2PPPA

Crystal structure of e60q mutant of fkbp12
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWQEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 1A
publication title Structural coupling between FKBP12 and buried water.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 30
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2pppA00
2FAPA 3JYJA 5HW7A 1FKSA 4J4NA 5J6EA 1HXVA 2VN1A 3IHZA 1QPLA 1FKTA 1J4IA 1C9HA 3KAGA 2AWGA 5DITA 4W9PA 2FKEA 2XP4A 2KGJA 4ODLA 5D75A 4DZ3A 2KR7A 1KT1A 1U79A 1ROTA 1FD9A 3JXVA 3PRBA 3O5PA 4U84A 4TW8A 1JNSA 1D7JA 1Y0OA 1KT0A 1D7IA 2VCDA 4IPXA 4J4OA 2KO7A 4W9OA 3KAHA 4JFJA 1YATA 3I6CA 4ITZA 2RUCA 4NNRA 1R9HA 3O5JA 2ZQSA 3KADA 1TCOC 4GIVA 4TYOA 3O5OA 4ODRA 2PV1A 2D9FA 4U86A 1JVWA 4ODPA 2DG9A 1EQ3A 1L1PA 2XP6A 2XP7A 2RSEA 1ZCNA 2KE0A 2XP9A 2XPBA 1M5YA 3IK8A 3NRKA 2DG4A 1FKKA 3TCZA 1B6CA 2KFWA 4GGQA 3O5EA 4R0XA 2ZQVA 2MLZA 5HKGA 2ZR6A 4LAWA 4IQCA 3CGMA 2ITKA 4DRPA 1FKJA 4TNSA 4BF8A 1FKLA 1J6YA 1FKFA 3O5QA 2MF9A 2XP3A 4MSPA 1BKFA 1FKBA 2OFNA 3CGNA 5GPGA 2MNTA 2LKNA 2ZR5A 1Q1CA 3FAPA 2MPHA 3O5IA 3O5LA 2Q5AA 1ZK6A 2IF4A 5DIVA 3VAWA 4DH0A 5B8IC 4ODQA 4JFKA 4TW7A 5HW6A 3PA7A 1YW5A 3B7XA 4W9QA 1FKDA 2MLYA 4ODOA 3RGCA 2F4EA 1FJDA 3NI6A 2PPOA 1BL4A 3KAFA 2M1IA 3UF8A 4DRKA 2DG3A 4JFIA 1Q6UA 3TC5A 2XP5A 1JNTA 1NSGA 4DIPA 1D6OA 3O5GA 3JYMA 1J4RA 2PV3A 4TW6A 3UI4A 5HW8A 3KCEA 3UI6A 5HUAA 2LGOA 3IKDA 4QT2A 4DRIA 2ZR4A 4QT3A 4DRMA 1T11A 3O5FA 2XP8A 1NMVA 4DRJA 3NTPA 4LAYA 5HWBA 3KABA 3KACA 4DRQA 1F8AB 3GPKA 4QIBA 1FAPA 1N1AA 1QZ2A 2JZVA 3KZ7A 1Q6IA 4DZ2A 2RQSA 2XPAA 4MGVA 1D7HA 2N87A 2RUQA 3LUOA 4G50A 1ROUA 2RURA 4IQ2A 3UQBA 2PV2A 3ODKA 4FAPA 2LJ4A 4ODNA 3TDBA 3H9RB 4DRNA 1FKGA 4JFLA 4C02B 2LPVA 3O5RA 4ODKA 5BXJA 1FKRA 3O5KA 4LAXA 5HTGA 2Y78A 4DRHA 4N19A 1NMWA 2PPPA 2M08A 2ZQUA 1F40A 3IKGA 1PINA 3UQIA 4LAVA 2M2AA 2RUDA 2F2DA 2K8IA 1A7XA 4ODMA 2PPNA 2PBCA 3OOBA 3RFWA 3WH0A 3O5MA 4DROA 1PBKA 1J4HA 3UI5A 1FKHA 1EYMA 2UZ5A 2ZQTA 4O2TA 2L2SA 3PRDA 1FKIA 1P5QA 4JYSA 4U85A 2MLXA 5HT1A 3MDYB 3KAIA 5HWCA 3EY6A 1Q6HA 1QPFA 5DIUA 4DT4A 5I98A 4FN2A 4G2PA 4TX0A 2F21A 3O5DA 1W26A 2KI3A 4JFMA 3UQAA
chains in the Genus database with same CATH superfamily
4DWSD 2FAPA 1XRVA 1CTNA 4ZPVR 4NSBA 1FKTA 4WJXA 1C9HA 4DZ3A 1WNOA 2KGJA 2KR7A 1ROTA 2DT2A 4DWSB 4URIA 1NWTA 1Y0OA 2WLZA 4IPXA 3AS3A 3CZ8A 3QOKA 2PV1A 2D9FA 4HBOA 1XHGA 2DG9A 1GPFA 1EQ3A 2XP7A 2XP9A 1LL7A 3TCZA 2WLYA 1HKJA 4MNLA 3CGMA 1LG1A 4BF8A 1J6YA 1FKLA 1FKFA 2MF9A 2XP3A 1BKFA 5GPGA 3G6LA 2ZR5A 3AS2A 3O5LA 1ZK6A 3ARXA 1GUVA 4ODQA 4MNKA 1FKDA 2MLYA 2F4EA 2PPOA 1BL4A 2P4VA 3UF8A 4DRKA 1O6IA 1Q6UA 1IX5A 1JNTA 4DIPA 1D6OA 3O5GA 3JYMA 1J4RA 1W1YA 3ARTA 1SYTA 2LGOA 4DRIA 2ZR4A 3O5FA 1NMVA 4WKAA 4LAYA 1ZBCA 4DRQA 1F8AB 4P8WA 3LUOA 2N87A 1NH6A 1NWUA 4FAPA 2LJ4A 3BXWA 4Z2IA 5BXJA 1FKRA 2Y78A 4DRHA 1E9LA 4L72B 4P8VA 1E6NA 4DROA 3CH9A 3O5MA 3UI5A 1FKHA 4Q7NA 2ZQTA 4KR0B 2L2SA 4O2TA 5GPRA 1P5QA 4JYSA 4U85A 2MLXA 5HWCA 1QPFA 5DIUA 3FY1A 4G2PA 4TX0A 2F21A 4P8XA 4QZVB 1K9TA 5DEZA 1EIBA 3AS1A 1QPLA 3CHDA 1E15A 5DITA 2AWGA 3WIJA 2A3BA 1KT1A 1E44A 1FFQA 3WD0A 3PRBA 4TW8A 4W9OA 4Z2JA 1KT0A 1ZL1A 2AOSA 3B9AA 2OLHA 3EIPA 4L3NA 3O5OA 1OGGA 4ODRA 1L1PA 3ALGA 1GOIA 1HJXA 1ZCNA 2KE0A 2RSEA 3RM8A 4XAKA 1SR0A 2O9OA 4GGQA 4R0XA 2MLZA 2ZR6A 4DWSC 4DWSA 4LAWA 3W4RA 2ITKA 2DSUA 1JCHB 4MAVA 3CGNA 1HKKA 3CHEA 2MNTA 1Q1CA 3FAPA 1X6LA 3ARPA 2MPHA 3CHCA 2Q5AA 1EDQA 5B8IC 4Q22A 3B7XA 1YW5A 1HKIA 3ARQA 4W9QA 1LG2A 2DSZA 1FJDA 4LGXA 3ARUA 2XP5A 5HW8A 3ARWA 2PV3A 3UI4A 3WD3A 5HUAA 4W5UA 3B8SA 4KQZA 4QT2A 3ARRA 2B5UB 2XP8A 1QZ2A 2O92A 2DT3A 3KZ7A 2DSWA 2WK2A 5DF0A 3GU0A 1D7HA 2RUQA 4IQ2A 2B31A 3ODKA 3TDBA 1FKGA 2A3AA 1LQ0A 2LPVA 4Z2KA 4ZPTR 4C02B 1FFRA 4LAXA 5HTGA 3WQVA 2G41A 1NMWA 4R5EA 2ZQUA 4IT4A 4MNMA 1EHNA 1NWSA 4WK9A 4ODMA 2F2DA 5DO2A 1A7XA 3RM9A 1GRJA 3RFWA 5HBFA 1PBKA 1EYMA 3PRDA 1FKIA 4IT6A 5HT1A 3EY6A 4JFMA 3G6MA 4S3KA 2FDMA 1X6NA 2IUZA 2YBTA 4Z2GA 3JYJA 1FKSA 4J4NA 2G8ZA 2VN1A 1J4IA 3KAGA 4HARA 1LL6A 2XP4A 4ODLA 3AQUA 4W9PA 1U79A 4ZPWR 4UDMA 4U84A 1JNSA 1VF8A 4P8UA 4J4OA 2VCDA 1YATA 4ITZA 2RUCA 4NNRA 1R9HA 2ZQSA 3KADA 1TCOC 4GIVA 2WM0A 4TYOA 2A3CA 4U86A 4PTMA 3PRAA 4ODPA 3CHFA 3IK8A 1M5YA 2DG4A 1FKKA 1W1TA 1E6PA 4AY1A 2KFWA 3O5EA 1KFWA 2ZQVA 4DRPA 1FKJA 4MSPA 1FKBA 1W9PA 1UR8A 2OFNA 3FXYA 1H0IA 4ZS6A 3O5IA 3ARSA 2IF4A 5DIVA 3VAWA 4DH0A 4JFKA 4TW7A 5HW6A 3PA7A 3WL1A 3RGCA 3KAFA 2M1IA 2DG3A 4JFIA 3TC5A 2A3EA 3WQWA 4NZCA 4TW6A 3KCEA 3IKDA 1NWRA 4QT3A 1JNDA 3NTPA 3KABA 3KACA 3GPKA 4QIBA 1N1AA 2F23A 1Q6IA 1JNEA 2RQSA 2XPAA 4MGVA 4G50A 4WKHA 2RURA 3UQBA 2PV2A 3B9EA 3WKZA 3B9DA 4DRNA 3O5KA 4N19A 1W1PA 2PPPA 2DT1A 2M08A 1UR9A 3ARZA 1F40A 1PINA 2M2AA 2K8IA 2PPNA 2PBCA 3OOBA 1J4HA 3BMBA 2UZ5A 3WL0A 2PN0A 3KAIA 4DT4A 5I98A 2DT0A 3O5DA 1W26A 2KI3A 1W9VA 1W9UA 3UQAA 4MNJA 5HW7A 1ZBKA 5J6EA 1HKMA 3PR9A 1HXVA 3WD1A 3IHZA 3WD4A 4Z2HA 5D75A 2FKEA 3RM4A 2EULA 1FD9A 3JXVA 5JH8A 3O5PA 1TFVA 2ESCA 4HBEA 1D7JA 1D7IA 2KO7A 1H0GA 3KAHA 4JFJA 1ZBVA 3I6CA 1LJYA 4MTVA 3O5JA 1JVWA 3WD2A 1OWQA 2XP6A 1WB0A 2XPBA 3NRKA 1WAWA 1D2KA 1B6CA 2PI6A 2DPEA 5HKGA 1RD6A 4IQCA 2ETNA 4TNSA 3ALFA 3O5QA 3RMEA 4MPKA 2LKNA 3ARVA 1W1VA 2YBUA 5GQBA 1LL4A 1HJWA 4ODOA 1HJVA 3NI6A 4WIWA 4Z2LA 1NSGA 1E6ZA 2QF8A 1ZB5A 3UI6A 1E6RA 1ITXA 4DRMA 1T11A 4DRJA 1OGBA 5HWBA 1ZBWA 1FAPA 2JZVA 4DZ2A 4S3JA 1ROUA 2DSVA 3AS0A 4ODNA 3AROA 3H9RB 4WKFA 4JFLA 3O5RA 4ODKA 3IKGA 3UQIA 4LAVA 3OA5A 2RUDA 3WH0A 4ML4A 1ZU8A 3MDYB 1Q6HA 3ARYA 4FN2A 3GTYX
chains in the Genus database with same CATH topology
4DWSD 2FAPA 1XRVA 1CTNA 4ZPVR 4NSBA 1FKTA 4WJXA 1C9HA 4DZ3A 1WNOA 2KGJA 2KR7A 1ROTA 2DT2A 4DWSB 4URIA 1NWTA 1Y0OA 2WLZA 4IPXA 3AS3A 3CZ8A 3QOKA 2PV1A 2D9FA 4HBOA 1XHGA 2DG9A 1GPFA 1EQ3A 2XP7A 2XP9A 1LL7A 3TCZA 2WLYA 1HKJA 4MNLA 3CGMA 1LG1A 4BF8A 1J6YA 1FKLA 1FKFA 2MF9A 2XP3A 1BKFA 5GPGA 3G6LA 2ZR5A 3AS2A 3O5LA 1ZK6A 3ARXA 1GUVA 4ODQA 4MNKA 1FKDA 2MLYA 2F4EA 2PPOA 1BL4A 3UF8A 4DRKA 1O6IA 1Q6UA 1IX5A 1JNTA 4DIPA 1D6OA 3O5GA 3JYMA 1J4RA 1W1YA 3ARTA 1SYTA 2LGOA 4DRIA 2ZR4A 3O5FA 1NMVA 4WKAA 4LAYA 1ZBCA 4DRQA 1F8AB 4P8WA 3LUOA 2N87A 1NH6A 1NWUA 4FAPA 2LJ4A 3BXWA 4Z2IA 5BXJA 1FKRA 2Y78A 4DRHA 1E9LA 4L72B 4P8VA 1E6NA 4DROA 3CH9A 3O5MA 3UI5A 1FKHA 4Q7NA 2ZQTA 4KR0B 2L2SA 4O2TA 5GPRA 1P5QA 4JYSA 4U85A 2MLXA 5HWCA 1QPFA 5DIUA 3FY1A 4G2PA 4TX0A 2F21A 4P8XA 4QZVB 1K9TA 5DEZA 1EIBA 3AS1A 1QPLA 3CHDA 1E15A 5DITA 2AWGA 3WIJA 2A3BA 1KT1A 1FFQA 3WD0A 3PRBA 4TW8A 4W9OA 4Z2JA 1KT0A 1ZL1A 2AOSA 3B9AA 2OLHA 4L3NA 3O5OA 1OGGA 4ODRA 1L1PA 3ALGA 1GOIA 1HJXA 1ZCNA 2KE0A 2RSEA 3RM8A 4XAKA 1SR0A 2O9OA 4GGQA 4R0XA 2MLZA 2ZR6A 4DWSC 4DWSA 4LAWA 3W4RA 2ITKA 2DSUA 4MAVA 3CGNA 1HKKA 3CHEA 2MNTA 1Q1CA 3FAPA 1X6LA 3ARPA 2MPHA 3CHCA 2Q5AA 1EDQA 5B8IC 4Q22A 3B7XA 1YW5A 1HKIA 3ARQA 4W9QA 1LG2A 2DSZA 1FJDA 4LGXA 3ARUA 2XP5A 5HW8A 3ARWA 2PV3A 3UI4A 3WD3A 5HUAA 4W5UA 3B8SA 4KQZA 4QT2A 3ARRA 2XP8A 1QZ2A 2O92A 2DT3A 3KZ7A 2DSWA 2WK2A 5DF0A 1D7HA 2RUQA 4IQ2A 2B31A 3ODKA 3TDBA 1FKGA 2A3AA 1LQ0A 2LPVA 4Z2KA 4ZPTR 4C02B 1FFRA 4LAXA 5HTGA 3WQVA 2G41A 1NMWA 4R5EA 2ZQUA 4IT4A 4MNMA 1EHNA 1NWSA 4WK9A 4ODMA 2F2DA 5DO2A 1A7XA 3RM9A 3RFWA 5HBFA 1PBKA 1EYMA 3PRDA 1FKIA 4IT6A 5HT1A 3EY6A 4JFMA 3G6MA 4S3KA 2FDMA 1X6NA 2IUZA 2YBTA 4Z2GA 3JYJA 1FKSA 4J4NA 2G8ZA 2VN1A 1J4IA 3KAGA 4HARA 1LL6A 2XP4A 4ODLA 3AQUA 4W9PA 1U79A 4ZPWR 4U84A 1JNSA 1VF8A 4P8UA 4J4OA 2VCDA 1YATA 4ITZA 2RUCA 4NNRA 1R9HA 2ZQSA 3KADA 1TCOC 4GIVA 2WM0A 4TYOA 2A3CA 4U86A 4PTMA 3PRAA 4ODPA 3CHFA 3IK8A 1M5YA 2DG4A 1FKKA 1W1TA 1E6PA 4AY1A 2KFWA 3O5EA 1KFWA 2ZQVA 4DRPA 1FKJA 4MSPA 1FKBA 1W9PA 1UR8A 2OFNA 3FXYA 1H0IA 4ZS6A 3O5IA 3ARSA 2IF4A 5DIVA 3VAWA 4DH0A 4JFKA 4TW7A 5HW6A 3PA7A 3WL1A 3RGCA 3KAFA 2M1IA 2DG3A 4JFIA 3TC5A 2A3EA 3WQWA 4NZCA 4TW6A 3KCEA 3IKDA 1NWRA 4QT3A 1JNDA 3NTPA 3KABA 3KACA 3GPKA 4QIBA 1N1AA 1Q6IA 1JNEA 2RQSA 2XPAA 4MGVA 4G50A 4WKHA 2RURA 3UQBA 2PV2A 3B9EA 3WKZA 3B9DA 4DRNA 3O5KA 4N19A 1W1PA 2PPPA 2DT1A 2M08A 1UR9A 3ARZA 1F40A 1PINA 2M2AA 2K8IA 2PPNA 2PBCA 3OOBA 1J4HA 2UZ5A 3WL0A 3KAIA 4DT4A 5I98A 2DT0A 3O5DA 1W26A 2KI3A 1W9VA 1W9UA 3UQAA 4MNJA 5HW7A 1ZBKA 5J6EA 1HKMA 3PR9A 1HXVA 3WD1A 3IHZA 3WD4A 4Z2HA 5D75A 2FKEA 3RM4A 1FD9A 3JXVA 5JH8A 3O5PA 1TFVA 2ESCA 4HBEA 1D7JA 1D7IA 2KO7A 1H0GA 3KAHA 4JFJA 1ZBVA 3I6CA 1LJYA 4MTVA 3O5JA 1JVWA 3WD2A 1OWQA 2XP6A 1WB0A 2XPBA 3NRKA 1WAWA 1D2KA 1B6CA 2PI6A 2DPEA 5HKGA 1RD6A 4IQCA 4TNSA 3ALFA 3O5QA 3RMEA 4MPKA 2LKNA 3ARVA 1W1VA 2YBUA 5GQBA 1LL4A 1HJWA 4ODOA 1HJVA 3NI6A 4WIWA 4Z2LA 1NSGA 1E6ZA 2QF8A 1ZB5A 3UI6A 1E6RA 1ITXA 4DRMA 1T11A 4DRJA 1OGBA 5HWBA 1ZBWA 1FAPA 2JZVA 4DZ2A 4S3JA 1ROUA 2DSVA 3AS0A 4ODNA 3AROA 3H9RB 4WKFA 4JFLA 3O5RA 4ODKA 3IKGA 3UQIA 4LAVA 3OA5A 2RUDA 3WH0A 4ML4A 1ZU8A 3MDYB 1Q6HA 3ARYA 4FN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FAP A;  3JYJ A;  5HW7 A;  1FKS A;  4J4N A;  5J6E A;  1HXV A;  2VN1 A;  3IHZ A;  1QPL A;  1FKT A;  1J4I A;  1C9H A;  3KAG A;  2AWG A;  5DIT A;  4W9P A;  2FKE A;  2XP4 A;  2KGJ A;  4ODL A;  5D75 A;  4DZ3 A;  2KR7 A;  1KT1 A;  1U79 A;  1ROT A;  1FD9 A;  3JXV A;  3PRB A;  3O5P A;  4U84 A;  4TW8 A;  1JNS A;  1D7J A;  1Y0O A;  1KT0 A;  1D7I A;  2VCD A;  4IPX A;  4J4O A;  2KO7 A;  4W9O A;  3KAH A;  4JFJ A;  1YAT A;  3I6C A;  4ITZ A;  2RUC A;  4NNR A;  1R9H A;  3O5J A;  2ZQS A;  3KAD A;  1TCO C;  4GIV A;  4TYO A;  3O5O A;  4ODR A;  2PV1 A;  2D9F A;  4U86 A;  1JVW A;  4ODP A;  2DG9 A;  1EQ3 A;  1L1P A;  2XP6 A;  2XP7 A;  2RSE A;  1ZCN A;  2KE0 A;  2XP9 A;  2XPB A;  1M5Y A;  3IK8 A;  3NRK A;  2DG4 A;  1FKK A;  3TCZ A;  1B6C A;  2KFW A;  4GGQ A;  3O5E A;  4R0X A;  2ZQV A;  2MLZ A;  5HKG A;  2ZR6 A;  4LAW A;  4IQC A;  3CGM A;  2ITK A;  4DRP A;  1FKJ A;  4TNS A;  4BF8 A;  1FKL A;  1J6Y A;  1FKF A;  3O5Q A;  2MF9 A;  2XP3 A;  4MSP A;  1BKF A;  1FKB A;  2OFN A;  3CGN A;  5GPG A;  2MNT A;  2LKN A;  2ZR5 A;  1Q1C A;  3FAP A;  2MPH A;  3O5I A;  3O5L A;  2Q5A A;  1ZK6 A;  2IF4 A;  5DIV A;  3VAW A;  4DH0 A;  5B8I C;  4ODQ A;  4JFK A;  4TW7 A;  5HW6 A;  3PA7 A;  1YW5 A;  3B7X A;  4W9Q A;  1FKD A;  2MLY A;  4ODO A;  3RGC A;  2F4E A;  1FJD A;  3NI6 A;  2PPO A;  1BL4 A;  3KAF A;  2M1I A;  3UF8 A;  4DRK A;  2DG3 A;  4JFI A;  1Q6U A;  3TC5 A;  2XP5 A;  1JNT A;  1NSG A;  4DIP A;  1D6O A;  3O5G A;  3JYM A;  1J4R A;  2PV3 A;  4TW6 A;  3UI4 A;  5HW8 A;  3KCE A;  3UI6 A;  5HUA A;  2LGO A;  3IKD A;  4QT2 A;  4DRI A;  2ZR4 A;  4QT3 A;  4DRM A;  1T11 A;  3O5F A;  2XP8 A;  1NMV A;  4DRJ A;  3NTP A;  4LAY A;  5HWB A;  3KAB A;  3KAC A;  4DRQ A;  1F8A B;  3GPK A;  4QIB A;  1FAP A;  1N1A A;  1QZ2 A;  2JZV A;  3KZ7 A;  1Q6I A;  4DZ2 A;  2RQS A;  2XPA A;  4MGV A;  1D7H A;  2N87 A;  2RUQ A;  3LUO A;  4G50 A;  1ROU A;  2RUR A;  4IQ2 A;  3UQB A;  2PV2 A;  3ODK A;  4FAP A;  2LJ4 A;  4ODN A;  3TDB A;  3H9R B;  4DRN A;  1FKG A;  4JFL A;  4C02 B;  2LPV A;  3O5R A;  4ODK A;  5BXJ A;  1FKR A;  3O5K A;  4LAX A;  5HTG A;  2Y78 A;  4DRH A;  4N19 A;  1NMW A;  2PPP A;  2M08 A;  2ZQU A;  1F40 A;  3IKG A;  1PIN A;  3UQI A;  4LAV A;  2M2A A;  2RUD A;  2F2D A;  2K8I A;  1A7X A;  4ODM A;  2PPN A;  2PBC A;  3OOB A;  3RFW A;  3WH0 A;  3O5M A;  4DRO A;  1PBK A;  1J4H A;  3UI5 A;  1FKH A;  1EYM A;  2UZ5 A;  2ZQT A;  4O2T A;  2L2S A;  3PRD A;  1FKI A;  1P5Q A;  4JYS A;  4U85 A;  2MLX A;  5HT1 A;  3MDY B;  3KAI A;  5HWC A;  3EY6 A;  1Q6H A;  1QPF A;  5DIU A;  4DT4 A;  5I98 A;  4FN2 A;  4G2P A;  4TX0 A;  2F21 A;  3O5D A;  1W26 A;  2KI3 A;  4JFM A;  3UQA A; 
#chains in the Genus database with same CATH topology
 4DWS D;  2FAP A;  1XRV A;  1CTN A;  4ZPV R;  4NSB A;  1FKT A;  4WJX A;  1C9H A;  4DZ3 A;  1WNO A;  2KGJ A;  2KR7 A;  1ROT A;  2DT2 A;  4DWS B;  4URI A;  1NWT A;  1Y0O A;  2WLZ A;  4IPX A;  3AS3 A;  3CZ8 A;  3QOK A;  2PV1 A;  2D9F A;  4HBO A;  1XHG A;  2DG9 A;  1GPF A;  1EQ3 A;  2XP7 A;  2XP9 A;  1LL7 A;  3TCZ A;  2WLY A;  1HKJ A;  4MNL A;  3CGM A;  1LG1 A;  4BF8 A;  1J6Y A;  1FKL A;  1FKF A;  2MF9 A;  2XP3 A;  1BKF A;  5GPG A;  3G6L A;  2ZR5 A;  3AS2 A;  3O5L A;  1ZK6 A;  3ARX A;  1GUV A;  4ODQ A;  4MNK A;  1FKD A;  2MLY A;  2F4E A;  2PPO A;  1BL4 A;  2P4V A;  3UF8 A;  4DRK A;  1O6I A;  1Q6U A;  1IX5 A;  1JNT A;  4DIP A;  1D6O A;  3O5G A;  3JYM A;  1J4R A;  1W1Y A;  3ART A;  1SYT A;  2LGO A;  4DRI A;  2ZR4 A;  3O5F A;  1NMV A;  4WKA A;  4LAY A;  1ZBC A;  4DRQ A;  1F8A B;  4P8W A;  3LUO A;  2N87 A;  1NH6 A;  1NWU A;  4FAP A;  2LJ4 A;  3BXW A;  4Z2I A;  5BXJ A;  1FKR A;  2Y78 A;  4DRH A;  1E9L A;  4L72 B;  4P8V A;  1E6N A;  4DRO A;  3CH9 A;  3O5M A;  3UI5 A;  1FKH A;  4Q7N A;  2ZQT A;  4KR0 B;  2L2S A;  4O2T A;  5GPR A;  1P5Q A;  4JYS A;  4U85 A;  2MLX A;  5HWC A;  1QPF A;  5DIU A;  3FY1 A;  4G2P A;  4TX0 A;  2F21 A;  4P8X A;  4QZV B;  1K9T A;  5DEZ A;  1EIB A;  3AS1 A;  1QPL A;  3CHD A;  1E15 A;  5DIT A;  2AWG A;  3WIJ A;  2A3B A;  1KT1 A;  1E44 A;  1FFQ A;  3WD0 A;  3PRB A;  4TW8 A;  4W9O A;  4Z2J A;  1KT0 A;  1ZL1 A;  2AOS A;  3B9A A;  2OLH A;  3EIP A;  4L3N A;  3O5O A;  1OGG A;  4ODR A;  1L1P A;  3ALG A;  1GOI A;  1HJX A;  1ZCN A;  2KE0 A;  2RSE A;  3RM8 A;  4XAK A;  1SR0 A;  2O9O A;  4GGQ A;  4R0X A;  2MLZ A;  2ZR6 A;  4DWS C;  4DWS A;  4LAW A;  3W4R A;  2ITK A;  2DSU A;  1JCH B;  4MAV A;  3CGN A;  1HKK A;  3CHE A;  2MNT A;  1Q1C A;  3FAP A;  1X6L A;  3ARP A;  2MPH A;  3CHC A;  2Q5A A;  1EDQ A;  5B8I C;  4Q22 A;  3B7X A;  1YW5 A;  1HKI A;  3ARQ A;  4W9Q A;  1LG2 A;  2DSZ A;  1FJD A;  4LGX A;  3ARU A;  2XP5 A;  5HW8 A;  3ARW A;  2PV3 A;  3UI4 A;  3WD3 A;  5HUA A;  4W5U A;  3B8S A;  4KQZ A;  4QT2 A;  3ARR A;  2B5U B;  2XP8 A;  1QZ2 A;  2O92 A;  2DT3 A;  3KZ7 A;  2DSW A;  2WK2 A;  5DF0 A;  3GU0 A;  1D7H A;  2RUQ A;  4IQ2 A;  2B31 A;  3ODK A;  3TDB A;  1FKG A;  2A3A A;  1LQ0 A;  2LPV A;  4Z2K A;  4ZPT R;  4C02 B;  1FFR A;  4LAX A;  5HTG A;  3WQV A;  2G41 A;  1NMW A;  4R5E A;  2ZQU A;  4IT4 A;  4MNM A;  1EHN A;  1NWS A;  4WK9 A;  4ODM A;  2F2D A;  5DO2 A;  1A7X A;  3RM9 A;  1GRJ A;  3RFW A;  5HBF A;  1PBK A;  1EYM A;  3PRD A;  1FKI A;  4IT6 A;  5HT1 A;  3EY6 A;  4JFM A;  3G6M A;  4S3K A;  2FDM A;  1X6N A;  2IUZ A;  2YBT A;  4Z2G A;  3JYJ A;  1FKS A;  4J4N A;  2G8Z A;  2VN1 A;  1J4I A;  3KAG A;  4HAR A;  1LL6 A;  2XP4 A;  4ODL A;  3AQU A;  4W9P A;  1U79 A;  4ZPW R;  4UDM A;  4U84 A;  1JNS A;  1VF8 A;  4P8U A;  4J4O A;  2VCD A;  1YAT A;  4ITZ A;  2RUC A;  4NNR A;  1R9H A;  2ZQS A;  3KAD A;  1TCO C;  4GIV A;  2WM0 A;  4TYO A;  2A3C A;  4U86 A;  4PTM A;  3PRA A;  4ODP A;  3CHF A;  3IK8 A;  1M5Y A;  2DG4 A;  1FKK A;  1W1T A;  1E6P A;  4AY1 A;  2KFW A;  3O5E A;  1KFW A;  2ZQV A;  4DRP A;  1FKJ A;  4MSP A;  1FKB A;  1W9P A;  1UR8 A;  2OFN A;  3FXY A;  1H0I A;  4ZS6 A;  3O5I A;  3ARS A;  2IF4 A;  5DIV A;  3VAW A;  4DH0 A;  4JFK A;  4TW7 A;  5HW6 A;  3PA7 A;  3WL1 A;  3RGC A;  3KAF A;  2M1I A;  2DG3 A;  4JFI A;  3TC5 A;  2A3E A;  3WQW A;  4NZC A;  4TW6 A;  3KCE A;  3IKD A;  1NWR A;  4QT3 A;  1JND A;  3NTP A;  3KAB A;  3KAC A;  3GPK A;  4QIB A;  1N1A A;  2F23 A;  1Q6I A;  1JNE A;  2RQS A;  2XPA A;  4MGV A;  4G50 A;  4WKH A;  2RUR A;  3UQB A;  2PV2 A;  3B9E A;  3WKZ A;  3B9D A;  4DRN A;  3O5K A;  4N19 A;  1W1P A;  2PPP A;  2DT1 A;  2M08 A;  1UR9 A;  3ARZ A;  1F40 A;  1PIN A;  2M2A A;  2K8I A;  2PPN A;  2PBC A;  3OOB A;  1J4H A;  3BMB A;  2UZ5 A;  3WL0 A;  2PN0 A;  3KAI A;  4DT4 A;  5I98 A;  2DT0 A;  3O5D A;  1W26 A;  2KI3 A;  1W9V A;  1W9U A;  3UQA A;  4MNJ A;  5HW7 A;  1ZBK A;  5J6E A;  1HKM A;  3PR9 A;  1HXV A;  3WD1 A;  3IHZ A;  3WD4 A;  4Z2H A;  5D75 A;  2FKE A;  3RM4 A;  2EUL A;  1FD9 A;  3JXV A;  5JH8 A;  3O5P A;  1TFV A;  2ESC A;  4HBE A;  1D7J A;  1D7I A;  2KO7 A;  1H0G A;  3KAH A;  4JFJ A;  1ZBV A;  3I6C A;  1LJY A;  4MTV A;  3O5J A;  1JVW A;  3WD2 A;  1OWQ A;  2XP6 A;  1WB0 A;  2XPB A;  3NRK A;  1WAW A;  1D2K A;  1B6C A;  2PI6 A;  2DPE A;  5HKG A;  1RD6 A;  4IQC A;  2ETN A;  4TNS A;  3ALF A;  3O5Q A;  3RME A;  4MPK A;  2LKN A;  3ARV A;  1W1V A;  2YBU A;  5GQB A;  1LL4 A;  1HJW A;  4ODO A;  1HJV A;  3NI6 A;  4WIW A;  4Z2L A;  1NSG A;  1E6Z A;  2QF8 A;  1ZB5 A;  3UI6 A;  1E6R A;  1ITX A;  4DRM A;  1T11 A;  4DRJ A;  1OGB A;  5HWB A;  1ZBW A;  1FAP A;  2JZV A;  4DZ2 A;  4S3J A;  1ROU A;  2DSV A;  3AS0 A;  4ODN A;  3ARO A;  3H9R B;  4WKF A;  4JFL A;  3O5R A;  4ODK A;  3IKG A;  3UQI A;  4LAV A;  3OA5 A;  2RUD A;  3WH0 A;  4ML4 A;  1ZU8 A;  3MDY B;  1Q6H A;  3ARY A;  4FN2 A;  3GTY X; 
#chains in the Genus database with same CATH homology
 4DWS D;  2FAP A;  1XRV A;  1CTN A;  4ZPV R;  4NSB A;  1FKT A;  4WJX A;  1C9H A;  4DZ3 A;  1WNO A;  2KGJ A;  2KR7 A;  1ROT A;  2DT2 A;  4DWS B;  4URI A;  1NWT A;  1Y0O A;  2WLZ A;  4IPX A;  3AS3 A;  3CZ8 A;  3QOK A;  2PV1 A;  2D9F A;  4HBO A;  1XHG A;  2DG9 A;  1GPF A;  1EQ3 A;  2XP7 A;  2XP9 A;  1LL7 A;  3TCZ A;  2WLY A;  1HKJ A;  4MNL A;  3CGM A;  1LG1 A;  4BF8 A;  1J6Y A;  1FKL A;  1FKF A;  2MF9 A;  2XP3 A;  1BKF A;  5GPG A;  3G6L A;  2ZR5 A;  3AS2 A;  3O5L A;  1ZK6 A;  3ARX A;  1GUV A;  4ODQ A;  4MNK A;  1FKD A;  2MLY A;  2F4E A;  2PPO A;  1BL4 A;  3UF8 A;  4DRK A;  1O6I A;  1Q6U A;  1IX5 A;  1JNT A;  4DIP A;  1D6O A;  3O5G A;  3JYM A;  1J4R A;  1W1Y A;  3ART A;  1SYT A;  2LGO A;  4DRI A;  2ZR4 A;  3O5F A;  1NMV A;  4WKA A;  4LAY A;  1ZBC A;  4DRQ A;  1F8A B;  4P8W A;  3LUO A;  2N87 A;  1NH6 A;  1NWU A;  4FAP A;  2LJ4 A;  3BXW A;  4Z2I A;  5BXJ A;  1FKR A;  2Y78 A;  4DRH A;  1E9L A;  4L72 B;  4P8V A;  1E6N A;  4DRO A;  3CH9 A;  3O5M A;  3UI5 A;  1FKH A;  4Q7N A;  2ZQT A;  4KR0 B;  2L2S A;  4O2T A;  5GPR A;  1P5Q A;  4JYS A;  4U85 A;  2MLX A;  5HWC A;  1QPF A;  5DIU A;  3FY1 A;  4G2P A;  4TX0 A;  2F21 A;  4P8X A;  4QZV B;  1K9T A;  5DEZ A;  1EIB A;  3AS1 A;  1QPL A;  3CHD A;  1E15 A;  5DIT A;  2AWG A;  3WIJ A;  2A3B A;  1KT1 A;  1FFQ A;  3WD0 A;  3PRB A;  4TW8 A;  4W9O A;  4Z2J A;  1KT0 A;  1ZL1 A;  2AOS A;  3B9A A;  2OLH A;  4L3N A;  3O5O A;  1OGG A;  4ODR A;  1L1P A;  3ALG A;  1GOI A;  1HJX A;  1ZCN A;  2KE0 A;  2RSE A;  3RM8 A;  4XAK A;  1SR0 A;  2O9O A;  4GGQ A;  4R0X A;  2MLZ A;  2ZR6 A;  4DWS C;  4DWS A;  4LAW A;  3W4R A;  2ITK A;  2DSU A;  4MAV A;  3CGN A;  1HKK A;  3CHE A;  2MNT A;  1Q1C A;  3FAP A;  1X6L A;  3ARP A;  2MPH A;  3CHC A;  2Q5A A;  1EDQ A;  5B8I C;  4Q22 A;  3B7X A;  1YW5 A;  1HKI A;  3ARQ A;  4W9Q A;  1LG2 A;  2DSZ A;  1FJD A;  4LGX A;  3ARU A;  2XP5 A;  5HW8 A;  3ARW A;  2PV3 A;  3UI4 A;  3WD3 A;  5HUA A;  4W5U A;  3B8S A;  4KQZ A;  4QT2 A;  3ARR A;  2XP8 A;  1QZ2 A;  2O92 A;  2DT3 A;  3KZ7 A;  2DSW A;  2WK2 A;  5DF0 A;  1D7H A;  2RUQ A;  4IQ2 A;  2B31 A;  3ODK A;  3TDB A;  1FKG A;  2A3A A;  1LQ0 A;  2LPV A;  4Z2K A;  4ZPT R;  4C02 B;  1FFR A;  4LAX A;  5HTG A;  3WQV A;  2G41 A;  1NMW A;  4R5E A;  2ZQU A;  4IT4 A;  4MNM A;  1EHN A;  1NWS A;  4WK9 A;  4ODM A;  2F2D A;  5DO2 A;  1A7X A;  3RM9 A;  3RFW A;  5HBF A;  1PBK A;  1EYM A;  3PRD A;  1FKI A;  4IT6 A;  5HT1 A;  3EY6 A;  4JFM A;  3G6M A;  4S3K A;  2FDM A;  1X6N A;  2IUZ A;  2YBT A;  4Z2G A;  3JYJ A;  1FKS A;  4J4N A;  2G8Z A;  2VN1 A;  1J4I A;  3KAG A;  4HAR A;  1LL6 A;  2XP4 A;  4ODL A;  3AQU A;  4W9P A;  1U79 A;  4ZPW R;  4U84 A;  1JNS A;  1VF8 A;  4P8U A;  4J4O A;  2VCD A;  1YAT A;  4ITZ A;  2RUC A;  4NNR A;  1R9H A;  2ZQS A;  3KAD A;  1TCO C;  4GIV A;  2WM0 A;  4TYO A;  2A3C A;  4U86 A;  4PTM A;  3PRA A;  4ODP A;  3CHF A;  3IK8 A;  1M5Y A;  2DG4 A;  1FKK A;  1W1T A;  1E6P A;  4AY1 A;  2KFW A;  3O5E A;  1KFW A;  2ZQV A;  4DRP A;  1FKJ A;  4MSP A;  1FKB A;  1W9P A;  1UR8 A;  2OFN A;  3FXY A;  1H0I A;  4ZS6 A;  3O5I A;  3ARS A;  2IF4 A;  5DIV A;  3VAW A;  4DH0 A;  4JFK A;  4TW7 A;  5HW6 A;  3PA7 A;  3WL1 A;  3RGC A;  3KAF A;  2M1I A;  2DG3 A;  4JFI A;  3TC5 A;  2A3E A;  3WQW A;  4NZC A;  4TW6 A;  3KCE A;  3IKD A;  1NWR A;  4QT3 A;  1JND A;  3NTP A;  3KAB A;  3KAC A;  3GPK A;  4QIB A;  1N1A A;  1Q6I A;  1JNE A;  2RQS A;  2XPA A;  4MGV A;  4G50 A;  4WKH A;  2RUR A;  3UQB A;  2PV2 A;  3B9E A;  3WKZ A;  3B9D A;  4DRN A;  3O5K A;  4N19 A;  1W1P A;  2PPP A;  2DT1 A;  2M08 A;  1UR9 A;  3ARZ A;  1F40 A;  1PIN A;  2M2A A;  2K8I A;  2PPN A;  2PBC A;  3OOB A;  1J4H A;  2UZ5 A;  3WL0 A;  3KAI A;  4DT4 A;  5I98 A;  2DT0 A;  3O5D A;  1W26 A;  2KI3 A;  1W9V A;  1W9U A;  3UQA A;  4MNJ A;  5HW7 A;  1ZBK A;  5J6E A;  1HKM A;  3PR9 A;  1HXV A;  3WD1 A;  3IHZ A;  3WD4 A;  4Z2H A;  5D75 A;  2FKE A;  3RM4 A;  1FD9 A;  3JXV A;  5JH8 A;  3O5P A;  1TFV A;  2ESC A;  4HBE A;  1D7J A;  1D7I A;  2KO7 A;  1H0G A;  3KAH A;  4JFJ A;  1ZBV A;  3I6C A;  1LJY A;  4MTV A;  3O5J A;  1JVW A;  3WD2 A;  1OWQ A;  2XP6 A;  1WB0 A;  2XPB A;  3NRK A;  1WAW A;  1D2K A;  1B6C A;  2PI6 A;  2DPE A;  5HKG A;  1RD6 A;  4IQC A;  4TNS A;  3ALF A;  3O5Q A;  3RME A;  4MPK A;  2LKN A;  3ARV A;  1W1V A;  2YBU A;  5GQB A;  1LL4 A;  1HJW A;  4ODO A;  1HJV A;  3NI6 A;  4WIW A;  4Z2L A;  1NSG A;  1E6Z A;  2QF8 A;  1ZB5 A;  3UI6 A;  1E6R A;  1ITX A;  4DRM A;  1T11 A;  4DRJ A;  1OGB A;  5HWB A;  1ZBW A;  1FAP A;  2JZV A;  4DZ2 A;  4S3J A;  1ROU A;  2DSV A;  3AS0 A;  4ODN A;  3ARO A;  3H9R B;  4WKF A;  4JFL A;  3O5R A;  4ODK A;  3IKG A;  3UQI A;  4LAV A;  3OA5 A;  2RUD A;  3WH0 A;  4ML4 A;  1ZU8 A;  3MDY B;  1Q6H A;  3ARY A;  4FN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...