2PPDA

Oxidized h145a mutant of afnir bound to nitric oxide
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWAVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Stable copper-nitrosyl formation by nitrite reductase in either oxidation state
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 89
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2007-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ppdA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ppdA02
3PAUA 1J9QA 2AFNA 1NPJA 1FWXA 2DYRB 2QT6A 4BWWA 3AG2B 2FQEA 2WO3B 2XUWA 2YAOA 3T6ZA 1BYPA 5I6LA 3KW8A 5B1AB 1ZDQA 3ABGA 1GW0A 3NJHA 3RYMA 2PLTA 1XB6A 2PPCA 3WKQA 2FJSA 1OV8A 2FT6A 2XWZA 1JZFA 1AZRA 2IH8A 4GY4A 1TU2A 1AQ8A 1ETJA 5I5IA 1PZCA 3DIVA 2Y1AA 1HFUA 1GR7A 1RZQA 3QJRB 2IDSA 4QLWA 5I6OA 3NYKA 3CVBA 3SQRA 4GP4B 2QDWA 1A8ZA 3FT0A 5B7FA 1AS7A 2BZ7A 3NJMA 1L9TA 1JZHA 4NAJA 4G72B 1AACA 3NJGA 4P5RA 1ASPA 3NJIA 3TU6A 2XXGA 2VSKB 5B7EA 1MZYA 3QJVB 3FU9A 2CUAA 3S8GB 1E65A 2I7OA 3FQ2A 3PAVA 2J55A 1W6WA 2NRDA 2I7SA 1L9SA 1PF3A 1SF5A 3SBQA 4YSQA 3CVCA 1ZIBA 4HAKA 2FQDA 1WS8A 1N68A 1OCCB 1PMYA 2XU9A 5B7MA 2TSBA 2PPFA 1E30A 4ZK8A 4QKTA 1ADWA 1ZPUA 2PCYA 4UANA 1AZBA 1SFDA 1WA2X 2X88A 3FPXA 3AY2A 1PY0A 4BXVA 5F7BA 1XB8A 1OF0A 2P80D 2YAFA 3WKPA 4F2EA 1J9TA 1GS8A 1ILUA 2A3TA 2JFCA 3ZDWA 3C75A 1OOWA 5B1JA 2Y69B 1KV7A 3FS9A 3JT2A 2W88A 4TXVB 3OM3B 2FQGA 1AAJA 1ET7A 3T6WA 3AZUA 2CJ3A 1KGYE 4P5SA 2HX8A 3NJLA 4F7KA 2VSMB 6PCYA 4NB7A 2PP8A 1L9PA 3PXLA 4A2GA 3WNIA 4DPAX 1X9RA 4BDVA 3OMNB 2EIMB 1M56B 3JTBA 2QPDB 3NJKA 1PNDA 1ZIAA 4E9YA 1GY1A 2BP8A 5AKRA 2JKWA 1E5YA 3ASOB 3H4FA 3BQVA 1AIZA 1A4BA 3FSVA 1F56A 2HZHA 1V54B 4HALA 3EH5B 1W6LA 2BO0A 2CALA 3UAEA 4G70B 4AKOA 4N8UA 2GI0A 1XMEB 1KDJA 3QQXA 4BDVB 1SHXA 2DYSB 2QDVA 4YSSA 3CVDA 1KDIA 1MZZA 4GP5B 1XB3A 1BQKA 1NZRA 3FSAA 2B3IA 3QJSB 3UACA 4DPCX 2BP8B 2RACA 3X1NA 5F7AA 3BVDB 3KW7A 4UAHA 4YVUA 2IDTA 3AG4B 1BXAA 1JOIA 5B1BB 5I5MA 2LLNA 3CG8A 4DP5X 2IWEA 2R7EA 2XX0A 4L0PB 1V55B 1AR1B 5FC9A 2YAMA 2PP9A 2E86A 1SHWA 1OE1A 1JERA 2EIKB 2FTAA 2OCCB 3T6VA 4HHWA 2HX9A 2ZXWB 1ET8A 2XV0A 1NPNA 2VM4A 3OD3A 4KO7A 2Q5BA 1NIAA 1ET5A 3T71A 4DP6X 4N4YB 2FT8A 4A68A 2VW6A 2N0MA 3PLYA 3QPKA 3S3DB 2AZAA 3UGEA 2XVBA 4YSDA 1CUOA 1T5KA 1PLAA 2R7EB 5B1KA 2PPEA 1KCBA 2GC7C 5IY5B 1AS8A 5LDUA 4MFHA 4PCYA 2YAPA 1W8EA 4A67A 5A7EA 1ASQA 3T9WA 3CZUB 1DYZA 2DWSA 1NICA 1AANA 1OE3A 3OMIB 3GXUB 4DP9X 1HAUA 4E9RA 1PNCA 3NJNA 1BQ5A 2H5UA 4BK5C 4YSEA 5D4JA 2GC4C 2B08A 4DP8X 3ASNB 1ILSA 3FU8A 1IUZA 1NIEA 2H47C 4A2FA 4K9JA 5TK4A 2EINB 3SBRA 1WA0X 1SJMA 1PCSA 3FYEB 4DPBX 4HIPA 1PLCA 1VLXA 2YAEA 2YXVA 1UATA 2PPDA 3DKHA 3WIAA 2VMJA 3FSZA 1CYXA 3G5WA 5I28A 4F2FA 3U25A 1SF3A 2DV6A 3DTUB 4WKXA 1EHKB 1A4AA 2UX7A 2WSDA 5D4IA 3X1EA 1JZIA 1GS6X 3GDCA 1SNRA 3IN0A 3TBBA 2HXAA 3AG3B 3X1GA 1L9QA 1GY2A 5I6KA 3WI9A 3H4HA 1MDAA 4HZ1A 2YAQA 3IEAA 3PAZA 5ANHA 3CDZA 2UXFA 1L9OA 4HCIA 3WNJA 2BWIA 2HRGA 2GHZA 1KYAA 2GIMA 3UADA 1V10A 1WAEA 4JHUA 1JZGA 1PZAA 1NIBA 2Q9OA 3NJJA 4KNTA 2PPAA 2PP7A 2ZOOA 3NSCA 4JHVA 1ASOA 2CBPA 1X9UA 3NP4A 1IKOP 1CYWA 1BEXA 2UXTA 2YQBA 3FQ1A 3PPSA 1MG3C 3HEIB 2UXVA 3NSYA 2XX1A 3CDZB 4YSRA 3EH4B 1GYCA 3UAAA 2TSAA 1IBYA 3ERXA 1SFHA 4E9WA 1KCWA 4YSAA 2UXGA 2W8CA 2H3XC 4KNUA 4BWTA 1KBWA 1RZPA 3EF4A 4WTQA 4AZUA 3OQRA 1URIA 3S8FB 1OCZB 3ABMB 1J9SA 1E5ZA 4YSOA 4A66A 2OJ1A 2VW7A 2XV3A 2HX7A 1AZUA 3ZIYA 2BHFA 2QPEB 4CSZA 4HHGA 1OCRB 1KBVA 1NDTA 2FT7A 4HCGA 3V9EA 3UABA 3V9CA 4X4KA 3ABKB 4E9VA 3D12B 1N70A 2DY2A 7PAZA 4YSCA 2EILB 2GB2A 4G71B 1J5CA 3QJTB 1JVOA 3S3BB 4E9QA 2IWFA 1RCYA 5D4HA 1QNIA 4NERA 5AFAA 1CC3A 1ID2A 2AZUA 9PCYA 1RKRA 1QHQA 3HB3B 1TEGA 4RH4A 2ZWNA 2BW5A 2GBAA 4A2HA 5I6MA 4YL4A 4AX3A 2IWKA 5PCYA 4GYBA 3T6XA 1AS6A 2DWTA 5B1JC 2J56A 4Q8BA 1MG2C 8PAZA 4EF3A 4AKQA 4G7QB 1A65A 1EZLA 2HLEB 2I85A 5I6PA 2XLLA 3EH3B 1JZEA 3H56A 1TEFA 5I6NA 1YLBB 1L9RA 1GSKA 2IDQA 1FFTB 2HRHA 1WA1X 4M3HA 4DP1X 2ZONA 3X1FA 3FU7A 3PCYA 4UF7C 1E67A 1NTDA 3ZBMA 1AZCA 1JVLA 2JXMA 2CAKA 3X2QB 2GSMB 4G7RB 2IAAC 1DZ0A 1I53A 1ZDSA 3MBWB 4HCFA 4KO9A 2XV2A 3SBPA 1AOZA 1FA4A 1JXDA 3NT0A 4A2EA 2PCFA 1R1CA 1BXVA 1IBZA 4BXSV 4AI7A 4DP2X 1B3IA 1NWPA 1SDDA 7PCYA 1BAWA 4E9TA 3FU7B 1OE2A 4G7SB 3ZX1A 2WO2B 3OMAB 2BP0A 3WG7B 3NJFA 2FQFA 2IDUA 3L45A 4ENZA 3S3CB 3TASA 4YSTA 5I5JA 1CURA 2EIJB 4JKNA 2YAHA 5E9NA 4AKPA 1AG0A 2J57A 2YXWA 4DP0X 1J9RA 1BXUA 3QJUB 5TK2A 4YSPA 3FYIB 3NSDA 1AG6A 2UX6A 1PLBA 3FPYA 4YVNA 1A3ZA 3FSWA 4Q89A 4W1TA 2VM3A 1GS7A 1J5DA 1SDDB 2XXFA 2FNWA 6PAZA 2MTAA 5EHFA 3ABLB 2BP0B 4A2DA 3NSFA 3X1BA 1AZNA 5PAZA 3FQYA 4PAZA 1PAZA 1JXFA 3IN2A 2FWLB 1TKWA 3N2JA 3AG1B 3NP3A 4FA7B 3IE9A 5B3SB 4KOBA 3QJQB 1OCOB 2OV0A 5AZUA 2BW4A 3EHBB 2IDFA 1A4CA 1M57B 3GYRA 4GP8B 2XYBA 1PZBA 1BQRA 2J5WA 2X87A 1NIFA 1ZV2A 4KOCA 1HAWA 4FAAB 4BWUA 2VW4A 2AVFA 2AANA 2VN3A 4GXFA 1JZJA 1NINA 4W9ZA 2CCWA 4CSPA 2YARA 3IBOA 2BWDA 4DP7X 1IC0A 3N55A 2BZCA 2IH9A 4DP4X 1NIDA 3MX0B 4KO5A 3TA4D 3TBCA 1BYOA 1QLEB 2MRYA 1M9WA 1NWOA 4E9XA 5I26A 4M4RB 1JXGA 4KO6A 1WS7A 4E9SA 4KNSA 2P80A 4YSUA 3AW5A
chains in the Genus database with same CATH superfamily
4PD4J 4S1DD 2IANA 2WMPB 1IIIA 4DWHA 2VMFA 1DBML 4IBQA 3WTWA 4XXDA 3FQRA 2V17H 1BMGA 3L5HA 4S0HA 3HHRB 1QBLH 4MA7H 3FTXA 3ZN6A 5I1AA 3VGGA 4GPVA 3ARBB 4J3SA 3VDCA 1UGNA 4QRBA 3WGUB 1KPRB 4TUKH 3CMOH 3UYPB 3WEXB 3HG5A 1QPXA 4OLEA 1CGVA 3CXHJ 1AY1L 4WI2A 4XR8C 3L1OL 5LGKA 1NLBL 4RBPK 5IMMA 3CSYB 3BDXA 2V9QA 4GRWH 4Q0XL 3EXLA 5I6OA 3U4BL 5JTWA 3NEEA 1OB1B 3AGWA 3IGAB 4XPTL 1LO2L 4Z7AA 2EXWC 2MJWA 4TQEH 1L0XA 2WBWB 4PBWD 2EE9A 3K71A 1KXVA 3VM7A 4IYKA 1N12A 1T7XA 2NOYA 4MXQD 4J3UA 4WWNA 1FG2B 2BPBA 4KK5C 5F7WC 3T65B 1AACA 3CFEA 4N5EC 1GXEA 1XZWA 4NQTA 2C9UA 3NTCL 2GJJA 2VLJD 3P0VL 1R5VA 2RHEA 2H0FA 3CZGA 2D7MA 3KVDD 4L37A 4DUWA 3SE6A 3QS2A 4YE4H 1BJMA 1EFXD 4E41B 2XXGA 2H0PA 3QJVB 3JZYA 5EC2A 2Z31B 2FX9H 2FX7H 2ZAIA 5CKGA 1CE6A 1ORSB 2XWJA 3PWLB 4OI9A 3FQTB 5CHNA 5D2NA 5D7IB 5IM7A 2OK0H 2MTPA 3K3QA 2I7SA 5D2NE 2BNRB 2NDFA 1QHPA 5FYKH 4S2SA 5ECGA 4PW4A 1QPPA 5IMOB 2FQDA 2LR4A 4ZMPA 1Y7VA 3MRMA 2W95A 4FHKA 4IOFD 5AKVA 4RFEB 1Q9KB 2FLBT 3GNMH 2GEEA 5AUMB 2LW3A 3OR7A 1E43A 2G5BA 2ZOUA 4FLQA 4LASL 2E8ZA 5ESAB 1OF0A 1LGVA 1CLYL 5TDNB 3GSQA 3H3PL 1SZNA 3OB0H 4QRQA 4X7DC 5D1XB 3LEVL 3F6JA 4PGCB 2NX5B 1XF5A 2HWZH 2Y69B 5CJOL 3HE7D 1RZ7L 3ZYJA 3N3EA 4B9KC 3BVXA 2AQNA 4JCLA 1OALA 1SBSH 4RIRA 4RNRA 5CNHA 3UYRH 1RV6X 4PRBB 3QUYA 2FWOB 4IRSC 4N2KA 1IMHC 2I60L 2WN3A 3K81A 2H1LM 2O5ZH 5GGVH 2V8MA 1ETB1 4IDLA 3L4UA 5I73C 4OKVB 1CI5A 3U9UA 4AJWA 1A7QH 3EO0B 5DUJA 3SYCA 5FYLD 3X3GH 4BCYA 3LHPL 4XCEA 3U4AA 2BZDA 2LLLA 3BRFA 3QORC 4LRIC 3FSVA 4JFFA 4K5OA 3VFMA 1H3UA 1Q4NX 3H9SD 4JFFE 2OR9L 4QF1B 4RFNB 1S9XB 3LKQB 4KTEH 4N8UA 5MEPB 2R15A 1BQLH 1VDGA 2VLMD 1WGVA 3UTQB 2IVFC 5KYUA 4GP5B 4I4WB 4MNQA 5FA4A 4FQQB 3QCVH 1ZTXL 4UT9L 1N5AA 3QQ9C 4OF3A 5IBLD 4HZLB 3C5SB 2GY7B 3QHZL 5HDBF 4CAGA 2Z8VC 3VD2A 2XPZA 1HTYA 3SO3C 1IL1B 2AJYL 1AE6L 3QZWG 2XBTA 4TVPL 1EZSA 3MV8D 4JN1H 2F58H 5CO1A 3P4NB 3BDYL 1TTUA 5TPWL 2WKOA 1U3NA 5FKAB 4HHWA 3K2IA 5ESVB 2VC2H 4FLHA 3L1EA 4HUUA 3QUHA 4AITA 2EYTA 2MPVA 2X4NB 3ZLQC 4A04A 1VAHA 4LHUA 4M1CD 1BQHA 2B4CH 3PNWA 5IQ7L 4JO1H 4UYPA 1SHSA 2DBLH 2N0MA 3VACA 4OCYL 3KLHC 3P0YL 4UOW0 1HL4A 1T5KA 2QGCA 1K72A 5DC4B 1SXBA 1YUHA 4YGVB 2GC7C 3V0VA 1EVUA 1K6QH 1QBAA 4F8PA 4NM4H 3F7RA 3HCVB 3HUJA 3ME0B 5DRWB 5FK9A 5DVMA 3HUJE 3FCSA 5A7EA 5T3ZE 5IEKB 3FQXB 5BZWB 3S88L 3GBMH 1RAMA 3BP7A 2CQVA 2VZ3A 4PS8A 1CTNA 1OE3A 3IETA 2WQWA 1MH5A 2A9BA 1MCWM 4LNRB 5I17A 4G8EA 4WW1B 3KBEA 3RWEB 3GJEA 1I9EA 4BQCA 3TYGL 1MCOL 3F12B 4XC1L 1UWGH 2VLLB 4YHKL 3VFRA 2X4PA 4GXUM 1JVKA 1HHKB 4WUUD 2FJUB 4Q9QL 4PGJA 1NIEA 2WHVA 3QNXB 1QRKA 2EINB 4YHNA 3A3YB 3QDGE 4EUPA 3KYNB 3MLYH 4N2BA 4RFOL 3RWDA 4X6CE 4HOZA 1YZZA 4NFBA 3MRGB 4N0YH 5C0AA 5LWYL 3NEXA 3DBXA 4HAFA 2YAEA 3A24A 5C0AE 5IQOA 1GGCH 4PRAB 3O9WB 1KCUL 4PHZA 3C60C 1KBGL 1CDIA 1ZOXA 4FFWD 2DV6A 2XZCL 2F1BA 3REWA 4FFYA 5EBGA 4IEFA 4J3OF 4PJ8B 1WUNT 3AJ7A 2MQGA 5HYSA 4HBQA 3W0WE 8FABA 4L1TA 3QO1B 3ZKXC 3BPOB 2ICCA 3O4LA 4JFHD 3PJSB 3O4LE 1U6AH 3UPAA 3BQUD 4HZ1A 4LEBA 1E3ZA 4H1LH 5ACZA 4NRZA 4FQ2L 4WI9A 2ZKYA 1IEHA 1O6VA 3MJ8A 1MW2A 5D96B 3HAEA 2OMTB 3RNKA 5GS0H 4GT7A 5FO7B 4JFEB 5FKPB 1A8JH 5I75B 1BBDH 1NIBA 2Q9OA 2XZQL 2XZZA 1A3LL 4MTMA 2W91A 1DVZA 1USQA 4ZW3A 5F7HA 4BM7A 3HEIB 4HCRA 4PRID 1DE4B 4JO3H 1OF2A 2QSCL 3NZ8A 3OHXC 4TF4A 4ALAC 2AEQL 4DNLA 2DQUL 4FF9A 3UAAA 5KZCB 1IBYA 4LDEB 5BV7B 4E9WA 3N50A 5JQ6H 2ZKMX 3AROA 4NYLA 1LEGB 5TDOB 2Q1EA 1RZ8A 4HXAH 3SDXE 4ABVA 4P5TB 3RB7A 1ZTMA 2X41A 3BVUA 3DSNB 1ZEAH 3MXWH 1MAML 3OQRA 4R4FL 4AVIA 3RVVC 1HIML 3WSQH 5L4MA 3EJUA 3TLRA 4JFUA 4PWGA 3SE3A 1UCBL 3ZGIA 3F5WA 3IJSB 1R24A 3SDCA 4KUCF 3VXRE 1NGQL 4EXKA 5ADOH 1TTCA 5EEYA 3Q01A 3NBNA 1LVEA 5D2LB 1L6PA 2G60H 4OF6A 1I3GH 4N20A 3FO9B 4ORGA 2IQ9H 3AY4C 1ZCRA 1WZ1L 5E0QA 5JA8B 5JORB 4E9QA 2IWFA 2CMRL 1GPOH 4P07A 3GZOA 4HK0A 4F15B 2ESVB 5EO1B 1TQBC 4NJAL 5CZVL 4HUVA 1TEGA 2ZWNA 3PJNA 3GS7A 3WOVA 1D5ZB 3IGUA 3RWGB 2B5IC 3BC9A 1I1YA 3KL0A 3RIKA 2CO6A 2XTJD 4TKWA 4LSQL 7CGTA 1U3HC 2RQ8A 1HDMA 3KL3A 3N44F 2QKSA 3FO1A 3Q13A 1RPKA 3SE8L 4BFBD 4XI5D 3HZYB 2BSRA 1HZLA 4AK1A 2EO1A 2J1XA 4NWUH 3EH1A 5E6SB 4TNWF 1A25A 5EBLA 1BPVA 1I7ZA 3BD3A 4Z7UA 5JMRA 4QRUB 3WIHA 2G4GA 4PS7A 4EN3B 3U1SL 1MPAH 1QAWA 3DXAB 1CDGA 4JFDD 4XN1A 3CXFA 5BRZD 2NXYB 3FF7A 3RUGF 2OR8A 4XH2B 5JA9A 4L8DA 3ZDZE 4KKNA 1T6VN 2DPKA 2GSIB 2O5YH 5EZJA 1S78C 2BSBA 2JXMA 2W0LA 4KRPC 1BVNP 3VCLB 4CDGC 1H0DB 4JRYA 4JRYE 2R1WA 3U1PA 5TQ2H 4HCFA 1EUUA 2ZXQA 2ZP9A 4WWID 4FCAA 3QJFB 1GGBH 2BK8A 4NRYA 5E94B 4GIAA 2PCFA 3ZDXE 1CGUA 4QNPE 3VU1A 4WO4D 1LP9F 2X7LB 4AQ1C 7PCYA 4XNMB 4XP6H 5DRXB 3ZY7A 3ZKNC 5IEHB 3OR6B 1GZHA 4XMXA 1KB3A 4HQQH 2LFGA 1TMCB 4OLVH 5IB2A 2KKQA 4IKIA 4ZFZA 4UNVA 3FUIA 4N2MA 2VOTA 1IFHH 2YAHA 4LQFH 5I1LA 4HKXB 4MQ7B 4IGBB 4A7SA 3QJUB 1WRFA 1VERA 4IS6B 5T1MB 5IVXB 4BBWA 4GRLC 2F5BH 4F5CA 4F5CE 4NBZB 4NC2B 1KYOJ 3CZJA 2BP3A 2FE0A 1IAMA 3MGTB 3TA3C 1TNNA 3BZ4A 2CXGA 4MD4B 1F3RB 1KGXA 4KKCD 5IHHA 1HOCA 5IROC 2ZE0A 5DHVH 3N42B 4K5NA 2ISDA 3BPNB 3FO0H 3VG9B 4JZNA 1HYSD 5DUPH 4BKTC 1I9RH 5I2IA 1F90L 1WSST 1OCOB 2QKIB 1F4YH 1RP8A 2YD3A 3EJCA 4JQIA 2VAJA 5D7JD 1JV5A 5F8QC 2EAEA 3VRIA 3GDBA 1CLZL 5AW8B 3VD9A 4FQIL 4OJCA 5IQ9A 1BQRA 4X7EC 4DGWC 4Z7IA 3L9RB 1CL7H 3D4YA 2VAAA 2VW4A 3DX9A 4LLYB 1ZHBB 4XVTL 4UWQB 1NINA 3VW3L 3II3A 4RMBA 3MOBL 4S10A 3B9EA 2NW3B 1CDJA 1IQWL 3TYFA 3ZXAC 3DUSB 3O6FC 5KAQG 1S9WB 3PWJA 1MFAL 3DGGA 4UQBA 1DEEB 2OYPA 4DP7X 2Y06H 4NLHA 2ITCB 4AQEA 5F1KC 2Z65C 3W38A 2EKJA 1TQTA 1BYNA 1LO5A 4HMDA 4OZ4A 1QI4A 2HG5A 4IOIA 5SWZB 2NQCA 3P3YA 3I3DA 1QO3B 2GBVA 5AVZB 4TUOA 3EH2A 3TNMB 4BFIA 2EDEA 4U7MA 3MCKA 4M4RB 4U1NB 1TYEB 2X4QB 3EGDA 3G5VB 1EHAA 3EOYG 5BRQA 5C71A 4Y4KB 1EZUA 2YLKA 3VFTB 3MUZ1 2QT6A 3RWIA 4U0RC 5D1ZD 4TQIA 2FBOJ 3ECUA 4YC2C 3FBQA 3ETSA 5FYJE 2V7HB 1Q94B 1PG7W 3FULA 1A4KA 3GKZA 3HZMB 3ZOAA 3TEYA 4ONHA 3I85A 2F7QA 5LQBH 4NHUB 3RYMA 2VL4A 3QFJB 1GAFL 4GO9A 4XVUD 5GXBB 4UB0H 4TV3A 1NMBL 1AZRA 1N9PA 3UJJL 1TU2A 1TYRA 4KVNL 2D73A 3TN0A 5ID1B 4OLXH 3GLAA 1HFUA 4AQOA 4R2GB 3TFBA 2JF1A 4JFOB 4JUTA 4I7ZC 4QIRA 2C4FT 3GTTA 3SQRA 5J12C 3D39D 1A8ZA 3SJVA 4CC4C 2Q3XA 3OF6D 3Q6GL 1JHLL 3MMEA 4U3HA 1ZHLA 3U6RB 3D52A 3T08A 3V0AC 3GJFB 4PBDA 3JWOH 2Z7UA 4XOBA 2FZ3A 4AUUA 5HBBA 2EXSA 4QRPB 5KSAC 2P8MB 2XKNB 5E5UB 5ELIA 5B38B 3Q05A 5I1IL 1U8OA 1GOHA 4H4NA 3DYOA 4P04A 3QH3B 4RGMB 1YEFH 3FW6A 4EAEA 4PJGF 4UQ2A 4C83A 3THML 2VSKB 4G7YL 3PUUA 3QDAA 1UWEH 3RZCA 3QUML 1OCWH 2HN7B 3TBWA 1FNLA 2Y2TA 4PJDB 4CKQA 4U1SB 3ZR5A 3SODB 4G5ZL 1ZLSH 4ZTOH 2H26B 3RWJB 4A7TA 1RXLA 3ARQA 4K3EL 1SXCA 4EEEA 1MHEA 1EERB 1C5BH 1YPZA 5DTFB 2TSBA 3DI3B 2FGWH 4PWFA 3ARBD 1A6UL 1MHPL 3KM2A 1XXDC 3I9GH 2E4FA 2ENJA 1MEXH 4NBYB 5F1NB 2ENPA 3IGKA 4QY8A 1PY0A 2NR6D 1E9PA 3NIFE 4L1DA 2F2HA 3UJIH 4UAOC 3LH8A 4XB7A 3KYOA 5DQ9A 4OCWH 1F6AB 4M9PA 5IZ7A 5ISZB 3MRQB 1BAFH 4J23A 1O7DE 3K6DA 4GBXB 3OB8A 3VXMB 3FQWB 1EPFA 5GRXG 5HDQH 3S4SB 5TDPB 2FQGA 3T0EA 3T0EE 1XD0A 4S1RL 2VITB 2H41A 2EUVA 4IHBA 4DOHB 1KTLB 2OZ4A 2PXYB 4Z9KB 4LK4A 3ZHKA 4HUNB 3KPQA 5HDWA 3ZE0E 3OXRB 5I1CL 1QOKA 1RH8A 3MBEB 4NKOB 4RMWA 2JK5A 3QUKA 4HUXB 5I1JH 4E41D 2OCFD 3SDDA 2Z31D 1TJHL 2CZNA 2B2XH 1QP1A 3EOAB 1XO8A 4AY0A 1JNLH 3CD4A 4GH7B 4WJKB 3W11C 2EDKA 4N2DA 3FUHA 4XNAA 3TGXA 2BNRD 4KI5C 3G04A 1JGIA 3WHE0 1NSNH 4TOYL 3GM0A 3Q2CA 4I48A 3VX0A 4A6YL 1I8AA 2QDVA 3IDYC 3P2DA 1SYVB 4LL1A 4R90L 4EI5A 1MZZA 1N2RA 5J06A 1OAQL 4G43B 4M00A 3LRKA 1UEMA 2JCWA 4L8BB 4L1BA 3QJOA 1JZ6A 1NGZA 1I8IB 2OQJA 5F89B 5DMIL 1BXAA 5E99L 5B1BB 4OGYL 5LDSA 1DJSA 1ID5I 3CG8A 5HGHA 4MMXA 5D1XD 1F6FB 2R69L 2XWXA 4XX1G 4Y4HA 4KXAA 4YWGH 2NX5D 1UZ6E 3U7YH 1AGCA 2YPKA 7FABL 5I18L 3V52H 3GI9L 1A9BA 4JEGB 2BY0A 4R6UA 5DJ0B 2XKSA 2AAVA 4HXBH 4OCXH 1ET5A 4L29A 3WV0A 3GB7A 4N4YB 1BXXA 3FONA 5GGUB 4HBCL 4I0CC 3QPKA 1AI1L 1HKLL 4LVOC 4WEUD 1JPFA 2YEZA 4NUGL 1PLAA 3VWKA 3CFQA 1TG8A 2J8UB 1NAKL 4LCUB 1E5UI 2WUCL 1KCBA 1CWVA 1D9KC 3GSRA 4PJEE 4LSDA 1T3FB 4LBAA 2BHZA 1H6FA 5DVOA 4RSYA 3VB9A 4IHOB 2WXOA 3KPPA 4AIZB 4DEUA 5EDXA 2L04A 3MLXH 3VH8G 5ALCH 4FQXA 1UZ8A 1N0LB 2VDLB 5LUMA 3ECWA 1FLRL 5DQDL 4AYMC 2EICA 4JHWH 1JRHI 5CILH 3VFNA 4YHYB 4BK5C 2ITDB 1XCQB 4UOZA 5DEFB 2AMGA 2J72A 4ZG1A 1JGUL 2ATPA 1JNHA 2IADB 1F45A 1T0MB 2IAMA 2P3YA 4NFDA 1G9ML 2VISB 4FMFA 1Q1PA 1HHIA 5IMKB 4WNSA 1CDUA 1DVSA 3MUY1 3WNMA 3RX8A 4PJ9A 5DFWH 2ED6A 4YGAB 5ITBH 2YXVA 5ICXA 3CJJA 4IM8A 3TO2B 2CJTA 4E5XG 3FSZA 4IW4C 3LPPA 4TQPA 4PN6A 3AQDA 4OF7A 2R0KH 2JTYA 4GSRA 4WGKA 2ALAA 3E38A 1HCYA 2VIRB 2JQAA 2ED8A 2AJUH 2WSDA 4MA3B 2ZUSA 1I1FA 4PLNC 4HT1L 4A7GF 4XC3H 4AEHH 1C12B 1G7QB 1MCCA 3KNBA 3PWNA 5JHLH 4PYHA 1A6ZA 1JF5A 1GY2A 4N9GB 5KN5A 1DSFL 1XL4A 4O51A 1G6RH 4WWKA 5HP5A 3LKOA 2CCVA 2ORBH 3D85A 2IPKA 1ZANL 2NYZA 4GQPH 5DZ9A 5JMOC 1RPUA 4PQXA 2WLMA 3QIBC 2FWSA 3QZNA 4Z7VB 2OMXA 2EDJA 3BH4A 4X0KB 3BJ91 1X9UA 1YJDH 1DLHB 2UXTA 3LIZH 3HKZA 1ITCA 4XBPA 5HHQA 2WYIA 5BZZA 2FEEI 4YSRA 2QPSA 2OZNA 2Z7WA 1HKFA 4JAMA 3U6XA 5HYJE 2J6EL 3JZ7A 3KGRA 3ZR6A 5CD3A 4Y5VA 1BZ7A 1PLGL 4NDMB 3O9WD 4IJ3B 3FRPA 3IAPA 2WWOA 4ZOEA 2VQ4A 1U95A 5LB1A 3CNKA 1IFRA 3AFLA 4JCMA 1BLNA 1BVLB 2X3CA 5FIEA 1VSCA 3ABMB 4PJ8D 1J9SA 1G9NH 1JWMB 4AL8L 2N4IA 3UBXB 2F53B 4PB9L 2VR8A 3GBNH 4M6NL 1SLUA 2VZVA 3W39A 4DCQA 2ODIA 2UUDH 2MCMA 3RAJL 3VFOA 4HX1A 4PJCE 4IBYA 5F96L 4JX0A 4GAGH 3NIDB 4L8CA 3QDJA 1H3WM 4O9HL 4JL2A 1D6EA 4V2CB 1AGBA 3M8OL 3RTLA 4OV5B 3JWNH 4NN5B 4JFED 4JHAH 5ICYA 2HJLB 5BW7A 3O11B 4HP5A 3QJTB 5D4HA 4UQCA 2D9CA 3B2VL 1D2PA 1UFUA 1NCDL 2MMXA 3BN9D 4P4KB 1WWWX 4X6CF 3SY0A 4B0MM 1ICTA 3ELQA 4HUMB 2Z92B 4C54A 1QHQA 1J11A 3N9GH 3T0XA 4XPAH 2BW5A 3K72A 3E6HB 4AX3A 1G7JB 5HHNA 3KLAA 35C8H 1GTFA 1QW9A 3KDMA 3H42L 4M1GL 2AERT 5KZCD 1GYWA 3A6CH 1NUNB 1BGXH 5B1JC 1MQ8A 2J56A 4C59B 4I5BA 1KJ2L 1P53A 2A77L 2X89D 3HC4H 4G7QB 4PUBH 1EDYA 1IAII 4H7VA 4Z5RA 5TF1L 4HLEA 3BGMA 4AEIH 5J11C 3TZVB 5FLVA 4P5TD 3UXFA 4TNVK 5EPMA 5CR8A 2ZCLH 5KSVA 3MRBB 4MYWB 3IMSA 3QUXB 4Z7WA 2B14A 3FCTB 4UQ3A 5FYLH 2VB5A 2R29L 1WA1X 5FECA 3D48R 3DO3A 4Q9BA 1GA2A 4XNDA 4ONOA 3KYKH 1ZLUK 3QEQB 4XXCA 2UY6A 2W0FB 3R8BB 3APDA 1DCEA 2J25A 4A55A 1S5HB 4AXWB 3B9KB 1JVLA 4DKTA 9CGTA 1RHHA 4ODWA 4EI6A 5FUOL 3AS1A 3PV7A 2GSMB 4GAJH 4JFZL 3CFKA 1KXQE 5IF0B 1LXMA 1SEQL 4QYAA 3SBPA 1OEZW 3UEZA 1JMXA 3U30B 5C0DB 2WXRA 1GC1L 2BVTA 2MHAA 4P9ML 4YHZH 2N7BA 4LPYA 4B9FA 2EDFA 2ESVD 2R2HA 4IOFC 5EUOB 3STZA 4K3HA 2GITB 2VDPL 3MOAL 4NSKA 4WFFE 1P7KA 1IB5A 1CYGA 1TTAA 1SOXA 3NJFA 1BFVL 2DWDB 3HI6H 1K8DA 3D69B 5B39B 1I8MB 4QI3A 4O2EB 1MWAH 1Z9OA 4Q6YA 3MV7A 3SDXF 3MV7E 3AQZA 4P23C 2G2RA 5DHMC 4YNYB 2E76C 1BZ9B 3T0VA 2XQBH 1IC1A 3ROLA 1PPIA 4MJIB 2GTWA 5J4MA 1HWGB 4YVNA 3RZCB 1MNNA 2VM3A 3QUMB 1GS7A 4KKAD 3KJ6L 1CXKA 2MTAA 1IVTA 3EUUA 4X6DE 1N6UA 3C09B 5CEYA 3OXSB 3ABLB 4AGQA 3O41B 1YNTA 5TQ0H 3TCXA 4EN3D 2HUEA 3DXAD 4KQ0A 4PJIA 3NFSL 1FGVH 3Q5YA 2NXYD 4QDGA 1D6VL 3IN2A 1BFOB 1DBAH 1MHHA 3PL6B 2NNAB 3ZMRA 2ZQKA 4G82A 5GISH 3G5YA 3EHBB 3VI3E 5C0CB 4YMPA 4RGNE 1M57B 1IEBB 2DIEA 4GUPB 4TLTA 1SVBA 2A38A 4R96A 1RIVH 2EC8A 4ODTH 1WAAA 2UWEF 2W94A 5JW5B 4NNPH 2Z7ZA 1URLA 4JCWA 4XNUL 3MNVB 1KIUB 3S36H 3C6LB 2AANA 1OSZA 5DJDB 5EU7E 5EZPA 3U36A 5J6HA 5LBSA 3HE6C 3GMNA 2O93L 5IMLA 1OP3H 1XF4A 5IFAL 2XJKA 3P11L 1QA9A 4DKEL 4N3TA 1CU4L 4UIMB 4JS7A 4IGBD 3MLRL 3QDMB 1EXUA 1FVEB 1JPEA 2PWDA 3MRFB 4CMHB 4DVRH 3ARFB 1PIGA 2GK0A 1F41A 4LSTH 2BCKA 5I26A 4KDTA 2HFGL 5LO7A 1J10A 4FFZH 3BT2H 1U58A 3F2LA 3FFCE 3VRLE 2VXTL 3AW5A 3FRUA 1AC0A 4LEXH 4HJ0D 4I0PA 3IPEA 1FWXA 4BWWA 3PP3H 3IVKA 3ROOA 5IVZA 1OP9A 3KPOA 1KOAA 5TE4L 4FG4A 3JQOB 3WJJC 3AU1B 3KW8A 3E3QC 3JXAA 3N04A 5DRZB 3ZDXF 1OGAB 4HPYL 4QNPF 2PLTA 3ZL4H 4B27A 1FGNH 5I8OH 1OV8A 4M7JL 3BZDA 4KY1H 4GRMB 4KHXH 3GLEA 2B7DT 1KG0B 2YLHA 5AYTA 2IDSA 5CAYB 5FYKU 1JZ7A 3P4OB 4KJQD 2E9WA 1T83C 1KJMB 2PMZA 3CCHA 1VCAA 3DMMC 4G7VH 3IGLA 4X4YB 3OSKA 4PJAA 2FGZA 2WLLB 1BF2A 4PJAE 1U8KA 4RBPH 2X4SB 4LL4A 4RRPA 4HUWA 3B56A 4J6RH 3WE6B 1PKQE 3BP4B 3FUFA 4HGWA 3AMLA 5DEZA 1MHCB 1HH9A 5SWZD 3MRIB 1MIML 1UYWH 1KBBA 4OCSL 3ARGC 1WK0A 3CK0L 1EK3A 2H8PB 5E8EA 4NRXB 1IEAA 4Y4KD 2YPVL 4HS3B 5AVUB 3STBA 1KIPA 3FCUB 2VYRE 4GT0A 4XTRC 5DEGB 3OKMA 1ODUA 3M86A 4X6BA 3S4SG 3RIAK 1X6LA 1ZE3C 1RJZB 5EOTA 3DX6A 4HHAA 4OCLC 5E6IB 4RCAA 3JVGC 2PCYA 2WWKO 2CHWA 2JKLA 2FD6H 3OJ2C 3QFJD 4QRRA 2WSPA 4TRPH 4Z0BL 1JF1A 1OKEA 5M7QA 5MERA 1G9HA 2GCYB 4JPQA 3ZE2B 1XB8A 2CSPA 2VLRB 3IJHB 5G55A 3BQUC 5L2JB 2XA3A 4DN3L 4ES9A 4KTYA 2PNDA 3POHA 3VGBA 3C75A 4ZFOL 2ZNWA 1ZS2A 4N2GA 4R2GD 5L7XH 5DYOB 2R2EB 2C1OB 3BEVB 4RDQF 1R0AH 3AZUA 3DJRA 3SCMC 4QEGA 3L3HB 1CI3M 2JMRA 1LP9A 3U4KA 3L5XH 3SOTA 5GZOD 4RWYL 1OAJA 2BJML 3BN3B 43CAB 4QRPD 3WXWL 3Q2NA 1GOFA 5I71C 3JTBA 2QPDB 1PNDA 2Q2EB 1CR9L 4M6ML 5ESQA 2A7BA 1X6NA 4W9HC 2EXYD 1XGYH 4BRVA 1EJFA 1KNOB 4MDIB 4B96A 4L4VA 3ABZA 4L4VE 1AIZA 2ZP8A 3VXPA 4HULB 1UD3A 2WN2A 2YN3A 3S96A 4BK4A 5GGSY 4AH2A 2Y0SA 2BO0A 2CALA 2M26A 4GSUA 4X8JA 2L0DA 5B21A 1MW0A 4BDVB 4XE0A 2EUWA 4FOMA 4NCC2 2IBZY 4B3EA 1NZRA 3GTNA 4YL9A 3GXIA 2EVJA 3VD0A 2W60B 1RZIB 1AZVA 2DH3A 3G6JA 3EJQA 3K6OA 4KX8A 3WKMH 5ISZD 5J1AB 1PVHA 1UFGA 4X4XA 5I5RA 4GBXD 3VXMD 3ZT7A 1KB5A 1EGJL 2D7TL 2I24N 4P5KB 5HI4D 5GGTL 2YAMA 4Z3HA 4ATWA 1CT8A 4HWBL 3HMXA 2FLMA 4HKZB 3W9EB 3IDJB 4LNVA 5KYXB 2PXYD 2K1MA 2P1YA 5DD3H 3J07A 1CZ8L 3SSGA 2XY2A 3W81A 1W72A 2WXQA 3HNTH 5B4MD 3VFGH 2JELH 3MBED 4DW2H 4I1PA 2ZKHH 5AZEH 3VD5A 1C08A 1F58L 2IGFL 4WCYH 4XO4A 4D8PB 2QGBA 1UJ3B 4NM8H 5JPNC 3X14A 3IDGA 3TFKC 4NQDA 2JKRM 2A4ZA 2AKRA 3HZVB 3MI6A 1Y18A 3JWDH 4ZMWA 3RL2B 3NIFF 3O8XA 3OMIB 1J48A 2ODHA 1WICA 1PNCA 3NJXA 4OM1L 4HUKB 3QWRD 4Y1TA 2W0KA 1RMFL 4ODSL 1BVKA 4XBGA 4OAWB 1L0YA 4YPGA 4YHLH 4K7FB 4UINH 1F5WA 5CMAA 3FQUB 4I9XA 4OUUB 3B9VA 4IRJB 4JHZA 4P46A 1RUKL 3GHEH 1BJ8A 1T66D 4K9JA 2C7FA 2VT0A 3QI9A 3BP5A 5HDBB 4PREB 2CDFA 3US9A 1SJMA 1PCSA 1ZHKB 2MOQA 4DPBX 2AQTA 4JPIA 1PQZA 5L88H 1WIUA 2X70A 3S3PA 2VMJA 3C5XA 1NGWA 1BD2E 5C6TL 4YHIA 4WO4C 3JSSA 5EG6C 1VRSA 2PCPA 3F62A 2AQ1A 2R4SL 3LQZB 1Q72L 2QL1A 3FT4B 4DGIL 5I8CA 3MV9A 4DN4L 1T21B 3L4WA 3MV9E 3PABA 5D5MA 3KBHE 1ZMYA 2OJEB 1QR1A 1G0YR 2R56L 3GSVB 2R51A 3D0VB 4YHML 4J1UA 5KG9B 1H5BA 4JY5H 3QK0A 2AP2A 4JDVB 4DK3A 2JJVA 3NOIA 2DEYX 3BO8A 2DQJH 2HRGA 2O61B 1COBA 4FKKA 4UV7H 2XIDA 2XNAB 1JGEB 2WLHA 1WAEA 2K8QA 3O3EA 3W9DA 5KYWA 4GKLA 3AT9A 4KKCC 3H7BA 1UZ6F 3PHQB 2VDPB 3D3VE 1Y0LB 3KPSE 1P5VB 3WN5C 5BVPH 2QMJA 2N1TE 4IKJA 4BFGA 1N59A 4Z1PA 1RY7B 4R5VA 5EC1A 1DQKA 2NSQA 5GRUH 3X3FL 3UBXG 3RRQA 3ZK0A 1BVOA 5ENWB 3O2DH 1U36A 4LARH 3L4TA 5CJBA 5HHVH 1AHWA 2Y6TE 5C0JB 4K94H 3NA9H 3Q48A 3C2AL 5BJTA 2ZWSA 3FUJA 4G3YL 2GT9A 2XWBB 4PJEF 4QAWA 4KY2A 1RJYA 3DLQR 3EYOB 1Q9WB 1K5NA 2OXGA 4KPHL 1XCXA 3ZHDA 3HZKB 2WVTA 2G4EA 4N8VA 1FFNA 4G80A 3E9TA 4NCC1 5DHDA 4ADIA 5IBTL 2EDNA 5JPMB 3IFLH 1SN2A 4FXGC 1XGRA 3VGHA 1HEZB 2NQ3A 3VWJA 3EYSL 4KKZA 1E4XI 2Y36H 2WINB 2UZYA 1RVFL 4N5UA 3RP1A 4RLDA 7PAZA 4M7ZB 5D1ZC 5KANI 3C2SA 5CSZA 2GBTA 1CC3A 4AMWA 9PCYA 4JGJA 3BISA 4FQCH 2A6IA 4JM2B 4YL4A 3WJLA 5I6MA 1GC1C 2BFVH 1X9QA 4PI2A 1FIEA 1K3IA 3HG1B 5DT1L 4PWKA 4XAWL 5IHUH 3MNZA 5F3BB 2BHYA 2ZYIA 4Q8BA 4EF3A 1EZLA 1IAKA 2FHBA 4YBHA 1TCMA 2DQCL 1VB9A 3UPRB 4GUOA 4H8HA 4K3GA 5HGBB 4WWOA 3MNWB 1KPUA 3D51A 1I75A 4G5AA 3PDGA 4K94C 1PG7L 5CP7B 3E1ZA 3MROA 2F53D 3NCYS 4PTUB 2UY7B 1UB6B 1X44A 1XR8A 1LM8V 3GWJA 5T3XE 1UOLA 1NTDA 4UQAA 1WITA 1FVDA 3H6JA 1ETZB 2H3NB 4PG2C 1UT9A 3FHEA 3GMMB 4L05A 4BZ2H 1WTGT 5DUML 1DZ0A 4AYFA 3EGSB 5A6MA 2ZCKL 3IMVA 5E4EC 5FFOA 4NZUL 4PGZA 4WRLA 4Y9CA 3BPLC 5GS1B 3F6LA 4KZEH 3V5DA 4OJYA 4YLBA 2OX5B 4AYSA 4P4KD 1DP0A 3KCPA 4L8SB 5J6GB 3ASWA 2NY2C 5J57B 1N0XL 1FZMA 5IWLC 4KHTL 4G8IA 2WO2B 4G9DB 4CN1A 1FJ1B 5A2BA 3OAZK 4X5WA 1ODAA 4JKNA 3MRNB 1U8QA 2AV7B 1TZHA 5DLML 1J9RA 3E6FB 3N43F 1QRNE 3GK8H 2EDMA 3N44B 1T20B 1KTBA 2X4UB 1BFTA 2RBLA 3C6SB 1FBIH 1HHJB 4OD1L 4Y1SA 3LNHA 5HTSA 4DUXA 1JI2A 3BWUC 3FSWA 2DWEA 3PY9A 4OZIA 4F58L 3TZVD 3ULVE 3F64A 5C97A 4V2BA 1NKOA 1QSFE 2YMXL 3QUXD 5TE7H 4R4ND 1G7MA 2BNUB 3B83A 5J8OA 1NDMA 1M7UA 4JN2B 4UBDD 4F27A 3LEYH 4ODVH 3V8CA 2YPLA 3HN8A 3HRZA 3RUGB 2YPLE 4JANA 2QHRL 1MRDL 3QEQD 4TTDC 2KUTA 5HVHB 1NGXB 1AD9B 3AG1B 3LNIA 4FA7B 3JTSB 3LZPA 4UT7H 1FNSH 1Q9OA 1TZIB 3B9KD 1MIEL 5E8DH 1M2VB 2BW4A 4P05A 1FG9C 5KW9L 2P5WA 2LV4A 2Z31C 3N06B 1U8NA 3GKWH 4Z3EA 3CUPA 1AYRA 3B2MA 4PGBB 1IGMH 3LN4A 5IVNA 2EKSB 3GSNB 5E6RB 5MENB 3KVPA 1NIFA 1O6SB 3UTTA 1LK2A 3U82B 3UTTE 4JQVA 3VFVB 1UEYA 4C47A 3D6GA 4AJYV 1VKXB 3V5KA 4FQ1L 2HFFA 4TN9A 2BSTB 5I16A 1NGYA 5ITFA 1JWSA 4JVWA 1TQVA 4R5TA 3OAUH 1FORL 4QLRA 2Q8AH 2GSGA 5EA0H 5DJCA 3GRWL 4PPTA 5D1XC 4MJID 5CCJA 1ZKAA 2H6OA 4LPXA 1M9WA 3I2CL 3KLLA 5ILTL 3RZCD 3C5ZA 2JH2A 4HS6A 4YXKL 4KO6A 1WS7A 3KL5A 3PWPB 4RGOL 3MA7A 3T2PA 3QDHA 4NKQB 5IB3A 5AVQB 2G3ZA 3RU8H 1YYLL 3CHOA 5C07B 4K15A 1IGYA 4M3KB 1I4FB 3ARDA 2WQUA 4XNXH 4CW1A 5C0RL 2Q6WA 3G6AA 3ZMEA 1NUDA 2B1AH 4WI3A 4ZFGH 1MLBB 1UKSA 4LRNL 3PL6D 4HOMA 2FJGA 1R3IH 3IE4A 3OG6B 3P4MA 4OFYA 4ZFFB 1NMCC 3PNRB 1MFBH 3EHBD 3L48A 5C0CD 2FJSA 2VDQH 3W2DH 3G6DH 3EFDL 5FCSH 5DWUH 2NNRA 3MA9H 3FZUC 4GEJA 4RFNC 4U6YA 2HT3C 4QGTA 3QJRB 1KN2L 3FB6A 3OJVC 4H26A 4YFEA 5I19H 3C6LD 4ILDA 4GXUN 3TJEH 4CGUB 5IR1B 4FJ6A 2XFGB 1AS7A 3NRFA 5DZAA 5EU6B 2HVKA 5GGQH 3TO4B 1Z5YD 1TYJA 2GUOB 1UASA 4X6DF 3B1TA 3MUHL 3QDMD 4IOSA 1U4EA 4ZXBA 3PREA 2CIIA 3ARFD 3IXAA 4P0DA 4YIQA 5IBUG 1Q9LB 3QEHA 4FFYL 1SN0A 1YN7B 2WWMD 4PHXA 4NZ8A 3SPVA 5KVEE 3BVNB 2OA9A 3IJEA 1P4IL 2DTML 4MLIA 1E65A 4APQB 2DQHL 2NXZC 2PYEA 2NY6C 3IFOA 5CJ8A 4BSVA 4WU5A 4LGSB 2R9HC 2HLAA 4HAKA 5BQ7B 1AVAA 5CIPB 3ECVA 5GIRB 1BX2A 2XWCA 3T77B 4GW1A 5IESL 4G6KH 5FCUL 1J5OL 1A9EB 4X7SH 3LXUX 1OGAD 1IM3A 1MJ7L 2DOCA 4LEOA 5FO8A 5G5DA 4LLMA 2HFEB 1D7BA 5KJ4A 1IZJA 4HIIB 4JFVA 2ZTBA 4XGZB 2YAFA 3WKPA 4C56A 1WISA 3V0WH 1ZGLB 1ILUA 4C56E 1FH2A 3ZDWA 1ZA3B 4WZ9A 3NZUA 3S37L 1F8TH 3NG5A 4F37F 3ZYIA 2ZSVA 3PGCB 4HCRL 1OZTG 1FLTX 2JKNA 1PYWA 2WBXA 1P6FA 3HS9A 4UTCA 2I9TA 3U2SA 2ADIA 3PHOB 2K9FB 3H2QA 3INUH 2XV6B 2VSCA 3GBLA 3CDGA 1GZPB 2X4OB 3L4CA 1IAOB 3WELA 2PP8A 2LT9A 2KZ1B 4XNYL 2AK1L 1U3JA 1KJVB 2ZYSA 5T5FH 3L2MA 5IOPA 4DGVH 4TYUA 1KCRH 1FIGL 4H8PA 5HHPB 5I1GH 1DL7H 3TNNB 4PJGB 1E5YA 3OC5A 4U1JA 2OXHA 4N6RA 3O9WC 4I2XA 2KZBA 1WQVT 4QXTB 1XTMA 4I3SH 4HALA 1A3QA 4JKWA 1KTRL 2YUVA 5CLTA 1TQWA 5KBPA 3DX8B 1YMMA 5I0VA 1EHLH 1IC4L 2P48B 1B0WA 3GM8A 1DANU 1KDJA 1EAPB 2BSSB 2DLEA 4PJ8C 5E6ID 4JDEB 1EIBA 1U41A 1XB3A 2ZKXA 3CTTA 3O2VL 3GSUB 2BP8B 3BE1H 3PS6A 3EO1B 4RAVB 5C08B 3X1NA 1OY3B 3VXTB 1DN0A 3BVDB 4RQQB 4Z0XA 2QPUA 3BD5A 2VLRD 3VXUA 1WBZB 3CSTA 3QEGL 4JM4L 4YQXH 1DBJH 2P8LB 1KT2A 5IB5B 2ZP0T 3PE9A 3P30H 4KGLA 5D96C 2FHCA 1AGDB 3LH2H 1WBXB 3BMVA 5IP4A 4LVNB 1LDPL 2EIKB 1NJ9A 2FTAA 4JZOA 1O9WA 2HVJB 3CLEH 3BN9C 3V0DA 2PETA 2ICWI 5JIQA 1S7RA 2VMEA 3ZTJG 1SDAB 5ETUA 4RMQA 2NY7L 2C7UB 5E8NB 2YZ8A 5GS2D 3BW9B 1HVXA 4Y88A 2ZG1A 4NGHH 2V2TB 4QT5B 2K3HA 3WIHL 4O00A 2G0LA 5BV7C 4IRSA 1G1KA 2HKHH 2B1HH 3MJ7B 3TM6A 1LD9B 1QSVA 5K1JA 5DA4A 4GRWE 1V3JA 4HD5A 4ZTPL 5JDSA 2E7LC 2E5EA 2I07B 3MVSA 5GSRB 4K8RL 3O3BA 2VLKE 1WYJA 1W8NA 3NRPA 2EQDA 2YD8A 3OKDA 5ANMB 4E9RA 4CL7A 4M5YL 1E9QA 4LRIA 4Y9GA 1M7DB 2H5UA 1G87A 4H8WL 3QQ3A 3L1OH 3DV4B 1DDTA 1M2OA 4UM8A 4Z3FA 3QZBA 2PWHA 3V4UL 2DD8H 3IB4A 4A2FA 3U4BH 2OMWB 3SBRA 2HB0A 4JM0A 4I18B 3WAKA 3LJ3A 4ZO7A 3WY3A 2WXPA 2PN5A 4HWUA 1KZYA 1VLXA 1R3JB 5G2NA 1OSEA 5J3HD 1A6PA 1ADQH 2X5PA 2DQFA 2PPDA 2W07A 3DPBA 3SGKC 2AJSL 3MYJB 5J9PA 3MLVL 3QYCA 3WO4C 4R26L 3HW7A 3RFZB 5K59F 2FAUA 1D7FA 3DVFA 1AXIB 4G9FE 4WFGD 2Z35B 3GGWB 3ILPA 5KS9E 2Y7SA 3VA2C 4MNHA 2KZKA 5HYFA 2ARJB 4V11A 1PGRB 4KDWA 5TH2B 2WZ6A 2NTSP 1M05A 1BZOA 2V5YA 4P2RE 2YAQA 2JLPA 2L7UA 3VYPA 4B41A 1KYDA 4M8RA 4HCIA 2DMHA 2DI7A 5MI0B 3U79A 1EO8L 1F3JB 4OZHF 4XP5H 1DVQA 4NQSB 4PRNB 4LASH 4EN3C 1V7MH 2DYPB 4IKKA 5E9AA 3ARVA 4HEPG 4JQIL 4MRBA 3H3PH 4GB9A 1FP5A 2XDHA 3KDPB 4ODXA 3LEVH 3DO7A 2VDKB 1YY8A 5EIIG 1ED3B 4IRJD 5JLZB 3X13B 2XX1A 4J3OG 3A23A 1NEPA 3I75B 5IW1A 2P5EE 4GINA 5A2FA 4GSXA 4X80L 3WUWB 4HDIB 3JV4B 1SMDA 2UZIL 1IGTA 1L3WA 5LGYA 1OM3L 4KX9A 1HNFA 2R8SL 5HJDA 4UTBH 2AABH 2RTTA 1EJOL 1NFDA 1QG3A 1KBWA 3U48A 5B3JE 2YQ2A 1NFDE 5I23A 4X6EB 1FZKA 4PLJC 2VMDA 4AZUA 1SBBA 1A7NH 2BVUA 3FB7A 4JDZA 1OCZB 1WDAA 3P02A 1SOQA 2BVQB 1UXWB 4G1EA 1CE1H 1YY9D 1YQ2A 1KEGL 2BVPA 2OR9H 4IGBC 1WC7B 4L5FE 2QPEB 4NQVB 5AWNL 4D3CH 5FYJL 3T2QA 5EBMB 1CBVL 3UZVA 3ULUL 1Z9SA 4D0CA 4O2CB 5AENA 1EXHA 4Z3TA 2PTTA 3LZLA 3OLEA 4ZOAA 4GG8B 5D9SA 5E1IA 1T5WA 4E9VA 3RDTB 2QGDA 2W65A 3C87A 1TZOA 4HJ0C 3D0LA 3ZQXA 4YSCA 2EILB 1VZHA 2OFQA 4UQIM 2IMMA 3JV0A 3SB3A 5JXED 2OI9B 1ID2A 5K39A 1XDTT 2A74B 1F4WL 5D7KE 4XX1E 5AZ2H 1M7IA 1RKRA 1RK7A 4BH8B 3AXLA 3VJ6A 3HB3B 5HGDB 1YEHL 2EIZB 3BGFB 4R0LB 2HA1A 5CS7A 4KI1A 3FN3A 5TPWH 3PPEA 3B2UC 3OKOB 1NMAL 5H37G 3SGEH 5DMKA 2HTLD 3BUYB 2ROYA 2UYLB 2A9MH 1AS6A 2X4RA 5IQ7H 3GJFH 5JIDA 2OM5A 5E8PB 4LLDB 3P0YH 5LAPA 4KJQC 4NENA 4X9HA 1P7QA 3HI1B 3QUYC 5GGRA 3IKCB 3H8NA 2AXHA 2G75B 2Y25A 2MEJB 3CV5A 1U8LA 4J3OD 4K5MA 3S88H 1NLDH 4L2LA 1RUAH 3LN5A 1OAYH 3FU7A 3QNYB 3TOPA 1JL8A 4D9RD 3QXVA 5HI3D 4FG6C 4QHNA 2DWXA 4HF5L 2CHZA 2ICWA 3IT8D 4PGDB 4MJ5A 2NW2A 4TL5A 3U7AA 4ZZFA 2GABA 3PWUA 4R97C 1GH7A 1ZDSA 1MCOH 4BHUI 4Q6IB 1HE7A 4YHKH 2HYMA 1H6TA 1Z66A 1XIWB 2GJ6A 1EJ6A 4WEMB 1AR1C 3GUFA 2GJ6E 3CGTA 3D7PA 4OLZL 3QDGB 2FYYA 5HVFB 3RILA 4GG6A 1F11B 5CCGE 2FUTA 4RFOH 4X6CB 4E9TA 1Y1DA 1RLBA 4MNGA 1P4BL 4IU2B 5LWYH 2X6CA 1CL7I 2ZCZA 1UHVA 4O2FB 5CF3A 4UTAL 1AYOA 4EI0A 3W5NA 1A6AB 1KCUH 1HQRA 4H1LA 5I8EB 1BZQK 3HG1D 2OZ4L 5EZLB 3TP4A 1T4KA 1TETL 1UXSA 1RL1A 4WTZA 4CMMB 4YDLB 1KJ3L 3W0WB 3RWCA 3VG0L 1G7PA 3FQNB 2D3NA 5I0ZA 4PRHA 4ZMAT 1U3HA 3CH8A 5F7LB 5GZOC 2BOCB 4YX2L 3MLWL 5ECJE 1F1DA 1AZNA 2R83A 5DD1H 2Y3NA 3BZFA 2OTPA 2YKLL 2AAAA 3L5WA 5C0FA 3PG2A 3KXFE 2CKBL 1MFMA 2G9HA 4M3JA 2UZPA 4FNLH 1HZHL 5DJYA 3V0EA 1JDCA 4YXHL 5D7LB 4RGMC 3SYQA 4KUCD 4P59H 4GAYA 1F86A 2OV0A 43C9B 2PW1A 4PY7A 5LN4A 1FZOB 4G8FB 1N6QL 3CHSA 5T5NG 2IDFA 1A4CA 2P24A 1FDLL 2CA3A 2PWFA 1VADA 2IALB 2PUQT 2O30A 1HXKA 2FBJH 2J5WA 2H0JA 1YRKA 5EUKA 4BELD 3N1FC 4CN6A 2AEQH 3SDAA 2BNQE 2VN3A 4QD2E 1AJ7L 1E6OL 3HC3L 1PBYA 1ZVHA 2CK0L 1TVHA 2OMYA 1YEDB 5CUSL 2F54B 1NAML 4YAQB 3WTSA 4QXGH 1DUZA 1Z2KA 2JKSA 5K9JH 1MN4A 1NIDA 3SDXB 2VWEC 4ZYKB 4Q9RL 5AG8A 4S1SL 4HKJB 1RIUL 1FAKT 4LP4A 4GBXC 3K8MA 5ICZA 2H32B 1MAMH 1NWOA 1J87A 1DR9A 1HIMH 5EN2A 4Q9CA 1UD2A 2EEDA 5H4YA 2WB7A 4FLSA 2H9GA 4JFQB 2XG4B 5IK3B 3VXRB 5IHZA 2HT4D 2OMVA 3B3IB 4UOQA 4AT6A 3QJHA 4PBVC 5C9JB 3VFPA 3BPCA 5B4MC 4QJ4B 3MBEC 3QCUH 3R1GL 3TA3A 1E50A 1MVUB 1WZ1H 2VDLH 1MFNA 5FV2A 1RUQL 3WKQA 5LHDA 5IROA 2FT6A 3CH1A 1MF2H 4UM9A 3US0A 4WTWA 4H13C 2Y1AA 1HWWA 3HJEA 3MNDA 5CZVH 5MEND 1VFUA 3AREB 1C1EL 1OLZA 4AM0Q 4ECNA 4LPCA 4DVBA 2UWEB 2H6PA 3BH9B 4K3JL 4U1KA 3NYKA 4JR9L 4LSQH 4KQ4L 1KGCD 1OAUL 5LCVL 3ZSTA 2BZ7A 2QR0B 1XH3B 4FQJH 2WLZA 4H44C 3SE8H 3SKOB 2HPOA 4KZCA 1E9OA 3L3DB 4YLQT 3UP1A 1T66C 1NBZB 1RULH 3ZZSA 3O6FA 2YWYA 4YZFE 2ETWA 4XNZB 1A14L 1U8CA 3T3ME 1A3RH 3PWPD 4PTTA 4XBEL 1MRFL 1TEYA 4WFHE 4HSQA 3ZDZB 3QEUB 5C07D 4BFKA 1UWXK 2V2XA 1JYWA 2DICA 2AGJL 4NQEE 1UUSA 1O7VA 5D6CA 5DVLA 3VRJA 2Z64C 5JHDB 1AP2B 5IB4B 5KTEL 3NFNB 1L7IH 1ZLVK 1SFDA 3SDCC 4CVZA 4NQXA 4JJ5B 2X88A 4JRLA 3TIDA 3ZDXB 5KVMC 4WDIA 4TNGA 4Y16B 4FFTA 2WIIA 3BGAA 4JG9A 1UM6L 4XOAA 2D0FA 3EJJX 4OGXH 2A1WL 2WY3B 3V6ZA 1PJ9A 3FB8A 1GTNA 1S7XB 1JK9B 3WY4A 3WHXA 4AWJC 1MCWW 3OKYA 5CM1A 1ZVSA 3TPUB 1DN2A 1OGTB 3KPRB 2ZUYA 5EU6D 5JHMA 2WLNA 3LY6A 3AU0A 3TO4D 2HVBA 3QW9A 1JXKA 3PXLA 1QUNB 4WFED 1FYTA 5IG7B 5C70A 1X9RA 3HZ3A 2EO9A 3WS6C 3OMNB 3MBXL 1M56B 4PEEA 2RA1A 2JB6A 3EO9L 2I5YH 2XICA 3EG9B 3DURA 4JLRA 4CC4A 4HWEL 1GY1A 3EJSA 1NFKA 3BCFA 4LFHG 3K5SA 2EZ0C 5EB9A 4AVJA 3H4FA 4N86A 3HFMH 5F70A 1BF5A 2W9EL 5KSAA 4I8DA 4APQD 2ZCHL 2JKTM 1FPTL 3U4EA 3FO2A 3EH5B 3I02A 4NZTL 1CLOL 5E2UL 1F90H 3RHWK 1H8OA 3NESA 3LEXA 5D71H 1LK3L 3UC2A 2OTUA 1G1YA 3EGXB 3IMTA 1CLZH 1WCBB 2AK4A 4K8RC 1JHKH 3MLSH 3QR2A 1IGJA 3GXPA 2PW2A 4UAHA 5EOCH 1VFAB 2FJFB 2RGSA 3DHPA 5G4OA 2W80C 4OVUA 4FXKA 1NCNA 3D05A 5E8OB 1V3LA 2IWEA 3J27A 5E2TL 2RD0A 4Y5YB 5DJ2B 3VI4A 1NOLA 3K6NA 1ZLDA 4PFEA 3BSZH 1MFCH 1RIHL 4O58H 3UMTA 5HYQA 2Q5BA 1S7QB 4DP6X 1OHZA 1T1XA 3AB0B 4JY6A 4N2HA 4L3FA 1X5IA 2YA2A 1XSOA 3ZPDA 4ZOBA 4X8GA 5J13B 1UADC 2XN9E 2VXVL 1CN4A 2C9QA 1I9JL 2FL5B 4K9EH 3U2JA 1EFQA 5BUAA 3CX2A 2B77A 3M17B 1PZ5A 1BBJB 4JZJB 3HLAA 1U8JA 2CPUA 4IJ3C 5HJ3A 2MPAL 4UZUA 1I8KB 2YAPA 4BEIA 3IM1A 1FAIH 2BRQA 5F97E 3T9WA 3OKEA 4D0BB 4IMLA 4QPEA 2MH4A 4A1RA 2DQIL 2EEXA 5F2FA 4N1EA 3UTSA 4NX0A 2WQ8A 2BVOA 3UTSE 5CJ5A 4HJJL 5BS0E 2J1ZA 3OZ9L 2R1YA 4UNTA 2PO6A 1PY4A 4PSRA 4MJ6A 5D4JA 3WFDL 3L9EA 3VGAB 4ZNEA 5C08D 1KXHA 4N26A 3B8YA 4HKBB 3ASNB 4KI5E 4NHCH 1A2YA 5EDSA 5ABZA 4MJHA 3A67L 3WEAA 3B2XA 1IUZA 3CLFL 5SWSA 3HNVH 1QVOA 1A4JA 3MPCA 4M6OL 5SWSE 3TS8A 4QOKA 1OZUA 2AXGB 1WA0X 5DJZA 3D87B 2PWEA 5HHME 1WO2A 1UH3A 2BC4B 3FYEB 3RKDD 4BZYA 2E9IA 1CFSA 1MDTA 3FU6A 4LSSL 3MOQA 5DHYB 1SJEA 1A1OA 2XKUA 4N9OB 4X7TB 1OSPL 1QSEB 4YDJB 1DJYA 3Q7JA 4B3VA 4P4KC 4OFVA 4M1DH 4W4OA 2CDEB 2C34A 5J6SA 1LNUA 1FL6B 1MXDA 3IYLW 4LHJB 1IRAY 4N24A 5I15L 1EHKB 2CUIA 1FCGA 5EORL 3GT6A 2D0GA 3S5LB 1BMZA 3QUMH 1PZSA 4G5ZH 3QG6B 1H8NA 4XN9A 3X1GA 1XGTB 3HBPA 4K3EH 4NP4H 4MWFB 3M45A 3MRPA 4N90E 3I6LD 3G5ZA 4WV1B 2UXFA 3NAAL 4XPFH 1N5YL 3WNJA 4LMQE 2WZPA 3SOBH 5E08H 3GMRB 3APNA 4K9EC 3WUWG 3NIFB 2B20A 2JCCF 5BQDA 4L4TB 4CU7A 3TEZA 5IQMA 2WGNB 3ULUC 1TVDA 4UBDC 3MLZL 3LV3B 2A83B 4XO5A 1NFIA 1S7TA 3W56A 1KTDB 4IIQB 4HV8A 1YG9A 1BEXA 2C1PA 3CU1A 3LKRA 1IILE 1MRCL 4S1RH 3ZZQA 3MRRA 4KRLB 4OSUL 4ZMQA 1U91B 1JZ2A 5EH1A 3MO1B 4AGPA 2X9WA 3FTZA 3TN0C 2ARWA 2R4RH 3T3PF 5LXVA 1AGEB 1O75A 3MLTB 3HR6A 4LLVA 3RL1B 4OLUH 1X5AA 1ZS8A 5IHWA 3QHFL 1I7TB 4FTVE 2DQTH 1MWOA 3AUWB 2ATKB 1URIA 4PW9A 1KUMA 3CE1A 3V2AR 1H19A 4WAFA 1HHHA 3M07A 2CKBB 2FEEL 2HRPH 4YHPA 5JHBA 3KHQA 4JGMA 3TBVB 3NPSC 2VXSL 3KS0J 1CFTA 4QO1B 5JOPD 4D9QE 5I24A 3SYOA 4F9PA 1A6VH 1NCJA 1WZKA 3RZCC 4U1MB 4R90H 5FWQA 1SDYA 3UABA 3G5XA 3ML8A 5K9QG 4MX7A 3ABKB 3C09C 3D12B 1W0WA 1GJIA 1A7RL 1EZVY 1BQHG 1X7QB 1KXTA 4DZ8B 1MFEL 2DYPD 2VKXA 4GW4B 4HJUA 4NO3A 3S3BB 4EDWH 3KPNB 3DETD 4PJ7E 4Z3GA 2EDRA 4PJ5E 4NKIL 3QPQD 1NAMB 1QLRA 1RK0A 3WDIA 3VQ2C 3CVIL 4XCFL 2IWKA 3GI9H 1MFDL 1QX1A 3EHBC 3IDMB 5AAWA 4RESB 1J86A 5PCYA 1XGZA 1PX3A 3OAYK 5KS9F 2ZUVA 3F04A 1B4JL 4AKQA 3EJZC 3P3RA 3RGHA 3BMWA 5AW7B 3BKJH 1ACCA 3C6LC 4TSAH 5CFHA 2GY5A 2VQ1B 4J4PA 4PJEB 5E70A 4C4KO 2ICES 4DFIA 4I3GA 5D4QA 1P9MA 3D09A 3OZKA 4AYID 2ZXAA 3GIVA 4N0CD 1SYSA 3FDWA 4U49A 2QADB 1E2ZA 3PQYA 4CMHC 1I7RA 3WEBA 4AV5A 4X5XA 3LB6D 3LZQA 5DQDH 1OXYA 2WWMC 1DVXA 4N8CL 4OIFA 4NUJB 3VM5A 3L3JA 5C8JB 3TX4A 1CVSC 4YZWA 5HHOE 3RDTD 4ANWA 1YECL 5IIEA 3KS0H 1VPOH 5ALBL 4BCXA 2Z34A 2R23A 5IB1A 1OANA 2MCG1 3EF7A 3VAEA 1BXVA 3QARA 4DP2X 3RVWC 1JYXA 2K4WA 5JHLA 4K7PH 4NNYA 3HB3D 3IU4L 1OM9A 2VL5B 1CFNA 5I1DA 2CLRB 3FFOA 1L3NA 2Q7NA 1KELH 2B0SL 1G6RA 3W82A 3V6FA 4JB9H 5TK2A 4URTB 3GZPA 4YOKA 3HAEG 2Q7AA 2Z93B 2ZZUT 3OAZH 4Q89A 4PJXE 3WIFB 2Z4QB 4K2UH 3GXTA 5GS2H 1JPGA 3GEFA 1CTMA 1MCHA 3IKKA 2Q86A 1OPGL 3ET9F 2KLTA 1A0QH 1PEZA 4ZUUA 5T3ZD 1QHOA 5H4ZA 5F3HA 1LEKA 3SKUD 2ICEB 2ZWYA 3GSOB 3O3UN 4EBQL 4G11A 1H3PL 1OB0A 3VWKC 1N4XL 1J8RA 3WS3A 4BKLA 2KLSA 3IE9A 4WW2A 12E8H 3NFPB 3WJMB 2WXNA 4S11A 1IJNA 4GFXA 4OR1A 1EWHA 2XT1B 5HD8D 2A6KB 3BUTA 3M1BB 3GYRA 1S8DA 2YKKA 4Z77A 2VLJA 4PRDB 5E4IA 1XIWD 2VLJE 4FQXC 2DB8A 1I1AB 5KYYA 2E9JA 4M56A 5TE6L 3IJYA 5FLUA 1FCCA 1EFXA 3QDGD 3LD8C 3OKLA 4L2YA 5DHVB 3RJDA 5DUBB 2V4LA 5DQJA 1TKWB 3HG2A 5E6IC 5HYJB 1G7IB 1KB5L 3ISWA 3KZ8A 2F8VA 3HTLX 4XMPL 2IAMC 5F7DB 3HMXL 4MDRA 5FGBA 4W68A 4ZUTA 3M46A 4HEMA 4WI0B 2LU4A 4KO5A 4LLWA 2X6AA 2AEWA 3N43B 3TBCA 3SBWA 4JO2H 3W0WD 5I8KL 4NC0B 4XCYB 2J20A 3BUIA 4WKZA 1J05A 1QZNA 1QZ1A 4YSUA 1L7TH 2A9NH 5L9DL 5JR1L 1I7UB 4ENED 1KWGA 1XGQB 4UILL 4PJCB 3RAJH 4FX5A 4RA3A 1NCWH 4JY4B 5E2WH 4QGYA 5D7HA 5CWSB 3HE7A 4UOW1 2SODB 1ZA6B 4KK9D 5I66A 1TZAA 5HHXL 5D7LD 3M8OH 1NL0H 4ZW5A 4B6ZA 3EFFA 2OMUA 3ZTJH 4MRCA 3VO0A 3DVNB 3FTSA 2WQRA 4FI8A 4YK4B 6FABL 1MNUH 3B2VH 4WWKC 1NCDH 1R5WA 1I3UA 5IJDC 2G30A 3T4AA 3WNKA 4MA1B 2Y5TA 4N0FB 2IQAA 1RK1A 2NTFB 1B3JA 3BRDA 1EZVX 3DK0A 3MRCB 4J39A 5GGSB 2O1AA 4M1GH 4BRJA 4XB3A 1OLLA 1NCAH 3OWEA 1T1ZB 2F54D 3H9SA 1JZHA 4GQZA 1N19A 2CXKA 4QCIB 3U0PB 1MW1A 2DKUA 2ZYRA 1HJBC 1ACYL 2P8PB 1U93A 3C5JA 4O02L 1T7VA 5FFGA 5FHBL 5E2VL 5TF1H 3TIEB 5BNXD 4GKSA 5AD0B 3TU6A 2ZICA 3OV6A 5DD5L 3RVXC 4AQZA 2BVEA 2IXQA 4Y5VC 5DS8B 4DPRA 1BREA 3BFOA 3FQ2A 4UV4L 2RMNA 2NY3B 3FFDA 3VXRD 4CUCA 1HWHB 4R7DB 2HG0A 4AZ8A 3KR3L 1U8HA 5EMYA 3MV8E 1MWAA 4AC2A 5FUOH 4Z78B 4PJFA 3D25A 1FO0B 2YRBA 4UANA 1SEQH 1X4XA 3GINA 4JREC 2Y24A 3WO3B 1HCFX 3LKNA 4AGLA 4XMLL 1TPXB 1YNLL 2QQNH 4BZ1L 3CQFA 3CFIC 2OL3L 1IKFH 4H88H 2K4AA 5EZIH 1J9TA 2VDPH 3MRKA 2A3TA 3VB8A 3ARED 5DDHB 1UQSB 3E3QE 1MI5E 3S34L 5BW7C 4JDTH 3MUGA 4TXVB 3VMOA 5IFJB 4AV0A 3F84A 2G3MA 4XNQB 5HSFA 1JGLL 1ZT1B 2DM3A 4X5PA 2C9SA 4EMZA 1HH6A 1ND0B 4PP2B 3WGVB 2O6CA 2ADGB 3BCDA 2ZOLA 4NZRL 2F1EA 1L9PA 1NBVH 5AW9B 3UTPE 3FB5B 2EADA 3ULSA 3TEWA 2O4EA 4H25B 4IRJC 4X6DB 1KEML 3SKNB 3BYTA 4HJ1A 4J2XA 4U0QB 1QLEL 2SEBB 3DX4A 3JV6B 4IU3A 1T2JA 4P8QA 2P7TB 3D4CA 1T04A 3QO0B 1D5MA 1ZD6A 4MB5A 4WUUA 4J3OH 2FECI 4X9FA 2YBRA 1D6VH 5E00A 4FA6A 5A3ID 2C3VB 4L9LA 2FWUA 1V54B 4ETQB 2BMKA 3P9MB 4ATTA 1P2CA 3CHPA 2I32A 5JHDD 1MJJA 3VI3B 3FOLB 4YSSA 3EJTA 1WGOA 1VEOA 2BOLA 1YY9C 3FOMB 5JNYB 4XXCC 3NCEB 3BWAA 4IBTA 4YBLB 3QNFA 4X5QA 3BDBA 3KW7A 4LOUC 3K8KA 4XNUH 2KPNA 3DTXA 4FFZA 4QAMB 4Y16D 3EOBA 1JGDB 5F93C 3ECBB 3ES6A 3IS1X 1SEBB 2R7EA 3JVGA 1MUJB 3MRDA 3DGCR 4XX5A 3TL5A 1YQVL 5IFAH 3DRTA 2UV3A 4OZGE 5IFHL 3CFBA 4M61B 3WD5H 4QTIL 2DM4A 2YUZA 2E86A 1CU4H 1WVZA 2FVNA 4XPBL 3BQUA 1A9VA 1SGKA 3KPRD 3MLRH 2D2OA 2UVFA 2CO2A 5EEVA 2XFXA 4AW7A 4FS0A 1RZJL 1OT1A 2HH0L 3T3MF 3T71A 3FFCB 3ZIMA 2WLYA 3S3DB 3L7FA 1BM7A 2D2CC 2VXTH 3L3OB 1S46A 5C0ND 1R3LA 3DNKA 1T22B 3X11A 4AIXA 5IKCA 5MEQA 5C0BE 3WTVA 4PRIA 2N3JA 4OD2B 5HXMA 1ASQA 3PIQB 2QVTA 4GKZA 5H37H 4YBQD 5G4MA 1WE5A 3WBDA 5IVXF 3NZHH 3AT0A 1S9VB 1HXMA 1XCWA 3MFFB 4I9WE 3VXSE 5D1ZI 1PAMA 4HETA 1IM9B 4LCCB 5FW6A 4KUZL 3O3AA 5FWRA 5HPMB 1I3RB 3AWFA 5JPMC 1BCIA 5HI3C 2XBDA 4G1MB 1A7BA 4J7RA 4X4ZA 4D94A 5BMFL 3ATAA 3N42F 3LHAA 3GI8L 3V6BR 4XCCL 3B9AA 4W9GC 4C58B 5I1EL 5DHEA 4FMVA 1S5IL 4N2OA 5EOQL 4AG4H 1T0NB 2E46A 1XR9A 1PKQB 2XPGB 4HGMA 2R1XB 4ELMA 4U6HB 3V4VL 5FA3A 1F13A 3LQMA 1SF3A 2AXFA 3OKNB 4FABL 4OF0A 2V6HA 1A4AA 2XG5A 3X1EA 2P42B 3ULVL 3IN0A 4WWPA 3OGCA 2GI7A 3T6QC 1YDPB 4KJPD 2WZAA 4TUUA 4NN7B 5JYMA 1T1YB 5FYJD 4FC3E 1UD4A 1JV2B 1YYML 2Z1KA 3CZFA 3PAZA 3F7KA 4Q97A 4GMSL 4HIJA 2KL6A 4L3CB 1M42A 4P9HL 4MS6A 2L7QA 5A16B 4BIKA 4OUOA 1DVYA 1CPUA 4I0PC 2GIMA 1N7ML 5F7EL 3GXDA 5GRZA 3UADA 2HMIC 4BFRA 3MRJA 4NCDA 4ZSOA 1OGPA 4R7VA 3T8XB 3VXNA 3DWTA 4I13B 3Q2VA 4IIZA 5KJRH 3CHXA 4F7MB 5AW3B 3FTGA 5JPNA 3OX8A 1MJUH 3QQ4A 1PJWA 3PDOB 2CBMA 2NZ9D 3NP4A 3VFSA 1FNGA 2F19L 3GSWB 3GSNH 4ODUA 4HH9B 3QULA 3ENEA 3BEWB 2EYSB 2WD0A 4ZO6A 4JFDA 3CDZB 2NUTA 3N40F 3H53A 5A40E 2F7OA 3L7EA 4JFDE 1EAOA 5BRZA 4MXWH 5BRZE 1U33A 1GYCA 1LO0L 1S7SB 2IO5A 1XH0A 4H20L 3TBSA 4RZCB 2WP3O 2BJMH 1QSED 5GS1C 1TT6A 1RZKL 5H8DA 1AD0A 5INCB 4QRSB 1FFRA 4X4MA 4Y2OB 4L8SC 1BWMA 1KLFB 1JGVL 1CDHA 1GYVA 1CR9H 2GJZB 3T1FA 3VTAA 2AJ3A 1JXJA 3UTZB 3D5OF 1D7DA 1LE9B 3CFCL 4R3SB 2BWQA 4JJHA 1SLVA 1TDQA 3O0RL 4YSOA 2IG2L 2XV3A 5KSUA 4WO4A 2GIYA 3A6BL 4YXLL 4GIPD 5DS2A 4D0DA 4TPRL 4ZUSB 1FL5A 2V9TA 1HESA 4OF5A 4HHGA 4CSZA 5I76A 4AQAA 3COOA 5JIHA 3OLDA 4FULA 1VHPA 1ESOA 5L2KB 4NC1C 3VXOB 1EVTC 3JTTA 1OP5H 2ADJB 4NO5B 2DY2A 3CXDH 4FQLH 4L4TD 4OZHB 4UDUB 4IKLA 1II4E 4PJDF 5DRNB 5AAMC 3ZGHA 1XZ0A 4TNVF 4PH8A 1J8HB 1EGJH 4LQ1A 5FOBA 1BFSA 3H0TB 4HWBH 3HPLA 3H9HA 2M1KA 4OJFH 1E4XL 1ECYA 4TUJB 1YSOA 2A6JB 3L9YA 3S35L 1FVCA 5F7KC 1CZ8H 2DWTA 3CPLA 5C0IB 1H3XA 2EACA 1JPTL 1HSAA 2VABA 5DK3A 3CVHB 2HLEB 1S9YA 3DIFA 2W9LA 3ZDYE 4LE8A 5D7JA 3VGDA 2DQMA 2RALA 5EWIH 2IGFH 1VGKA 5KVEL 4GQ9L 4ZD3H 1L9RA 2HRHA 4FN0A 2BOBA 5I1HL 1D5XA 3G08B 2FEDD 1XSIA 4QRTB 4U6VL 4Y9BA 5CN1A 5INDB 1J0IA 2WVVB 2L4OA 4ICWA 1TFPA 1HJCA 2CAKA 2X0UA 1BJ1H 5CIPH 1WBYB 4NPYA 3NZSA 4ODSH 4Q14A 1AXTL 3EYQD 3F7VB 4G8GE 4FXGA 4JQXC 2IC2A 3NACL 5K9KA 3MNMA 4MMYA 2ZUUA 1RUKH 3IDIB 1IBZA 4BXSV 2KPWA 2NY5C 4DGYL 3GMOA 4LKXA 2ZWZA 1NCCL 1A1MA 4G7SB 1ZY9A 4WIQA 3TURA 3IU3B 5HY9A 3P1VA 4ELDA 3STLA 4N2EA 2NY0C 5D1ZA 1BD2B 1FFPA 4LKCB 2ENSA 4O02B 3PAYA 5C6TH 5KVGH 3K0YA 3HS0A 1YMHB 1DLFH 2M83A 2UX6A 2AQRA 1B4RA 4EJ1C 2DM7A 1SDDB 1FFOA 4ANVA 2BP5M 4M7LL 2K9UA 2D4DA 2R56H 2JQMA 2V2WB 5AVYB 4U6XA 1HILB 5D6DA 3L5JA 2WQAA 2AJXH 2QADD 4N0UE 3O2DA 5AG9A 3D39A 1T1WA 1C7SA 1YNKL 3OF6A 5DO8A 4AMXA 2OKMA 3MGOB 4AYDC 4PJBF 4KWUA 5AZUA 3NK3A 1DFXA 1XGUB 2WCGA 3PYCA 2OL3B 4MSWA 1ZSDA 4W6XB 3D3VB 3WHE1 2J8UF 3A4DA 3KPSB 4N2CA 3MX0A 4APQC 2XYBA 1E28B 1QEWA 4NKDA 3TV8A 1ZV2A 3W3BA 2JCCA 3X3FH 3GMPA 4CJ1A 2A0LD 2CCWA 2TRYA 4CSPA 4EDXB 3PGFL 4XP9L 4MA8L 4XP1L 2WMPA 3UYOD 3D34A 4J2QA 1MFVA 1C5DB 2JWYA 5BO1H 3U46B 2V17L 3C2AH 4WGVB 3BZ5A 4AW4A 4G3YH 1QBLL 4ABUA 2YJLA 3ARBA 3IJ7A 3EDEA 1BYOA 1QLEB 4L0YA 1KPRA 3HLKA 4TUKL 3CMOL 4KPHH 3UYPA 3WEXA 2NR6A 1J0JA 5IBTH 3FAWA 3MRHB 3CSYA 3LSOB 1E8WA 3DROB 2JI3A 3AG2B 1RFDH 1OB1A 3IGAA 3SKMB 2WO3B 1JNNH 5B1AB 4MCZB 3ZKSD 2NYYD 1FG2A 3T65A 1UWFA 1IBBA 1H5BC 3ATBA 3BIAX 3MCYA 1ZHNB 1ERNA 4NOFA 3REVB 3QZWB 1I1AD 4UZGA 4YE4L 4RMRA 1UTDA 4E41A 3MQIA 4E41E 4URKA 2Z31A 2FX7L 5HYJD 2QDWA 1ORSA 3KPLB 3PWLA 1IV8A 5D7IA 3FQTA 5DVNA 1SM3L 5DT1H 1QTPA 2OK0L 1V5JA 4MAYB 5FYKL 2BNRA 2L7JA 2VJXA 4PJXF 3RIAF 5IMOA 4HUCA 1WZMA 4BZ2A 5D72H 5IGXL 4RFEA 3DJ9A 1Q9KA 2J3SA 5AUMA 2E0PA 2ZSWB 4X7FC 3RKDC 4XVOA 5B7EA 3SIKA 1MZYA 3WMQA 1PG7H 4LVNC 5ESAA 3QG7L 4U1GB 5TDNA 4XNBA 5D1XA 3UO1H 3LXAA 1ANUA 5D1XE 4PGCA 5MP6L 2NX5A 2HWZL 3CVCA 3MJWA 3FTUA 4JKKA 1BDYA 3F7PC 2YJQA 1MREH 1OAKH 3NN8B 2D3VA 5DSCB 1SLWA 2WC7A 3L3KB 2QQLH 3UYRL 2OSXA 4PRBA 3OWRA 4MCYB 2FWOA 5IREA 2H6UA 2XTLA 3VWJC 1F3DH 4GSDH 5GZND 2P80D 4XWGH 4PR5B 5GGVL 4CBZA 5KEZA 1VFBB 5D93B 5FO9B 1KLGB 4OKVA 4E0RB 2VDKH 2D9QB 4LSUH 3EO0A 3X3GL 1QYGH 3T0BA 3CMGA 3T6WA 4P5SA 2N1KA 4P2QE 3HN5A 5H35B 1QRNB 2DI9A 4QF1A 1BAGA 3UX9B 1RU9H 1S9XA 3LKQA 4KTEL 5LAXB 4OU3A 4DPAX 3RGVB 3WJLC 5MEPA 4M7LT 3KYMB 3DYPA 1BQLL 4OY9A 3UTQA 4F58H 2CR0A 4I4WA 4I18C 1QSFB 3QCVL 4FQQA 5F6HJ 4ANUA 4E9YA 1ZGLM 2CDGB 3FHQA 4HZLA 3C5SA 3E7JA 4V1DE 3B5TA 3LS5L 2NY3D 1EUTA 4WK4B 2QHRH 1JFQL 1MRDH 1IL1A 1XXFC 4KKPA 4QHKI 1W6LA 1E27B 3LNGA 3QSKB 3HHSB 4JN1L 2F58L 2OP4L 4AKOA 3P4NA 5KW9H 2NMSA 2QGEA 3QUZB 3T2LA 2G5RA 5FKAA 5ESVA 4WHYG 2VC2L 2WJ5A 2X4NA 2GTQA 2CO4A 4JO1L 4UQ9A 4YVUA 5KVFE 2H1PH 5K1VA 5IV2B 4F9LC 2MKLC 2HJKB 4KRNA 2J4WL 4WFFD 4DO6A 3APFA 1TVBB 3O4OB 3R0NA 1KY6A 1MVYA 3RNQB 4YGVA 4OLYL 2NY1C 1K6QL 4M6AA 4A7UA 3WNOA 4AE0A 4NM4L 3HCVA 3ME0A 5DRWA 2QSTA 3RI5K 3OPZL 4AYGA 1FORH 4EOWL 4BE6A 5IEKA 2FEJA 2ZXWB 1TF4A 2PR4H 3DETC 3FQXA 5BZWA 3OD3A 3GRWH 1NBYB 3LZNA 4HVBA 4NWTH 2YEQA 3I2CH 3QPQC 4W6WB 4P57B 5EFIB 5D1QB 3UGEA 4LNRA 4P2YA 4ALAL 2DS4A 3U9PH 4WW1A 2K45A 1E4HA 4LLQB 3RWEA 1YYLH 4OH2A 3DBSA 1A5FL 1OAZH 1DZBA 2ZXGA 3GZKA 4YDVB 5FF6B 1P6WA 4F93B 3F12A 1UWGL 2RIKA 2VLLA 4Q6KA 1U8IB 1HHKA 5T3ZH 3S2AA 1MCNA 2A2QT 3QNXA 4A67A 2J88L 3PV6B 3AACA 3MLYL 3KYNA 3B4NA 3RPIB 1LE5B 3MRGA 1UKTA 3F8UB 5AVTB 3DSFH 1GGCL 2LOEA 3GMLB 4RRPG 2BDNH 4X9BA 4PRAA 3O9WA 1KCVH 4X5RA 3EFDH 2Z0UA 2C9AA 3ESMA 5BRPA 4ZMXA 3AITA 2DMBA 5I6XB 5LNGA 2MKWA 1B0RB 3LB6C 4ZQKB 4FFVD 4AYBA 2H47C 1TQSA 5HDOA 4PJ8A 3S0PA 3J8F7 4KXDA 4WU7B 2HLFC 2DMKA