PDGA 1MHPH 3O2VL 4YDZA 2XPGB 3KLKA 4GAYB 4M93B 1KXVC 4C54A 5I75C 3G08A 1XIWB 2NY4C 4FA7B 2O6EA 1ZWIA 3CGTA 3L3HA 5IHZB 1KJVA 1MF2L 4B5ZA 1TJHH 3F00A 4ZW7A 4YBQC 3PPSA 2PTTB 3C87A 1AXTH 1U6AL 5E6SB 2VSCA 3K81A 3A24A 2K8MA 5E1AB 3K1DA 2WPGA 1NGQL 2W0KA 3PDOB 4HK3N 4LEEA 3N2JA 1HWGB 2DEWX 4PUBL 4ZMVA 1ETB1 4PJIF 5DK2A 2BSTB 3QK0A 1U91A 4PJBB 1AKJB 1MRFH 5C92A 1JAEA 3DHPA 5LAXA 1JD7A 1RZFL 4UYPA 2CR3A 1L7IL 3NH7L 4Y2OB 1INEH 5HYSB 4E9SA 4PGZA 2MOGA 1N6VA 1M1XB 1BQHB 1QR1B 1XIWA 1QRNB 2VDKH 4NZRL 1N0XH 4LPXA 5CJOH 5AD0B 3SEPA 5D7JA 4E0RB 3P4NA 3VYPA 3DRQA 2IQ9L 1A9EA 3R1GH 1ZLSH 3DURA 4HIXH 4GP8B 5ANHA 2FX8L 1E7UA 2RAMA 3KYKH 4GUCA 2A0LD 4MXWL 5E08L 4GW4B 3VXNA 3VG0H 1CE1L 5IW6B 5C86A 1PKQB 2CXGA 2IMMA 1IAKA 4CAGA 4KNTA 3A5VA 3BC9A 2NYKA 4XAKD 3V52H 1EXUB 1KSRA 4GG6B 4U3SB 4I3SH 2XPZA 3GLAA 4OLVL 5EIQA 2IPTL 3N55A 4YVNA 5JIPA 2Y7QB 1FL3A 1OARL 1ZD6A 1DBAH 2Y07H 2VTFA 4PRBA 3OQRA 4NO5A 4PJXA 3VVVA 3WS6A 4BXVA 3H3PL 4UT9A 4XC1H 4JM0A 3OLGA 4WO4A 4UT9H 4GKNB 2VDML 3E8UL 4HW6A 5A2KH 4BHUA 1J87A 3ZTNL 5FGSA 1I1AC 3CLFL 4KWUA 3O6FA 1GOHA 5HJDA 1MQ8A 4JDEB 4ZS6D 1PD6A 2FBJL 5LGJB 3V6ZA 5J3HD 5GGRA 1A7OH 3NFPB 4IOIB 4UCFA 2R51A 1FYHB 2JJSC 1FFRA 4R8WL 3MLPA 4Z76B 4OU3A 2IDSA 1UA7A 5CKGA 4H8HA 3VXUD 1QAWA 3GBNL 4WWOA 1KLFB 2I5YH 2CO6A 1SJVA 4G9FD 3QUYA 2PF6A 1JGUL 2JKSA 5DK0A 3AXHA 5E23A 1N12A 3U46A 4LLDB 4L1SA 3W39B 3CSFA 3PWNB 3QJFA 1IBYA 2AQ3A 1DBML 1IC4L 3LS5L 3RKDC 2DIBA 1ACYL 2FLBT 3MJ7A 3NIDF 4Q2ZB 4Z78A 1FUNA 3HC0B 4RWYH 3TA3A 4TULL 3ZOAA 1CFSA 4JFHD 1JGDB 4HJSA 1A7RH 2X1XR 5F89A 2R27A 3BXNB 5AENA 1Y1UA 1A8ZA 3BDXA 2V2TA 5G55A 1QTYT 2FLRT 5M95B 2UZIL 3SE4A 1G7LA 3D4GA 3A47A 4OTXH 4YX2H 5DMGD 5DSCB 2AXJA 1WIOA 1NCBH 4LE8A 1KB5A 2KI6A 5DFVC 4LVHB 3U9UA 2EUWA 3UBXA 1SGKA 3FB6A 1BJ1H 1AR1D 1AD0A 4MD5B 3NCYS 4WGVB 3MNDA 4NENB 2F5AH 5CEXA 4YFEA 3NDZE 3QDGD 1MCBA 4DAGL 5DVPA 2PYEB 1B0GA 3SGKC 3AG2B 3L5XL 3PCYA 3RL1B 5L7XH 5EUKA 2JIXB 1B2WL 3CV5A 2CDFA 3ILQD 3QQ9D 1OOAA 4NGHH 1NDGA 2QGDA 3HMXA 3NCFB 4AQEB 1H8OA 2YSTA 3TO2A 1ACCA 1BAFH 5FO8A 2DQTL 2HTKD 2UXFA 4QHNA 4OSUL 4LLYB 3WEAA 3L3DA 3KWVA 3H9HB 3MBEA 4QXTB 1ZLDA 2CKNA 3AAZA 3FFCD 5EZIH 5ENWB 5JOPE 2P8LB 3KZ8A 1L9MA 4IKJA 4JUSA 5LNEA 4MJHA 3IJEB 3S0PA 4PGDA 2ROXA 3DX7A 2K8QA 3DO3A 4TNEA 4X42A 5IMLB 4TPRH 3H4FA 3VFRA 2IEPA 4QLWA 1GGCH 1GGTA 3HPJA 3AACA 4QRSA 5EC2A 3SQRA 2C4FU 5EUOF 5KVEL 4JFEE 1NKOA 5FDYA 2OZ4L 5TDOA 3C60C 1H15A 2H6PA 1KIUA 2QGBA 2XTJB 4MAYD 3GK8L 1CDUA 3D2TA 3KWUA 4H0GA 4S2SB 1PG7X 3C6LB 2X9XA 4PUBH 2W8CA 2QSCH 3UC0L 4J8RB 3SBWA 2HX8A 3JWNE 1HL8A 4NQVA 4TOYH 4BFFA 1W9XA 1V8HA 2XTJE 5CLYA 5D71L 4OF7A 4YWGH 1Y6MR 4KRLB 1NFKA 4XNUL 3MACL 4LHUG 2FX9L 4IRSA 1KPRA 5J3HC 2Q8AH 4HPHA 3SJVD 2VLLA 3U36A 1FZMB 4XXDA 4H8WC 4LBEA 2RBLA 5T1LB 5L0QB 3Q3GB 3D0VB 2XVKA 4N8UA 2Z1KA 4L8SC 4U6YA 5GGVL 4L8BB 3SDXF 5CUSH 1THAA 5F3FA 1J1OL 1KN4L 2BOCB 1TQCB 4JRYE 4M62L 1YMMB 3V9FA 3BQUC 1P69B 4E9YA 2Q8BL 5E2WH 4JY4A 1MELA 3CMOL 1Z0MA 3VFOA 3S2AA 4F8NA 1AQHA 1HCFX 2UWEA 2E7DA 1KTCA 4LVEA 3DRTA 3EGXB 3F05A 1QLRB 3FBQA 3HI1A 3MMEB 4X8JA 2ATKB 2PYEE 2VLLB 5C9KA 3HUJA 1TFPA 3POHA 1Z66A 3RWCB 5SWZB 4L23A 4PR5A 2O30A 3NZSA 1ZHNB 5DK3A 3PXHA 2H2PC 2FH8A 5EIIA 3DHMA 2W80C 4F9PA 1S5HA 3LIZL 4HHGA 2NTFB 3EW3B 3FBKA 3QR2A 2D3VA 2AJ3A 3VRLE 5J6GB 3F7RA 1V3LA 1CJYA 1SEQL 4NT6A 3QDJD 1LO0H 4NQCB 1Z7JA 3ZO9A 2BSSA 3Q48A 4OKDA 1QOKA 2HT3D 4KTEL 2V37A 1CGUA 1I8KA 2VJ8A 4ONGL 4QHUA 5LAXB 4WI9A 1SYVB 3HB3D 4LPVA 4OD2A 2KYIA 3NVQA 4AUJA 3DJSA 3RWJB 4FXTA 3GSNB 1CGXA 1U3HA 1CGSH 4YDVA 4JN2B 1XGTA 2OR8A 4X7SL 3LH2H 1SRDA 2Q3ZA 2YOAA 3NJVA 4RGMC 4IU2A 4P23C 4DO6A 4NWTH 2YKLH 4ODSL 1NA8A 4NFDA 3WNLA 1RMFH 4NEHB 5C3IA 5FM5O 2HVJB 3GXPA 3VWKB 5IMMA 4Z8FL 1JTPA 5CMAA 1GHFL 4XC3L 2K9FB 2V4LA 3V10A 3K1KC 3VXSE 2VN7A 4KOBA 4FYTA 4DETA 4YDJB 2MCPL 4PY8J 1KTKE 3T1WA 2DBLL 2ZOKB 2EIMB 1ZHNA 1N9PA 4OJFL 4NAQA 2EACA 3NFSH 1I3GL 2VUYA 3HS0C 4QRPD 1FNFA 4FQIL 1F18A 4QHMA 3T8XB 3QIUB 1EFXA 3AB0C 5DRNA 4WIQA 3Q1SH 5DVKA 5D5MB 1IB5A 4BQBA 4KZDL 4J5VA 3HC3L 4K7PH 2EDYA 5FUOL 4XWOD 3UH8A 2O5YL 4LSPH 1UKQA 5I74B 1ZIBA 1IC7L 1ORSA 1JPTH 1AC6A 1OB1B 3AREB 5FC9A 3HS8A 4GI6A 3MRGB 3W9DA 4L8SA 1T7XA 4PLKC 3RIAF 4O02A 2QZQA 4LBEB 2V7HB 2Q7YB 4NZTH 4DP8X 3FQ4A 1SOSA 4PJ7F 1NCAH 4AM0A 5TQ2L 3D39B 3FO0L 2BFVH 4JFEA 1KDIA 3MLSH 1FO0A 2AV7B 3QWOB 1EHKB 3FU9A 2N4IA 4OT1H 4PBWD 3E1F1 3S9DB 3NEXA 1CDCA 4NJAH 3TA3D 4Q6IC 3ZUNC 9CGTA 5IROD 1G9MC 4Y19A 1SN5A 1E4XL 2OA9A 1EEYA 3O9WD 4BFKA 5ISZE 3FW6A 2BSCA 2DW5A 3SO5A 3BRFA 3IKKA 1XD0A 2W5PA 3LKPB 1RHHA 4ELKB 3GSXA 5TTRA 2WKOA 3F12A 4MS6A 4NO2A 5J6SA 4BFIB 3VQLA 5F7EH 1TU2A 2W60B 3UTTA 2AS5M 3L08A 3QA3A 2KH2B 2VERN 3TVMB 1MZZA 3LMJH 3P40A 1BQSA 1DL7L 4JG1L 5HDRA 4G8FA 2FO8A 3LV3A 2VLKB 5ID0B 5DZPA 4BD4A 4GW1A 3KG5A 2NLJB 4XODA 5C0GB 3U6RA 1JPGA 4M6NH 5HVHC 1FVDA 4UQ3B 4X83A 3T9WA 3ZE0F 5HDOA 5KS9B 5EUKB 1ZA6B 1IBBA 4RAVA 4F33A 5K9OB 4TVPL 1E0OB 2ZKXA 3FFCB 1OP5H 1QFWI 4Y89A 4ZOAA 4LSTH 1IGMH 5IVZB 3P3RA 1EJOL 1KBWA 5FO7B 4NFBA 4GRLB 4H8QA 1XGQA 4XHJD 2CMRH 1HCYA 2P26A 5E2VH 1JCKA 3X3GH 5A2JH 1GYVA 5I2IB 2QQKH 3DJ9A 3W38A 5AAMC 1J5OH 1K4CB 1LXMA 4HD9A 4YC2B 5EZLA 5IY5B 4YBLB 1I4FA 4N0FA 5FEBA 4ZX6A 2XWEA 3LN4B 2XQBL 4XN5A 3G08B 4RIRA 5D71H 2Z3FA 4YWGL 4B9ZA 1FZJB 1CGSL 3KLDA 3CX2A 4IYKA 2RGSA 5AYUH 1D6EA 4XCNB 3UP1A 4HUWA 3WLBA 5IK3B 2RHEA 1BM3H 2L0DA 4N2IA 1NEUA 1I9IH 1UKSA 4R2GD 4JBSA 4APQB 2F8IA 1WZ1H 3NJMA 4ZW8A 1EO8H 2P1YA 3HVNA 2FR4B 1YJDC 3LQAC 1UH3A 3H8NA 5BXFB 1MEXH 1DJZA 4ZMNA 2PR4H 5SWSD 3MUJA 2ORBL 4Y4KA 3SB3A 4ZK8A 1OGTA 2ZXAA 3QRBA 4EAEA 4NLAA 4WVRA 5F7AA 5GGRB 1A6ZA 3F6LA 3BUPA 3FONA 3EJUA 3M86A 1G7MB 3EOBB 3Q5TA 2GSIA 1M9WA 1RIHH 3O0RL 5I9QC 5KYXB 5EF3A 2HMIC 1TU2B 3UTTB 2OR7A 2V5TA 4YL4A 4TUUA 3RWDB 4DEPB 3PU7A 3IDIB 1HL5A 3RQ3A 4YZFE 2AK1L 1SBSH 3DX4A 3WEMA 2BP0B 3PQYA 2LT9A 5D7KE 5ID1A 5DS8A 3T0EC 1JPSL 3D1MC 4UUJA 1QSFD 1T4KB 3SPCA 5C0AE 1SUHA 2A6IB 2XVBA 4G8EB 4YPGA 3ORJA 1G84A 1Z5HA 3LIZA 4JPKL 3KYNB 3EZ8A 4WGKA 1MOEA 2JJTA 3CJJA 5AW8B 3N04A 5DO2C 1J0KA 5KEZA 1I7ZB 5KANG 4U1JA 4PJIA 3QCTH 1J9RA 1NBQA 1H5BB 2VO5A 4GG8A 4LPUA 4NC1C 2YWZA 5FGCE 1VCBC 3VXQB 4ALAC 3JQOB 3X14A 4U6VL 5F88B 1T89A 3GS4A 5FAAA 5D2LE 1HEZB 4OV6F 3S5ZA 4OH2A 3E0GA 3GMRB 5J1TC 4M1CD 5E7FA 4HYTB 4EDWL 4KV5F 2FX8H 1SDDA 5E5MB 2MCPH 3VGAC 3LKSA 4TNWK 1NUNB 3OPUA 4KH2A 4ZMYA 4N0UE 2DQDH 3BT2H 1PNDA 1PQZA 3GSNL 4I1PA 3HE7D 4HJJH 3PHAA 5BRPA 2CDGA 2JSFA 2K6WA 2WXGA 4JGUA 5DQJB 3T5WA 2BWQA 5IHZA 4NSKB 5EHFA 4BH7B 4PJAA 3RGVB 3OG6B 1JFQL 2R0ZL 1OAKL 5IHWA 2E59A 4V1DB 1MHCA 2XJLA 3ULUE 2A9DA 1I8UA 1X5XA 2NNXA 4DJMA 2Q1EA 1OGAA 1ETZA 1FNGB 2UYLB 4WI7A 2QJDA 4W4OC 1BZ9B 2VDQL 3RDTB 5DJCA 4NPYA 2WLMA 1EDHA 4L4TB 2EXYC 4NFCA 3SGEI 2XFXB 3MLVH 1KJ2H 5E1QA 2WYTA 4HETA 5CJXA 3IXAA 4ZQKB 3FTXA 3ATDA 3DTXA 4K9EC 4U1IB 3A6BH 5F1NA 1DE4B 3L9BA 5EEZA 2Z91A 3FFCE 2DS4A 1MLCA 2XVGA 1U8PB 1BD2A 2EH7H 5HHNA 3MFFA 4UILH 1FGVH 1HXYB 2YRLA 4JCMA 4DGUA 3QJQB 5EA0H 2A9CA 4HISA 3D4ZA 2E0PA 2NR6A 4NQCA 5HJ3A 3UIZA 5KG9B 1ACYH 4LSRL 5T5FH 5CD5D 1H3WM 1OCCB 3QXVA 3MRIA 3IGFA 1FGNH 4NCDA 3DBXB 2Y9RT 4G80A 5DJ0A 5F2FA 5TGBA 5I71C 4TQPA 5FECB 3FFOA 3TASA 4HH9B 3BMVA 4FABH 3VI4F 1LDSA 5DMIH 2R9HD 2VZUA 1U8CA 4XCCH 4YNYA 4HU8A 1U8MA 1FVCA 1I3VA 1RZFH 1WIPA 3Q1EA 4JGJA 3QI9A 3V0FA 4OIBA 2VO8A 3PHOA 4LLYA 4RX4A 4N20A 2QMJA 3AWEA 2JJTC 4YHIB 3CBRA 3TEXA 1AY1L 5JPMB 3DO7A 4DKEH 3T0DA 2BJML 1RERA 4HKJA 1EDYA 4IKIA 1OE1A 2CAKA 1E3FA 4JAMA 1LEGB 2FEDC 2WGXA 2BVEA 4WHTB 1WT5C 1AQ8A 5IB3B 3O6KL 2ZG1A 5CIPH 5GSRB 1VPOL 4PYHA 3HG1B 4PMEA 5EEWA 1DSWA 5C0NC 1G6VK 1S7QB 1WFNA 2O5ZL 1FFTB 1TZIB 5IWLA 1FLRH 3V8OA 4XBGB 2Z7UA 3GSUB 3HZYB 4XXDB 1CZ8H 5TPWH 4NM4H 4XCYA 1AYOA 2UZYB 4FCHA 3HB3C 4I3SL 2XQYA 2C9QA 2GABA 4D3CL 3TBWA 2K3TA 3HKFA 1UXSB 3B1UA 1EHXA 1AY1H 4HBQA 3KWWB 1J5OL 4OZ4B 4JDVB 4KDTC 4PGJA 3PE9A 2B9AA 4TRPL 1YNLH 5E9DA 1CFSB 3WIHL 4E5XA 3HN8A 4X99B 1J0ZA 2P5WE 1U8HA 3LKRB 1G0DA 2WW8A 2ZG2A 3LNIA 5E6UB 1KBGL 4W1TA 4AH2A 4YDLC 2QQNH 2VLRE 2GT9A 4X4XB 2DLTA 4UNIA 2KBGA 4A38A 3DUUB 2V9RA 5EA0L 1A0QH 2I27N 3RWFB 5KW9L 5KJ4A 1GAFH 1ZSHA 2J55A 2VL5A 2BVOA 3P77A 3IKCB 1DL7H 1RUPH 1AGFB 1T83A 3FTGA 2XOTA 1MFEH 2MJWA 1DEEB 2I24N 1KBKA 3GINA 3Q9QA 5FPIA 2VM9A 3D25B 4YSQA 5L4IA 5D6CB 3RIKA 1I8IB 2JIXD 1DBJH 3GGWB 5FCUH 1AXTL 1HINL 1SHWA 2R8SH 4PJ8C 2WKOF 4XBEH 4Z7WA 1HYSD 2X38A 3TXAA 3SQBB 3VNZA 4C8XA 2VDPH 2Q87A 1JHTB 4WU7A 2NR6C 3UTQA 1NLBL 4NKIH 3NFNB 5D93B 5JTWA 5JW3H 5DEFB 3UDWC 3ARSA 1DDHA 1E90A 1JE6A 1HI6B 1Z9NA 2VLJE 1JHKL 3ZL4L 2EVFA 3DETD 4ZUWA 5CN2A 3VYNA 3OAUH 4EXKA 2QV4A 1WAAE 2NRDA 4TVSa 1XAKA 1UUSA 4P3CH 4J3SA 1E28A 2XLLA 4WNSA 1XCTA 4AMWA 3N40F 3C60D 5AZ2H 4JK0D 4HH9A 4PJBE 5E1GA 1CQKA 1YPZF 4B60A 3UJTL 4WW1A 4NZDA 1AGEB 2OMTA 1A9EB 1VESA 3GNML 2Z7WA 1MHEB 2BK8A 3HTLX 4C83A 1BMZA 1U8KA 4R97C 4LLDA 3PDDA 4Q89A 5F7DB 2DEYX 3LKQA 4N0YL 1OIOA 4AYFB 1W80A 4PJIB 4W9CC 5JA8B 3HUJB 3LQZB 3CHQA 1P2CB 1Q72H 2P7TA 3ARDD 4L5FL 4WNQB 1MN4A 2HTKC 3EO9L 4GJTB 2B59B 1RJZB 2F1AA 3CPUA 4NQDE 1MJUH 1ZHLB 1PG7W 2ICEA 2VABB 3O6FC 2EICA 3LRHA 3PDOA 4W4NA 3KD4A 1K5WA 2QL1A 1WITA 2XIDA 3PAZA 2YMOA 2G5RA 1TXKA 3S7GA 1JZ4A 3ESUF 3FT2A 2HFEB 1GSKA 4YHYC 2IDCA 3TBCA 3UCRA 2DTML 3IDIA 1PCXA 3IMUA 3QUMB 1WC7A 5HDQH 2OYPA 3CXHK 2PMZA 5F7NC 1QQDB 3OXRA 3QJUB 3S48A 4X5XA 4FYSA 4QJ4B 2DLFH 2E9WA 1CDGA 3FH5A 3K7UA 3KLQA 3P2BA 4OJDH 4RZCA 4Z95H 5EOCJ 4Y16C 2C4XA 4GRLD 5GGTL 1MFCH 2R1XA 3BPNC 4B0MM 3QAZC 2KHAA 3NIGF 5F9WC 1CD0A 3SSGA 4PB0H 1GPOL 1CURA 1CF1A 3FB5B 3CZNA 2F54B 3VW3L 2WOBA 4N6QA 1SOXA 1VIWA 3K3QA 1CU4L 3TCXA 2EABA 3QDAA 1WSST 3RWHA 4XBEL 5CJ8A 3TTYA 3IJ9A 3KEDA 1S3KL 5E6IA 2KDGA 1G9NH 2PWEA 5DDHB 5F9JA 1JTTA 2KT6A 4F7MB 4JGNA 3OV6A 1OALA 5ALBL 5DUJA 2IH3A 1HSAA 3KCPA 4DOHE 3LN4A 1ULVA 2G9HB 3M8OH 5H35B 4Y5XC 4HKXA 3BW9A 4KKBC 3U1SL 3T3PB 2X53A 4K9JA 5LQBL 1C5DA 3ESOA 3O45A 1T0MB 2RIKA 3FFDA 4LDOB 4OM0H 4Y9GA 4XNDA 3HZMA 2FYVA 1P1VA 3D3VB 1HOCA 2VDQB 4EI5B 1GC1C 2EC9T 3TVMC 3SDCB 4NDMA 4OT1L 2OAAA 1JWMB 1PD0A 4EN2A 2XWTA 2WQVA 5H8DA 5HGAA 1ERNA 4TXVB 5IFAL 3RDJA 4JZJB 5J56B 1IE4A 1VB9A 3UO1H 3BAWA 1L3NA 4N28A 1JZ7A 4K94C 1PTZA 4D9QE 4HAGA 5E8NB 1YEGL 1X5FA 4MQSB 1BFTA 5FUCC 2ICCA 3P11H 5C3TA 2HX9A 3UBFA 3P4MA 3FTVA 3MV9E 2I60H 4NZTL 4P2RD 5E8DH 2ATPB 3ROOA 1EHLH 1I85A 2V2WA 4K23H 3I50L 2W92A 3V6OE 5ABZA 4CKVX 3Q6FA 4GKSA 3MZTA 2GKIA 4L1DA 4OFQA 2JKXA 2AVFA 1MW0A 4HUCA 3FF8A 4AQ1A 1CIUA 4EQ2A 2ZXEB 1TUPA 5FXCH 3TFKD 1I9JH 4FXGB 2VXSL 2EDXA 2BNRB 5BUAA 4G8AC 4XN2A 5DI8B 5E8EA 3RI5K 3U6XA 2F53B 3MJ7B 2YR3A 3WTYA 2VQUA 4XPFH 1JWSB 4I9WD 5J6HB 1HHGA 5EU6E 2C7FA 1FV1B 1SY6H 1QABA 3FUEA 4KTEH 2K78A 5F96L 5FOBB 1SHSA 4MJ6A 4K15A 1RZ8A 3FN0L 2DWTA 5G2NA 1SJEB 2QVKA 2EEXA 1NH6A 3CHSA 3T0EA 4A7QA 1NDMA 5DVOA 1E9OB 1P7QA 2AQRA 1HKLL 4PHXA 1EEZB 2BXYA 5AB2A 3RYMA 1I9EA 3HMWL 3RJQB 2AJSL 5FYJL 1IZKA 3VW3H 3QYCA 2BSEA 3A6CL 1NANI 4FNQA 2NY7L 4L3EA 4MXQD 3MU3A 4NJAL 1D5IL 4P5SA 2B08A 5B39A 4ODXA 3ARBD 1FORL 5FW8A 2DQCL 1EEQA 1XF2B 3PAUA 3D30A 4G8EA 3SJVB 4LRIA 2H5UA 3BPNB 3BH8B 2VIRB 1T89C 4BGDA 2VAJA 4M61B 4RQQB 5AVWB 2XWJB 4QT5B 2AANA 3GZQA 1HWHB 3FXIC 1XB3A 3MLWL 1C5CH 1FNEB 2WWNA 2ZTBA 3IU3B 3GKWH 3U4BL 3ZHKA 1U8OB 4EI0A 2YPLD 1WQVT 3RY4A 4HJIA 4YHML 3BWUF 5GZOD 4I0PC 2V5YA 1N70A 3UZEC 2F7PA 4UIMA 3IN0A 3WNJA 1YNTB 2CWRA 2F53D 3WXVL 4HOXA 1B4LA 4HV8A 3VM5A 3DRQB 2XKSA 3Q6FB 1J0YA 3G5XA 5IFHH 3CBKB 3MRLB 5TK4A 3HC3H 1A64A 3HHSA 3E6FA 3IGLA 3OKDB 1QFWH 4YHZH 4CMMA 1BM7A 2DYRB 4JRLA 2X7LB 2C4FT 3ULVL 3HMXL 2DWEB 3DLQR 1QZNA 4JPQA 3HNSL 1V05A 1FPTH 4K5MA 4E42A 2EDQA 3WJLC 2J56A 1FP5A 2K4WA 4AMXA 2EUZA 2RH0A 4PRDA 3U2SA 2J2ZA 3ZT7A 3UYOD 2Q86A 1D6EB 1NLDH 4HEME 4ZYKB 1BQHA 1QR1A 3BKJH 3GSNA 3NSCA 4FQPA 1IRAY 4W4OA 3ZKXC 2JKWA 4H1LB 4GXUN 2HRHA 4RA0C 1PL3A 3JWOH 4YHNA 4M7ZB 4GG6F 1YYLH 2DQIL 2BSTA 5I6OA 5IF0A 2X41A 4GMTL 4YOKA 3RNKB 3EGSA 1KCVH 5IB5A 3OZ9H 4FFZL 2VR8A 4U7SA 4A2GA 2V17L 4FQJH 2PXYC 2CO1A 4UT7L 4GBXC 2ADJA 5LQBH 1BZOA 3I9IA 3OKMA 4GAFB 4GH7B 1OSPL 3RTQA 3QUKB 1FV1A 4I89A 2WO3B 3HE7C 4PJAE 1GR7A 1S7WA 3SKNB 3IPEA 1HEJC 3GB7B 4W81A 4WWKC 3S8GB 1QX1A 1D6VH 5I73B 4OCSH 2CGRL 2FT6A 4BIKA 1RH8A 3RY5A 1E9QB 1L9SA 3CFIC 4MXWH 5KYYB 3TYGH 2Y5TA 3H56A 2Y7MA 2UWEE 2COQA 4HHAA 4HSAC 4X6EB 3FB7B 3P3SA 2EE3A 5B3JE 1SBSL 1A7QL 3MGOB 3X1NA 4ETQA 5D1ZA 4PM1A 3TT3H 1N2RB 4JGMA 4B7IA 3NAAL 3EDEA 1ORQA 3MNVB 3N41F 3S88H 1DVXA 5BNXD 5AFAA 2A74B 4OLZL 4XCFH 3WFBH 2NY0D 4MHHI 1AGBB 2PCYA 4MNQE 4TL5A 1ASQA 4WU5B 12E8L 2XZQL 1GCYA 3WN6A 5MI0C 5ADPH 4PSPA 2LU7A 5TH2A 1R75A 2B59A 3O4LB 2HWZH 4AQ8C 2FQFA 3FZUC 2WWOA 2AQTA 1X7SA 4HD5A 3SDDC 4BZ1A 4H40A 2B14A 3TEZA 3MPCA 1CZ8L 5BV7L 4GSDL 3I02A 3BP7B 1MNUL 2IADB 4WFHE 1XF3A 2JB6A 2W07B 4OCNC 4ANWA 4ODHL 4HOWA 3DXAA 1T66C 2PUQT 3IPFA 3TLRA 4UANA 1SJEA 1RUKL 1AGBA 4YSEA 1CGYA 2CA3A 1BEYL 4J28A 4WLCA 3NG5A 5EC1B 2VAAA 3CWGA 3UPRB 1BZ7A 3D39E 4MJ4A 2F74B 3K71A 2BHUA 3DSNA 3EO1A 1OSZA 1T0PB 3FQNB 3MGOA 4NNYA 4M5ZL 4ETQB 4OLXL 1F0LA 1X4ZA 3FB5A 3F6IA 3QIWA 1U93B 3KPRA 4QUOA 3WKMH 2KMWA 3RL1A 4HMEA 4NQXB 5E8OA 2OMWA 4YPJA 3AROA 3EDKA 1SOQA 2Z34A 5KVGH 1VACA 5DURB 3GMNB 4JO1L 5B1BB 1SMDA 4R2GC 5DUPL 1FNSH 3ZKXB 3GHBL 1FL5A 4QXVA 2FSDA 4NGHL 4X80L 4XI5C 4LPCA 2YA2A 1JN6A 2FO4B 1UVQB 1KPUB 3C9NB 2O6DA 1KY6A 3QHFH 1N8OE 2HVKB 5TQ0L 4IOFD 4LMQE 1AGFA 4RSYA 4G3YH 4UV4H 5D96C 1JYWA 1JP5A 3TCLB 4ZI8A 3NGBC 4GLRH 3WEXA 3QEGH 4HKBA 5I8OL 1W0WA 3SO3B 5DD0H 3UAAA 4G1MB 4OCRL 3RTQC 3FUIA 3TIEB 5LGKA 1LWHA 4D0BB 3UOAB 5D7IA 3KJ4C 3KBFA 1SLVA 5F0PB 2WUBL 3T09A 5CO1A 2X4NB 3IGUA 3QZWA 4CDHA 3RVXC 1JK8A 2K45A 1P84J 1AP2B 3V4PL 1MCHA 1RZGB 2EO1A 3HE7B 3RUGB 3K2UH 3LKRA 4UT6A 3QDHA 4MAYA 1KTLA 5EF1A 2X12A 5DTFA 1L0PA 1LM8V 2CHNA 2J2ZB 4DP7X 3CVHB 3LEYH 4QCIA 5I0ZA 1AO7D 3V9CA 3DXAD 5DWUL 1D5IH 3V0JA 5C0BA 4BZYA 2R2EB 2EP6A 3MC0A 3QBTB 1FJ1B 2BFVL 1UD6A 1MG3C 4GUPA 2A6JA 4GW5A 4X8CA 4HFWA 4P9ML 1W91A 2NQDA 3IWUA 2Z93B 2VW6A 5JIIA 1QLRA 4X8JB 4LLQB 1NBZB 4I18C 4HOMA 1L6PA 4YHOL 5C09A 4K8RH 1W8OA 4QOKB 4WEBL 3SD5A 4IGBC 1TQVA 2FBRA 5IIEB 5K69A 5E9AA 1FCGA 3HLAB 4FNUA 2DWSA 4LCIH 3Q6GL 4PRNB 5E4EC 5FCSH 1VZGA 1DQKA 3BOVA 3QNYB