2PPPA

Crystal structure of e60q mutant of fkbp12
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWQEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 1A
publication title Structural coupling between FKBP12 and buried water.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 30
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2pppA00
3O5RA 1FKLA 1FKGA 2XPBA 4DZ3A 2AWGA 3O5OA 4FAPA 2L2SA 1KT1A 2RQSA 4DROA 1J6YA 2K8IA 2KR7A 2ZQTA 4TW8A 4TW6A 4W9PA 2XP4A 4DZ2A 5HKGA 3CGMA 1FD9A 1T11A 4DRIA 1ROTA 2DG9A 1Y0OA 3NI6A 1Q6IA 3KZ7A 4IPXA 4TX0A 2FKEA 5BXJA 4GGQA 3O5JA 3O5PA 4DRQA 4JFJA 3IKGA 1P5QA 2XP7A 1FKBA 3KAIA 3O5KA 3IKDA 4ODOA 1D7JA 1Q6HA 3NRKA 4DRMA 1J4RA 4GIVA 4ODQA 2M08A 1D6OA 3RGCA 2Y78A 2VCDA 4N19A 4U86A 4QIBA 3UQBA 2F4EA 3O5IA 1NSGA 4ITZA 1YATA 5DIVA 4MSPA 2XP9A 1FKFA 5B8IC 3ODKA 2MLXA 4ODLA 3FAPA 3PA7A 4IQCA 3TCZA 5I98A 5J6EA 1JVWA 2ZQVA 1C9HA 4DT4A 1N1AA 2IF4A 4DH0A 1BL4A 3O5EA 2LGOA 2LKNA 2VN1A 1HXVA 4ODRA 4NNRA 2M2AA 3JYMA 4LAXA 4BF8A 4JYSA 2KO7A 3KACA 1ROUA 1FKDA 3O5LA 3VAWA 3TC5A 1B6CA 1R9HA 2RUCA 3LUOA 2RURA 4JFMA 4LAVA 1PINA 3O5GA 4U84A 4DRPA 1FJDA 5HW7A 3IK8A 4FN2A 4JFKA 5D75A 5HWCA 1ZK6A 4MGVA 4W9QA 4DIPA 2KE0A 1F40A 1TCOC 2XPAA 2RUDA 2PV2A 2LPVA 3GPKA 3OOBA 2F21A 2PV3A 2PV1A 1W26A 2XP5A 3EY6A 1FAPA 3KAHA 2MLYA 1FKTA 4IQ2A 5HW6A 3B7XA 3KAFA 5HW8A 2ZR6A 4DRHA 2OFNA 4TYOA 4DRNA 3H9RB 1L1PA 1D7IA 2MF9A 4TW7A 1QPFA 1ZCNA 2ZR4A 5DIUA 4ODPA 5HTGA 1BKFA 2KI3A 3O5DA 2ZQSA 1Q6UA 2MLZA 2UZ5A 1JNTA 4J4NA 4JFLA 2PBCA 1U79A 2KFWA 4O2TA 2PPPA 5GPGA 3UI4A 3RFWA 2XP8A 2FAPA 3MDYB 4QT3A 2Q5AA 4G50A 3KAGA 2PPOA 1NMWA 2N87A 3JYJA 2M1IA 1FKIA 2LJ4A 3O5MA 1F8AB 1PBKA 2D9FA 3JXVA 3WH0A 4DRKA 5HWBA 2ITKA 3PRDA 3UI5A 1D7HA 1M5YA 3TDBA 2MNTA 4ODNA 3UF8A 4U85A 4G2PA 4ODMA 3KCEA 1QZ2A 3PRBA 4LAYA 1QPLA 2JZVA 2PPNA 2DG4A 2RSEA 4J4OA 3UQIA 1FKRA 3KADA 2ZR5A 1NMVA 1YW5A 3CGNA 3UI6A 3UQAA 2F2DA 3I6CA 1EQ3A 1EYMA 1A7XA 4TNSA 4ODKA 1J4IA 2KGJA 2XP3A 3KABA 5DITA 2XP6A 1J4HA 3IHZA 5HUAA 3O5FA 2MPHA 1JNSA 1KT0A 4DRJA 1FKKA 4LAWA 4QT2A 1FKHA 1FKSA 5HT1A 2ZQUA 4W9OA 2DG3A 1Q1CA 1FKJA 4JFIA 3NTPA 4R0XA 2RUQA 4C02B 3O5QA
chains in the Genus database with same CATH superfamily
1FKLA 3ARSA 4L72B 4FAPA 2K8IA 4TW6A 1LG1A 4DZ2A 1WNOA 1FD9A 4TX0A 2FKEA 1WAWA 3WKZA 3O5PA 4JFJA 3ARXA 2OLHA 1FFRA 4HBOA 4Z2KA 3IKDA 4ODOA 2O9OA 4IT6A 3RGCA 2Y78A 4U86A 3UQBA 4URIA 4ZS6A 4WIWA 4KR0B 1FKFA 3ODKA 4PTMA 3B8SA 3PA7A 3TCZA 1ZBKA 2ZQVA 4DWSC 1RD6A 2ESCA 1BL4A 2LGOA 1HXVA 4ODRA 1FKDA 1UR9A 5HBFA 3TC5A 1B6CA 2RUCA 2RURA 4DRPA 4P8VA 5HW7A 3IK8A 2EULA 1W1YA 2WM0A 1E9LA 3FY1A 4DIPA 1X6LA 1F40A 4WK9A 2PV1A 1W26A 4Q22A 3B7XA 3KAFA 4P8UA 4UDMA 1EHNA 1L1PA 4TW7A 3G6LA 2DSWA 2MLZA 4J4NA 1LL4A 1U79A 2KFWA 2PBCA 3BMBA 4MPKA 1GRJA 2FAPA 3KAGA 4R5EA 2PPOA 2N87A 2M1IA 2DT0A 3O5MA 3JXVA 3WH0A 3UI5A 1D7HA 2A3EA 2WK2A 1E6PA 1K9TA 1JNEA 3CHFA 1NMVA 4DWSD 1OGGA 1HJWA 3AS1A 1D2KA 2XP3A 3IHZA 4L3NA 1ZU8A 4QT2A 3RM9A 5HT1A 1HKKA 4W9OA 2A3BA 3NTPA 2RUQA 4C02B 3O5QA 1FKGA 4MAVA 1KT1A 1J6YA 2ZQTA 3AQUA 1W1VA 5GQBA 3GU0A 2DG9A 1Y0OA 3NI6A 3KZ7A 4WKFA 4Q7NA 1P5QA 1HKJA 1W9VA 2AOSA 3CHEA 3AROA 3WQWA 1Q6HA 3ARVA 1LQ0A 3CHCA 4ODQA 1D6OA 4S3KA 4N19A 4QIBA 1YATA 3AS0A 4MSPA 2WLZA 4IQCA 1HJVA 3AS2A 1C9HA 4W5UA 1NWUA 2PI6A 3O5EA 2VN1A 4NNRA 1JCHB 4LGXA 4JYSA 3KACA 1ROUA 3O5LA 3ALGA 2YBUA 1R9HA 3LUOA 4JFMA 1FKRA 1PINA 3O5GA 4W9QA 1TCOC 2XPAA 3GPKA 2PV2A 3RM4A 5DF0A 2DSZA 2XP5A 3EY6A 1FAPA 4DRHA 2OFNA 4MNKA 2MF9A 1QPFA 1LG2A 5HTGA 5DIUA 1BKFA 2KI3A 3PRAA 3QOKA 1JNTA 4JFLA 1XHGA 3RFWA 3B9DA 2B31A 3JYJA 1E15A 1FKIA 3ARWA 1PBKA 4DRKA 5HWBA 1LJYA 2WLYA 3PRDA 4NSBA 3TDBA 1M5YA 4NZCA 1H0IA 3G6MA 1QZ2A 3PRBA 4LAYA 1QPLA 2JZVA 2DG4A 3WD2A 3KADA 3ARTA 3BXWA 3UI6A 3UQAA 3I6CA 1A7XA 4ODKA 1J4IA 2KGJA 3O5FA 2MPHA 2IUZA 4S3JA 4AY1A 1VF8A 2ZQUA 1FKJA 4Z2GA 4DZ3A 2XPBA 2AWGA 3O5OA 1ZB5A 2L2SA 3OA5A 4DROA 2G41A 2KR7A 4TW8A 3EIPA 2ETNA 4W9PA 1H0GA 1T11A 4IPXA 4DWSA 3O5JA 3ARQA 4DRQA 3IKGA 3ARPA 2XP7A 1EIBA 4MNJA 3WD0A 3NRKA 2F4EA 4ITZA 2XP9A 1NWTA 2YBTA 1KFWA 3FAPA 5J6EA 2A3AA 1SR0A 2IF4A 4ZPVR 1W9UA 4P8WA 2M2AA 3JYMA 4LAXA 4BF8A 1OGBA 4LAVA 3ARUA 4FN2A 5HWCA 1ZK6A 4ZPWR 4DWSB 4ZPTR 2KE0A 3WD3A 2RUDA 1JNDA 3OOBA 3PR9A 2DT1A 2MLYA 1FKTA 5HW8A 1TFVA 1LL6A 4DRNA 2ZR4A 4ODPA 3CH9A 1OWQA 2ZQSA 2FDMA 2UZ5A 4WKAA 4XAKA 3UI4A 3MDYB 4QT3A 4G50A 1GUVA 1NWSA 1W9PA 1ZL1A 1NMWA 3B9EA 3WD1A 1F8AB 3WIJA 2O92A 2MNTA 3UF8A 4G2PA 4ODMA 4Z2JA 2PPNA 4J4OA 5DO2A 3UQIA 3CGNA 1YW5A 3ALFA 1ZBCA 1UR8A 2F2DA 1EQ3A 2A3CA 1EYMA 4TNSA 5DITA 1J4HA 2P4VA 5HUAA 1FKKA 4LAWA 1FKSA 1ZBWA 2DG3A 1Q1CA 4JFIA 4R0XA 5DEZA 3O5RA 1ITXA 3B9AA 2RQSA 1O6IA 5HKGA 2XP4A 2B5UB 3CGMA 3CZ8A 4DRIA 1ROTA 4Z2HA 1Q6IA 5BXJA 4GGQA 3WL1A 1FKBA 3KAIA 1EDQA 3O5KA 1LL7A 1D7JA 4DRMA 1J4RA 4GIVA 3VAWA 2M08A 2VCDA 3WD4A 3O5IA 1NSGA 5DIVA 5GPRA 5B8IC 2MLXA 1E6NA 4ODLA 5I98A 1JVWA 5JH8A 4P8XA 4DT4A 4HARA 1N1AA 4DH0A 3RM8A 1HJXA 2LKNA 2G8ZA 2KO7A 4KQZA 4Z2LA 4MNLA 1GPFA 1FJDA 4U84A 1CTNA 4JFKA 4MGVA 4IT4A 3ARRA 3GTYX 2LPVA 1E6RA 2F21A 1HKIA 2PV3A 3KAHA 2DSUA 4IQ2A 5HW6A 2ZR6A 4TYOA 3AS3A 3H9RB 1D7IA 1SYTA 4Z2IA 1HKMA 1ZCNA 1E44A 4MNMA 3O5DA 3WL0A 1Q6UA 2QF8A 1IX5A 4O2TA 2PN0A 1ZBVA 2PPPA 5GPGA 2XP8A 4HBEA 2Q5AA 2F23A 4MTVA 3CHDA 2DT3A 1FFQA 2LJ4A 4WJXA 2D9FA 2ITKA 1W1PA 1NH6A 4ML4A 2DT2A 4ODNA 3ARZA 4U85A 3KCEA 1W1TA 3ARYA 2RSEA 1XRVA 2DPEA 2ZR5A 4WKHA 3FXYA 3KABA 2XP6A 1X6NA 2DSVA 3W4RA 1KT0A 4DRJA 1JNSA 1FKHA 4QZVB 1NWRA 3WQVA 1E6ZA 1WB0A 1GOIA 5D75A 3RMEA
chains in the Genus database with same CATH topology
1FKLA 3ARSA 4L72B 4FAPA 2K8IA 4TW6A 1LG1A 4DZ2A 1WNOA 1FD9A 4TX0A 2FKEA 1WAWA 3WKZA 3O5PA 4JFJA 3ARXA 2OLHA 1FFRA 4HBOA 4Z2KA 3IKDA 4ODOA 2O9OA 4IT6A 3RGCA 2Y78A 4U86A 3UQBA 4URIA 4ZS6A 4WIWA 4KR0B 1FKFA 3ODKA 4PTMA 3B8SA 3PA7A 3TCZA 1ZBKA 2ZQVA 4DWSC 1RD6A 2ESCA 1BL4A 2LGOA 1HXVA 4ODRA 1FKDA 1UR9A 5HBFA 3TC5A 1B6CA 2RUCA 2RURA 4DRPA 4P8VA 5HW7A 3IK8A 1W1YA 2WM0A 1E9LA 3FY1A 4DIPA 1X6LA 1F40A 4WK9A 2PV1A 1W26A 4Q22A 3B7XA 3KAFA 4P8UA 1EHNA 1L1PA 4TW7A 3G6LA 2DSWA 2MLZA 4J4NA 1LL4A 1U79A 2KFWA 2PBCA 4MPKA 2FAPA 3KAGA 4R5EA 2PPOA 2N87A 2M1IA 2DT0A 3O5MA 3JXVA 3WH0A 3UI5A 1D7HA 2A3EA 2WK2A 1E6PA 1K9TA 1JNEA 3CHFA 1NMVA 4DWSD 1OGGA 1HJWA 3AS1A 1D2KA 2XP3A 3IHZA 4L3NA 1ZU8A 4QT2A 3RM9A 5HT1A 1HKKA 4W9OA 2A3BA 3NTPA 2RUQA 4C02B 3O5QA 1FKGA 4MAVA 1KT1A 1J6YA 2ZQTA 3AQUA 1W1VA 5GQBA 2DG9A 1Y0OA 3NI6A 3KZ7A 4WKFA 4Q7NA 1P5QA 1HKJA 1W9VA 2AOSA 3CHEA 3AROA 3WQWA 1Q6HA 3ARVA 1LQ0A 3CHCA 4ODQA 1D6OA 4S3KA 4N19A 4QIBA 1YATA 3AS0A 4MSPA 2WLZA 4IQCA 1HJVA 3AS2A 1C9HA 4W5UA 1NWUA 2PI6A 3O5EA 2VN1A 4NNRA 4LGXA 4JYSA 3KACA 1ROUA 3O5LA 3ALGA 2YBUA 1R9HA 3LUOA 4JFMA 1FKRA 1PINA 3O5GA 4W9QA 1TCOC 2XPAA 3GPKA 2PV2A 3RM4A 5DF0A 2DSZA 2XP5A 3EY6A 1FAPA 4DRHA 2OFNA 4MNKA 2MF9A 1QPFA 1LG2A 5HTGA 5DIUA 1BKFA 2KI3A 3PRAA 3QOKA 1JNTA 4JFLA 1XHGA 3RFWA 3B9DA 2B31A 3JYJA 1E15A 1FKIA 3ARWA 1PBKA 4DRKA 5HWBA 1LJYA 2WLYA 3PRDA 4NSBA 3TDBA 1M5YA 4NZCA 1H0IA 3G6MA 1QZ2A 3PRBA 4LAYA 1QPLA 2JZVA 2DG4A 3WD2A 3KADA 3ARTA 3BXWA 3UI6A 3UQAA 3I6CA 1A7XA 4ODKA 1J4IA 2KGJA 3O5FA 2MPHA 2IUZA 4S3JA 4AY1A 1VF8A 2ZQUA 1FKJA 4Z2GA 4DZ3A 2XPBA 2AWGA 3O5OA 1ZB5A 2L2SA 3OA5A 4DROA 2G41A 2KR7A 4TW8A 4W9PA 1H0GA 1T11A 4IPXA 4DWSA 3O5JA 3ARQA 4DRQA 3IKGA 3ARPA 2XP7A 1EIBA 4MNJA 3WD0A 3NRKA 2F4EA 4ITZA 2XP9A 1NWTA 2YBTA 1KFWA 3FAPA 5J6EA 2A3AA 1SR0A 2IF4A 4ZPVR 1W9UA 4P8WA 2M2AA 3JYMA 4LAXA 4BF8A 1OGBA 4LAVA 3ARUA 4FN2A 5HWCA 1ZK6A 4ZPWR 4DWSB 4ZPTR 2KE0A 3WD3A 2RUDA 1JNDA 3OOBA 3PR9A 2DT1A 2MLYA 1FKTA 5HW8A 1TFVA 1LL6A 4DRNA 2ZR4A 4ODPA 3CH9A 1OWQA 2ZQSA 2FDMA 2UZ5A 4WKAA 4XAKA 3UI4A 3MDYB 4QT3A 4G50A 1GUVA 1NWSA 1W9PA 1ZL1A 1NMWA 3B9EA 3WD1A 1F8AB 3WIJA 2O92A 2MNTA 3UF8A 4G2PA 4ODMA 4Z2JA 2PPNA 4J4OA 5DO2A 3UQIA 3CGNA 1YW5A 3ALFA 1ZBCA 1UR8A 2F2DA 1EQ3A 2A3CA 1EYMA 4TNSA 5DITA 1J4HA 5HUAA 1FKKA 4LAWA 1FKSA 1ZBWA 2DG3A 1Q1CA 4JFIA 4R0XA 5DEZA 3O5RA 1ITXA 3B9AA 2RQSA 1O6IA 5HKGA 2XP4A 3CGMA 3CZ8A 4DRIA 1ROTA 4Z2HA 1Q6IA 5BXJA 4GGQA 3WL1A 1FKBA 3KAIA 1EDQA 3O5KA 1LL7A 1D7JA 4DRMA 1J4RA 4GIVA 3VAWA 2M08A 2VCDA 3WD4A 3O5IA 1NSGA 5DIVA 5GPRA 5B8IC 2MLXA 1E6NA 4ODLA 5I98A 1JVWA 5JH8A 4P8XA 4DT4A 4HARA 1N1AA 4DH0A 3RM8A 1HJXA 2LKNA 2G8ZA 2KO7A 4KQZA 4Z2LA 4MNLA 1GPFA 1FJDA 4U84A 1CTNA 4JFKA 4MGVA 4IT4A 3ARRA 2LPVA 1E6RA 2F21A 1HKIA 2PV3A 3KAHA 2DSUA 4IQ2A 5HW6A 2ZR6A 4TYOA 3AS3A 3H9RB 1D7IA 1SYTA 4Z2IA 1HKMA 1ZCNA 4MNMA 3O5DA 3WL0A 1Q6UA 2QF8A 1IX5A 4O2TA 1ZBVA 2PPPA 5GPGA 2XP8A 4HBEA 2Q5AA 4MTVA 3CHDA 2DT3A 1FFQA 2LJ4A 4WJXA 2D9FA 2ITKA 1W1PA 1NH6A 4ML4A 2DT2A 4ODNA 3ARZA 4U85A 3KCEA 1W1TA 3ARYA 2RSEA 1XRVA 2DPEA 2ZR5A 4WKHA 3FXYA 3KABA 2XP6A 1X6NA 2DSVA 3W4RA 1KT0A 4DRJA 1JNSA 1FKHA 4QZVB 1NWRA 3WQVA 1E6ZA 1WB0A 1GOIA 5D75A 3RMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5R A;  1FKL A;  1FKG A;  2XPB A;  4DZ3 A;  2AWG A;  3O5O A;  4FAP A;  2L2S A;  1KT1 A;  2RQS A;  4DRO A;  1J6Y A;  2K8I A;  2KR7 A;  2ZQT A;  4TW8 A;  4TW6 A;  4W9P A;  2XP4 A;  4DZ2 A;  5HKG A;  3CGM A;  1FD9 A;  1T11 A;  4DRI A;  1ROT A;  2DG9 A;  1Y0O A;  3NI6 A;  1Q6I A;  3KZ7 A;  4IPX A;  4TX0 A;  2FKE A;  5BXJ A;  4GGQ A;  3O5J A;  3O5P A;  4DRQ A;  4JFJ A;  3IKG A;  1P5Q A;  2XP7 A;  1FKB A;  3KAI A;  3O5K A;  3IKD A;  4ODO A;  1D7J A;  1Q6H A;  3NRK A;  4DRM A;  1J4R A;  4GIV A;  4ODQ A;  2M08 A;  1D6O A;  3RGC A;  2Y78 A;  2VCD A;  4N19 A;  4U86 A;  4QIB A;  3UQB A;  2F4E A;  3O5I A;  1NSG A;  4ITZ A;  1YAT A;  5DIV A;  4MSP A;  2XP9 A;  1FKF A;  5B8I C;  3ODK A;  2MLX A;  4ODL A;  3FAP A;  3PA7 A;  4IQC A;  3TCZ A;  5I98 A;  5J6E A;  1JVW A;  2ZQV A;  1C9H A;  4DT4 A;  1N1A A;  2IF4 A;  4DH0 A;  1BL4 A;  3O5E A;  2LGO A;  2LKN A;  2VN1 A;  1HXV A;  4ODR A;  4NNR A;  2M2A A;  3JYM A;  4LAX A;  4BF8 A;  4JYS A;  2KO7 A;  3KAC A;  1ROU A;  1FKD A;  3O5L A;  3VAW A;  3TC5 A;  1B6C A;  1R9H A;  2RUC A;  3LUO A;  2RUR A;  4JFM A;  4LAV A;  1PIN A;  3O5G A;  4U84 A;  4DRP A;  1FJD A;  5HW7 A;  3IK8 A;  4FN2 A;  4JFK A;  5D75 A;  5HWC A;  1ZK6 A;  4MGV A;  4W9Q A;  4DIP A;  2KE0 A;  1F40 A;  1TCO C;  2XPA A;  2RUD A;  2PV2 A;  2LPV A;  3GPK A;  3OOB A;  2F21 A;  2PV3 A;  2PV1 A;  1W26 A;  2XP5 A;  3EY6 A;  1FAP A;  3KAH A;  2MLY A;  1FKT A;  4IQ2 A;  5HW6 A;  3B7X A;  3KAF A;  5HW8 A;  2ZR6 A;  4DRH A;  2OFN A;  4TYO A;  4DRN A;  3H9R B;  1L1P A;  1D7I A;  2MF9 A;  4TW7 A;  1QPF A;  1ZCN A;  2ZR4 A;  5DIU A;  4ODP A;  5HTG A;  1BKF A;  2KI3 A;  3O5D A;  2ZQS A;  1Q6U A;  2MLZ A;  2UZ5 A;  1JNT A;  4J4N A;  4JFL A;  2PBC A;  1U79 A;  2KFW A;  4O2T A;  2PPP A;  5GPG A;  3UI4 A;  3RFW A;  2XP8 A;  2FAP A;  3MDY B;  4QT3 A;  2Q5A A;  4G50 A;  3KAG A;  2PPO A;  1NMW A;  2N87 A;  3JYJ A;  2M1I A;  1FKI A;  2LJ4 A;  3O5M A;  1F8A B;  1PBK A;  2D9F A;  3JXV A;  3WH0 A;  4DRK A;  5HWB A;  2ITK A;  3PRD A;  3UI5 A;  1D7H A;  1M5Y A;  3TDB A;  2MNT A;  4ODN A;  3UF8 A;  4U85 A;  4G2P A;  4ODM A;  3KCE A;  1QZ2 A;  3PRB A;  4LAY A;  1QPL A;  2JZV A;  2PPN A;  2DG4 A;  2RSE A;  4J4O A;  3UQI A;  1FKR A;  3KAD A;  2ZR5 A;  1NMV A;  1YW5 A;  3CGN A;  3UI6 A;  3UQA A;  2F2D A;  3I6C A;  1EQ3 A;  1EYM A;  1A7X A;  4TNS A;  4ODK A;  1J4I A;  2KGJ A;  2XP3 A;  3KAB A;  5DIT A;  2XP6 A;  1J4H A;  3IHZ A;  5HUA A;  3O5F A;  2MPH A;  1JNS A;  1KT0 A;  4DRJ A;  1FKK A;  4LAW A;  4QT2 A;  1FKH A;  1FKS A;  5HT1 A;  2ZQU A;  4W9O A;  2DG3 A;  1Q1C A;  1FKJ A;  4JFI A;  3NTP A;  4R0X A;  2RUQ A;  4C02 B;  3O5Q A; 
#chains in the Genus database with same CATH topology
 1FKL A;  3ARS A;  4L72 B;  4FAP A;  2K8I A;  4TW6 A;  1LG1 A;  4DZ2 A;  1WNO A;  1FD9 A;  4TX0 A;  2FKE A;  1WAW A;  3WKZ A;  3O5P A;  4JFJ A;  3ARX A;  2OLH A;  1FFR A;  4HBO A;  4Z2K A;  3IKD A;  4ODO A;  2O9O A;  4IT6 A;  3RGC A;  2Y78 A;  4U86 A;  3UQB A;  4URI A;  4ZS6 A;  4WIW A;  4KR0 B;  1FKF A;  3ODK A;  4PTM A;  3B8S A;  3PA7 A;  3TCZ A;  1ZBK A;  2ZQV A;  4DWS C;  1RD6 A;  2ESC A;  1BL4 A;  2LGO A;  1HXV A;  4ODR A;  1FKD A;  1UR9 A;  5HBF A;  3TC5 A;  1B6C A;  2RUC A;  2RUR A;  4DRP A;  4P8V A;  5HW7 A;  3IK8 A;  2EUL A;  1W1Y A;  2WM0 A;  1E9L A;  3FY1 A;  4DIP A;  1X6L A;  1F40 A;  4WK9 A;  2PV1 A;  1W26 A;  4Q22 A;  3B7X A;  3KAF A;  4P8U A;  4UDM A;  1EHN A;  1L1P A;  4TW7 A;  3G6L A;  2DSW A;  2MLZ A;  4J4N A;  1LL4 A;  1U79 A;  2KFW A;  2PBC A;  3BMB A;  4MPK A;  1GRJ A;  2FAP A;  3KAG A;  4R5E A;  2PPO A;  2N87 A;  2M1I A;  2DT0 A;  3O5M A;  3JXV A;  3WH0 A;  3UI5 A;  1D7H A;  2A3E A;  2WK2 A;  1E6P A;  1K9T A;  1JNE A;  3CHF A;  1NMV A;  4DWS D;  1OGG A;  1HJW A;  3AS1 A;  1D2K A;  2XP3 A;  3IHZ A;  4L3N A;  1ZU8 A;  4QT2 A;  3RM9 A;  5HT1 A;  1HKK A;  4W9O A;  2A3B A;  3NTP A;  2RUQ A;  4C02 B;  3O5Q A;  1FKG A;  4MAV A;  1KT1 A;  1J6Y A;  2ZQT A;  3AQU A;  1W1V A;  5GQB A;  3GU0 A;  2DG9 A;  1Y0O A;  3NI6 A;  3KZ7 A;  4WKF A;  4Q7N A;  1P5Q A;  1HKJ A;  1W9V A;  2AOS A;  3CHE A;  3ARO A;  3WQW A;  1Q6H A;  3ARV A;  1LQ0 A;  3CHC A;  4ODQ A;  1D6O A;  4S3K A;  4N19 A;  4QIB A;  1YAT A;  3AS0 A;  4MSP A;  2WLZ A;  4IQC A;  1HJV A;  3AS2 A;  1C9H A;  4W5U A;  1NWU A;  2PI6 A;  3O5E A;  2VN1 A;  4NNR A;  1JCH B;  4LGX A;  4JYS A;  3KAC A;  1ROU A;  3O5L A;  3ALG A;  2YBU A;  1R9H A;  3LUO A;  4JFM A;  1FKR A;  1PIN A;  3O5G A;  4W9Q A;  1TCO C;  2XPA A;  3GPK A;  2PV2 A;  3RM4 A;  5DF0 A;  2DSZ A;  2XP5 A;  3EY6 A;  1FAP A;  4DRH A;  2OFN A;  4MNK A;  2MF9 A;  1QPF A;  1LG2 A;  5HTG A;  5DIU A;  1BKF A;  2KI3 A;  3PRA A;  3QOK A;  1JNT A;  4JFL A;  1XHG A;  3RFW A;  3B9D A;  2B31 A;  3JYJ A;  1E15 A;  1FKI A;  3ARW A;  1PBK A;  4DRK A;  5HWB A;  1LJY A;  2WLY A;  3PRD A;  4NSB A;  3TDB A;  1M5Y A;  4NZC A;  1H0I A;  3G6M A;  1QZ2 A;  3PRB A;  4LAY A;  1QPL A;  2JZV A;  2DG4 A;  3WD2 A;  3KAD A;  3ART A;  3BXW A;  3UI6 A;  3UQA A;  3I6C A;  1A7X A;  4ODK A;  1J4I A;  2KGJ A;  3O5F A;  2MPH A;  2IUZ A;  4S3J A;  4AY1 A;  1VF8 A;  2ZQU A;  1FKJ A;  4Z2G A;  4DZ3 A;  2XPB A;  2AWG A;  3O5O A;  1ZB5 A;  2L2S A;  3OA5 A;  4DRO A;  2G41 A;  2KR7 A;  4TW8 A;  3EIP A;  2ETN A;  4W9P A;  1H0G A;  1T11 A;  4IPX A;  4DWS A;  3O5J A;  3ARQ A;  4DRQ A;  3IKG A;  3ARP A;  2XP7 A;  1EIB A;  4MNJ A;  3WD0 A;  3NRK A;  2F4E A;  4ITZ A;  2XP9 A;  1NWT A;  2YBT A;  1KFW A;  3FAP A;  5J6E A;  2A3A A;  1SR0 A;  2IF4 A;  4ZPV R;  1W9U A;  4P8W A;  2M2A A;  3JYM A;  4LAX A;  4BF8 A;  1OGB A;  4LAV A;  3ARU A;  4FN2 A;  5HWC A;  1ZK6 A;  4ZPW R;  4DWS B;  4ZPT R;  2KE0 A;  3WD3 A;  2RUD A;  1JND A;  3OOB A;  3PR9 A;  2DT1 A;  2MLY A;  1FKT A;  5HW8 A;  1TFV A;  1LL6 A;  4DRN A;  2ZR4 A;  4ODP A;  3CH9 A;  1OWQ A;  2ZQS A;  2FDM A;  2UZ5 A;  4WKA A;  4XAK A;  3UI4 A;  3MDY B;  4QT3 A;  4G50 A;  1GUV A;  1NWS A;  1W9P A;  1ZL1 A;  1NMW A;  3B9E A;  3WD1 A;  1F8A B;  3WIJ A;  2O92 A;  2MNT A;  3UF8 A;  4G2P A;  4ODM A;  4Z2J A;  2PPN A;  4J4O A;  5DO2 A;  3UQI A;  3CGN A;  1YW5 A;  3ALF A;  1ZBC A;  1UR8 A;  2F2D A;  1EQ3 A;  2A3C A;  1EYM A;  4TNS A;  5DIT A;  1J4H A;  2P4V A;  5HUA A;  1FKK A;  4LAW A;  1FKS A;  1ZBW A;  2DG3 A;  1Q1C A;  4JFI A;  4R0X A;  5DEZ A;  3O5R A;  1ITX A;  3B9A A;  2RQS A;  1O6I A;  5HKG A;  2XP4 A;  2B5U B;  3CGM A;  3CZ8 A;  4DRI A;  1ROT A;  4Z2H A;  1Q6I A;  5BXJ A;  4GGQ A;  3WL1 A;  1FKB A;  3KAI A;  1EDQ A;  3O5K A;  1LL7 A;  1D7J A;  4DRM A;  1J4R A;  4GIV A;  3VAW A;  2M08 A;  2VCD A;  3WD4 A;  3O5I A;  1NSG A;  5DIV A;  5GPR A;  5B8I C;  2MLX A;  1E6N A;  4ODL A;  5I98 A;  1JVW A;  5JH8 A;  4P8X A;  4DT4 A;  4HAR A;  1N1A A;  4DH0 A;  3RM8 A;  1HJX A;  2LKN A;  2G8Z A;  2KO7 A;  4KQZ A;  4Z2L A;  4MNL A;  1GPF A;  1FJD A;  4U84 A;  1CTN A;  4JFK A;  4MGV A;  4IT4 A;  3ARR A;  3GTY X;  2LPV A;  1E6R A;  2F21 A;  1HKI A;  2PV3 A;  3KAH A;  2DSU A;  4IQ2 A;  5HW6 A;  2ZR6 A;  4TYO A;  3AS3 A;  3H9R B;  1D7I A;  1SYT A;  4Z2I A;  1HKM A;  1ZCN A;  1E44 A;  4MNM A;  3O5D A;  3WL0 A;  1Q6U A;  2QF8 A;  1IX5 A;  4O2T A;  2PN0 A;  1ZBV A;  2PPP A;  5GPG A;  2XP8 A;  4HBE A;  2Q5A A;  2F23 A;  4MTV A;  3CHD A;  2DT3 A;  1FFQ A;  2LJ4 A;  4WJX A;  2D9F A;  2ITK A;  1W1P A;  1NH6 A;  4ML4 A;  2DT2 A;  4ODN A;  3ARZ A;  4U85 A;  3KCE A;  1W1T A;  3ARY A;  2RSE A;  1XRV A;  2DPE A;  2ZR5 A;  4WKH A;  3FXY A;  3KAB A;  2XP6 A;  1X6N A;  2DSV A;  3W4R A;  1KT0 A;  4DRJ A;  1JNS A;  1FKH A;  4QZV B;  1NWR A;  3WQV A;  1E6Z A;  1WB0 A;  1GOI A;  5D75 A;  3RME A; 
#chains in the Genus database with same CATH homology
 1FKL A;  3ARS A;  4L72 B;  4FAP A;  2K8I A;  4TW6 A;  1LG1 A;  4DZ2 A;  1WNO A;  1FD9 A;  4TX0 A;  2FKE A;  1WAW A;  3WKZ A;  3O5P A;  4JFJ A;  3ARX A;  2OLH A;  1FFR A;  4HBO A;  4Z2K A;  3IKD A;  4ODO A;  2O9O A;  4IT6 A;  3RGC A;  2Y78 A;  4U86 A;  3UQB A;  4URI A;  4ZS6 A;  4WIW A;  4KR0 B;  1FKF A;  3ODK A;  4PTM A;  3B8S A;  3PA7 A;  3TCZ A;  1ZBK A;  2ZQV A;  4DWS C;  1RD6 A;  2ESC A;  1BL4 A;  2LGO A;  1HXV A;  4ODR A;  1FKD A;  1UR9 A;  5HBF A;  3TC5 A;  1B6C A;  2RUC A;  2RUR A;  4DRP A;  4P8V A;  5HW7 A;  3IK8 A;  1W1Y A;  2WM0 A;  1E9L A;  3FY1 A;  4DIP A;  1X6L A;  1F40 A;  4WK9 A;  2PV1 A;  1W26 A;  4Q22 A;  3B7X A;  3KAF A;  4P8U A;  1EHN A;  1L1P A;  4TW7 A;  3G6L A;  2DSW A;  2MLZ A;  4J4N A;  1LL4 A;  1U79 A;  2KFW A;  2PBC A;  4MPK A;  2FAP A;  3KAG A;  4R5E A;  2PPO A;  2N87 A;  2M1I A;  2DT0 A;  3O5M A;  3JXV A;  3WH0 A;  3UI5 A;  1D7H A;  2A3E A;  2WK2 A;  1E6P A;  1K9T A;  1JNE A;  3CHF A;  1NMV A;  4DWS D;  1OGG A;  1HJW A;  3AS1 A;  1D2K A;  2XP3 A;  3IHZ A;  4L3N A;  1ZU8 A;  4QT2 A;  3RM9 A;  5HT1 A;  1HKK A;  4W9O A;  2A3B A;  3NTP A;  2RUQ A;  4C02 B;  3O5Q A;  1FKG A;  4MAV A;  1KT1 A;  1J6Y A;  2ZQT A;  3AQU A;  1W1V A;  5GQB A;  2DG9 A;  1Y0O A;  3NI6 A;  3KZ7 A;  4WKF A;  4Q7N A;  1P5Q A;  1HKJ A;  1W9V A;  2AOS A;  3CHE A;  3ARO A;  3WQW A;  1Q6H A;  3ARV A;  1LQ0 A;  3CHC A;  4ODQ A;  1D6O A;  4S3K A;  4N19 A;  4QIB A;  1YAT A;  3AS0 A;  4MSP A;  2WLZ A;  4IQC A;  1HJV A;  3AS2 A;  1C9H A;  4W5U A;  1NWU A;  2PI6 A;  3O5E A;  2VN1 A;  4NNR A;  4LGX A;  4JYS A;  3KAC A;  1ROU A;  3O5L A;  3ALG A;  2YBU A;  1R9H A;  3LUO A;  4JFM A;  1FKR A;  1PIN A;  3O5G A;  4W9Q A;  1TCO C;  2XPA A;  3GPK A;  2PV2 A;  3RM4 A;  5DF0 A;  2DSZ A;  2XP5 A;  3EY6 A;  1FAP A;  4DRH A;  2OFN A;  4MNK A;  2MF9 A;  1QPF A;  1LG2 A;  5HTG A;  5DIU A;  1BKF A;  2KI3 A;  3PRA A;  3QOK A;  1JNT A;  4JFL A;  1XHG A;  3RFW A;  3B9D A;  2B31 A;  3JYJ A;  1E15 A;  1FKI A;  3ARW A;  1PBK A;  4DRK A;  5HWB A;  1LJY A;  2WLY A;  3PRD A;  4NSB A;  3TDB A;  1M5Y A;  4NZC A;  1H0I A;  3G6M A;  1QZ2 A;  3PRB A;  4LAY A;  1QPL A;  2JZV A;  2DG4 A;  3WD2 A;  3KAD A;  3ART A;  3BXW A;  3UI6 A;  3UQA A;  3I6C A;  1A7X A;  4ODK A;  1J4I A;  2KGJ A;  3O5F A;  2MPH A;  2IUZ A;  4S3J A;  4AY1 A;  1VF8 A;  2ZQU A;  1FKJ A;  4Z2G A;  4DZ3 A;  2XPB A;  2AWG A;  3O5O A;  1ZB5 A;  2L2S A;  3OA5 A;  4DRO A;  2G41 A;  2KR7 A;  4TW8 A;  4W9P A;  1H0G A;  1T11 A;  4IPX A;  4DWS A;  3O5J A;  3ARQ A;  4DRQ A;  3IKG A;  3ARP A;  2XP7 A;  1EIB A;  4MNJ A;  3WD0 A;  3NRK A;  2F4E A;  4ITZ A;  2XP9 A;  1NWT A;  2YBT A;  1KFW A;  3FAP A;  5J6E A;  2A3A A;  1SR0 A;  2IF4 A;  4ZPV R;  1W9U A;  4P8W A;  2M2A A;  3JYM A;  4LAX A;  4BF8 A;  1OGB A;  4LAV A;  3ARU A;  4FN2 A;  5HWC A;  1ZK6 A;  4ZPW R;  4DWS B;  4ZPT R;  2KE0 A;  3WD3 A;  2RUD A;  1JND A;  3OOB A;  3PR9 A;  2DT1 A;  2MLY A;  1FKT A;  5HW8 A;  1TFV A;  1LL6 A;  4DRN A;  2ZR4 A;  4ODP A;  3CH9 A;  1OWQ A;  2ZQS A;  2FDM A;  2UZ5 A;  4WKA A;  4XAK A;  3UI4 A;  3MDY B;  4QT3 A;  4G50 A;  1GUV A;  1NWS A;  1W9P A;  1ZL1 A;  1NMW A;  3B9E A;  3WD1 A;  1F8A B;  3WIJ A;  2O92 A;  2MNT A;  3UF8 A;  4G2P A;  4ODM A;  4Z2J A;  2PPN A;  4J4O A;  5DO2 A;  3UQI A;  3CGN A;  1YW5 A;  3ALF A;  1ZBC A;  1UR8 A;  2F2D A;  1EQ3 A;  2A3C A;  1EYM A;  4TNS A;  5DIT A;  1J4H A;  5HUA A;  1FKK A;  4LAW A;  1FKS A;  1ZBW A;  2DG3 A;  1Q1C A;  4JFI A;  4R0X A;  5DEZ A;  3O5R A;  1ITX A;  3B9A A;  2RQS A;  1O6I A;  5HKG A;  2XP4 A;  3CGM A;  3CZ8 A;  4DRI A;  1ROT A;  4Z2H A;  1Q6I A;  5BXJ A;  4GGQ A;  3WL1 A;  1FKB A;  3KAI A;  1EDQ A;  3O5K A;  1LL7 A;  1D7J A;  4DRM A;  1J4R A;  4GIV A;  3VAW A;  2M08 A;  2VCD A;  3WD4 A;  3O5I A;  1NSG A;  5DIV A;  5GPR A;  5B8I C;  2MLX A;  1E6N A;  4ODL A;  5I98 A;  1JVW A;  5JH8 A;  4P8X A;  4DT4 A;  4HAR A;  1N1A A;  4DH0 A;  3RM8 A;  1HJX A;  2LKN A;  2G8Z A;  2KO7 A;  4KQZ A;  4Z2L A;  4MNL A;  1GPF A;  1FJD A;  4U84 A;  1CTN A;  4JFK A;  4MGV A;  4IT4 A;  3ARR A;  2LPV A;  1E6R A;  2F21 A;  1HKI A;  2PV3 A;  3KAH A;  2DSU A;  4IQ2 A;  5HW6 A;  2ZR6 A;  4TYO A;  3AS3 A;  3H9R B;  1D7I A;  1SYT A;  4Z2I A;  1HKM A;  1ZCN A;  4MNM A;  3O5D A;  3WL0 A;  1Q6U A;  2QF8 A;  1IX5 A;  4O2T A;  1ZBV A;  2PPP A;  5GPG A;  2XP8 A;  4HBE A;  2Q5A A;  4MTV A;  3CHD A;  2DT3 A;  1FFQ A;  2LJ4 A;  4WJX A;  2D9F A;  2ITK A;  1W1P A;  1NH6 A;  4ML4 A;  2DT2 A;  4ODN A;  3ARZ A;  4U85 A;  3KCE A;  1W1T A;  3ARY A;  2RSE A;  1XRV A;  2DPE A;  2ZR5 A;  4WKH A;  3FXY A;  3KAB A;  2XP6 A;  1X6N A;  2DSV A;  3W4R A;  1KT0 A;  4DRJ A;  1JNS A;  1FKH A;  4QZV B;  1NWR A;  3WQV A;  1E6Z A;  1WB0 A;  1GOI A;  5D75 A;  3RME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...