2PPPA

Crystal structure of e60q mutant of fkbp12
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWQEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural coupling between FKBP12 and buried water.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords FK506-binding protein 1A
total genus 30
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2pppA00
3UQAA 1B6CA 1FKSA 2F2DA 4IQCA 5I98A 2KE0A 4QT3A 4C02B 4GGQA 4J4NA 1Q6IA 2RSEA 3ODKA 4TX0A 3OOBA 3UI6A 2XP8A 1PBKA 2FKEA 1KT0A 3GPKA 3TDBA 4FAPA 4TW8A 3O5QA 4U86A 1FKDA 4NNRA 4DROA 1FD9A 1ZK6A 3FAPA 4IPXA 3TCZA 5HW7A 2DG9A 2KGJA 2KFWA 3O5IA 3O5OA 1FKHA 2ZR6A 1D7HA 2N87A 4GIVA 1FJDA 1JNSA 1FKKA 2XP6A 3VAWA 1D7IA 3KACA 1N1AA 3NTPA 2MNTA 1JVWA 2RUDA 2D9FA 4JFKA 2XP9A 3CGNA 2M08A 3MDYB 3NI6A 3UI5A 4DIPA 4U84A 2DG3A 2KI3A 5B8IC 2MLZA 4U85A 4ODRA 4TW7A 4J4OA 2XP3A 3O5FA 3O5KA 1QPFA 2DG4A 2PPPA 2ZQVA 2PV1A 5D75A 4O2TA 4W9OA 5GPGA 3JYJA 3JYMA 2XP7A 3O5DA 1FKLA 2MLYA 2UZ5A 3IKGA 3O5JA 4ODOA 3EY6A 1F40A 2Q5AA 4LAYA 2XP5A 2M1IA 2ZR5A 1L1PA 3KAIA 4MGVA 3KAFA 1QZ2A 2IF4A 4TNSA 2JZVA 5DIVA 3IK8A 3UQBA 3O5MA 3PA7A 4DZ2A 3RGCA 4QIBA 4QT2A 3O5PA 1NMVA 4G2PA 4ODPA 3KAHA 3RFWA 3UI4A 3O5RA 3UF8A 1JNTA 1Q6HA 1J6YA 5HWBA 4DH0A 5HW6A 4G50A 2K8IA 2PPNA 1J4HA 5DITA 2Y78A 3IHZA 1R9HA 2RUQA 1D7JA 1TCOC 1EQ3A 1FKRA 1NMWA 1C9HA 1J4RA 4DZ3A 1ROUA 2LJ4A 1FKJA 1FKFA 3O5GA 3B7XA 5DIUA 2PV3A 3LUOA 4LAWA 4JFMA 3UQIA 1P5QA 1U79A 3H9RB 5HKGA 1FKGA 2F4EA 1FAPA 2ZQSA 3PRDA 1FKBA 2KR7A 1NSGA 3CGMA 3IKDA 4MSPA 1BKFA 4DRJA 2PPOA 4FN2A 5HW8A 2ZQTA 2LKNA 4JYSA 4DRPA 5HUAA 2M2AA 4DRMA 1A7XA 1FKIA 2AWGA 4DT4A 1T11A 2L2SA 2KO7A 2LPVA 4DRQA 1KT1A 3WH0A 5HT1A 3O5EA 1FKTA 2MLXA 2XPAA 2ITKA 2ZR4A 4LAVA 4ODQA 4ODKA 4ODLA 4DRNA 2ZQUA 2OFNA 2PV2A 1Q1CA 1F8AB 4TW6A 4W9PA 4DRKA 5HTGA 2F21A 3KADA 1J4IA 4LAXA 1ROTA 1ZCNA 1D6OA 3I6CA 2XPBA 4IQ2A 4N19A 4ODMA 2VN1A 4W9QA 4DRIA 3JXVA 3KABA 2MF9A 2MPHA 3NRKA 3PRBA 3TC5A 4DRHA 4JFJA 4JFLA 5BXJA 2FAPA 4R0XA 1M5YA 3O5LA 3KZ7A 1Q6UA 4TYOA 1YATA 1BL4A 1W26A 1EYMA 1PINA 3KAGA 2RUCA 4BF8A 5HWCA 5J6EA 4ODNA 1YW5A 3KCEA 4ITZA 2RURA 2LGOA 1QPLA 4JFIA 2XP4A 1HXVA 2VCDA 2RQSA 2PBCA 1Y0OA
chains in the Genus database with same CATH superfamily
1B6CA 2A3AA 2KE0A 4C02B 4GGQA 3W4RA 3RM4A 1EIBA 4MAVA 2RSEA 4TX0A 4MNJA 1GRJA 4TW8A 4DWSB 2EULA 3BXWA 3WD2A 2KFWA 4WIWA 3WQVA 1FKHA 2N87A 1FJDA 3ARQA 4DWSC 1D7IA 2WLYA 1JVWA 4MNKA 5HW7A 1JNDA 3UI5A 1LQ0A 3BMBA 5B8IC 4U85A 4ODRA 2O92A 4TW7A 1NWTA 1UR9A 3WIJA 3O5KA 1X6NA 4P8VA 2DT3A 2XP7A 2YBTA 3O5DA 1FKLA 3IKGA 2M1IA 1SYTA 3RM8A 3ALGA 1W1YA 5DIVA 2JZVA 3IK8A 3UQBA 3O5MA 4URIA 4G2PA 4ODPA 3UI4A 3UF8A 2B5UB 3RM9A 1JNTA 1HKMA 3WD0A 1W9PA 2K8IA 1NWUA 3IHZA 1D7JA 1ZBKA 3G6MA 1FKRA 2A3BA 1FKFA 3ARSA 2PV3A 3EIPA 1VF8A 4WJXA 1OGBA 2AOSA 5HKGA 2ZQSA 3PRDA 1E6ZA 3CGMA 5HW8A 4DRJA 1WB0A 4IT6A 3PRAA 1FKIA 2L2SA 1W1VA 2KO7A 3FXYA 1H0GA 1LG1A 4ZS6A 3WL0A 1E15A 1NH6A 1J4IA 4XAKA 1ZCNA 3WD3A 2XPBA 1D2KA 3B9DA 5BXJA 2MPHA 2G8ZA 3AS0A 2FAPA 1M5YA 2WM0A 3ARZA 1Q6UA 4LGXA 1YATA 1W26A 5GQBA 4HARA 1EYMA 1PINA 1YW5A 3KCEA 2LGOA 1E9LA 2XP4A 3ARRA 4Q22A 4ZPTR 3AS1A 1Q6IA 3ARWA 3UI6A 1PBKA 3GPKA 1GPFA 4U86A 4NNRA 1ZK6A 3B8SA 3AS2A 3ARXA 1HJVA 3KACA 3NTPA 2MNTA 2RUDA 3ARTA 4JFKA 4Z2HA 2M08A 4UDMA 2DG3A 2A3CA 2MLZA 5DF0A 2XP3A 4WK9A 3JYJA 3JYMA 1OGGA 4ODOA 3EY6A 1E6NA 2XP5A 3CH9A 1H0IA 3WQWA 1ZB5A 3KAFA 2IF4A 4TNSA 2DSZA 4HBEA 4QIBA 4MNMA 3KAHA 5HWBA 4DH0A 5HW6A 1WNOA 2DT2A 1EHNA 2Y78A 3ARVA 3AROA 1J4RA 4Z2GA 3O5GA 4W5UA 4LAWA 1FKBA 2KR7A 4KR0B 4MSPA 2PPOA 4DRPA 4DRMA 4HBOA 4DT4A 2LPVA 4DRQA 1NWSA 1KT1A 3WH0A 1E44A 2XPAA 2ITKA 4ODQA 1HKKA 4DRNA 2OFNA 2PV2A 3WL1A 1Q1CA 4TW6A 4DRKA 5HTGA 1HKIA 3KADA 1W1PA 1SR0A 1D6OA 4N19A 4IQ2A 1LL6A 2VN1A 4DRHA 3NRKA 2MF9A 3TC5A 4R0XA 3CHDA 4P8XA 3ARYA 4TYOA 1E6PA 1LG2A 1K9TA 4ITZA 2RURA 2O9OA 2VCDA 3CHEA 1W9VA 3UQAA 1CTNA 1FKSA 1LL4A 4WKAA 4J4NA 2DSVA 3ODKA 2XP8A 2FKEA 1KT0A 1KFWA 4FAPA 1FD9A 3FAPA 4IPXA 4NSBA 1GUVA 3O5IA 2ZR6A 2DSUA 1WAWA 1FKKA 3G6LA 2XP6A 3CZ8A 1ITXA 2D9FA 2PI6A 2XP9A 1ZBVA 3CGNA 3MDYB 4L3NA 4U84A 1ZU8A 2KI3A 1HJXA 4J4OA 3O5FA 2IUZA 1QPFA 2DG4A 2PV1A 5D75A 4O2TA 4W9OA 5GPGA 4AY1A 4R5EA 2MLYA 3O5JA 1F40A 4ZPVR 4ML4A 4MGVA 2WK2A 3RMEA 4QT2A 1NMVA 3RFWA 3O5RA 1X6LA 1J6YA 4WKHA 2PPNA 1J4HA 5DITA 2RUQA 1NMWA 3B9EA 1C9HA 4DZ3A 2LJ4A 5DIUA 1W1TA 2A3EA 1U79A 2DT0A 2FDMA 2F4EA 1FAPA 1NSGA 1FFRA 4Q7NA 4FN2A 2ZQTA 4JYSA 5HUAA 1A7XA 2AWGA 2PN0A 1HJWA 3QOKA 5HT1A 3FY1A 2ZR4A 5GPRA 4ODKA 4ODLA 4W9PA 2F21A 3ARUA 4LAXA 4WKFA 3I6CA 1RD6A 4DRIA 3JXVA 3KABA 3PRBA 4P8UA 4JFJA 4KQZA 3KZ7A 4S3JA 1BL4A 1ZL1A 1JCHB 2RUCA 4ODNA 1QPLA 1UR8A 1OWQA 2YBUA 2B31A 2RQSA 4Z2IA 1TFVA 2F2DA 4IQCA 5I98A 4QT3A 4Z2KA 3OOBA 3TDBA 3ARPA 3O5QA 1FKDA 4DWSD 4DROA 4MNLA 3TCZA 1FFQA 2DG9A 2KGJA 4MTVA 3O5OA 1E6RA 1D7HA 4GIVA 4S3KA 1JNSA 2F23A 3VAWA 1N1AA 4DZ2A 4NZCA 3NI6A 5DEZA 4DIPA 3GTYX 1HKJA 4L72B 2OLHA 2PPPA 2ZQVA 2P4VA 2DPEA 1LL7A 2UZ5A 3CHFA 2Q5AA 4LAYA 4Z2JA 2ZR5A 2WLZA 1L1PA 3KAIA 1QZ2A 3AS3A 5DO2A 3PA7A 3O5PA 4MPKA 4P8WA 1JNEA 1Q6HA 4Z2LA 1EDQA 2G41A 5HBFA 4G50A 1IX5A 1R9HA 1TCOC 1EQ3A 3GU0A 1LJYA 1ZBWA 1ROUA 1FKJA 3AQUA 3B7XA 1NWRA 3LUOA 4JFMA 3UQIA 1P5QA 3H9RB 4QZVB 1FKGA 3WKZA 2DT1A 1O6IA 3IKDA 1BKFA 1XHGA 3OA5A 2LKNA 3PR9A 2M2AA 1T11A 4ZPWR 3CHCA 3O5EA 1FKTA 1XRVA 2MLXA 4LAVA 2QF8A 2ZQUA 1ZBCA 1F8AB 1W9UA 2DSWA 3RGCA 1ROTA 3WD4A 4ODMA 4W9QA 3B9AA 4PTMA 5HWCA 4DWSA 5JH8A 2ESCA 4JFLA 3O5LA 1GOIA 2ETNA 3KAGA 4IT4A 3WD1A 4BF8A 5J6EA 3ALFA 4JFIA 1HXVA 2PBCA 1Y0OA
chains in the Genus database with same CATH topology
1B6CA 2A3AA 2KE0A 4C02B 4GGQA 3W4RA 3RM4A 1EIBA 4MAVA 2RSEA 4TX0A 4MNJA 4TW8A 4DWSB 3BXWA 3WD2A 2KFWA 4WIWA 3WQVA 1FKHA 2N87A 1FJDA 3ARQA 4DWSC 1D7IA 2WLYA 1JVWA 4MNKA 5HW7A 1JNDA 3UI5A 1LQ0A 5B8IC 4U85A 4ODRA 2O92A 4TW7A 1NWTA 1UR9A 3WIJA 3O5KA 1X6NA 4P8VA 2DT3A 2XP7A 2YBTA 3O5DA 1FKLA 3IKGA 2M1IA 1SYTA 3RM8A 3ALGA 1W1YA 5DIVA 2JZVA 3IK8A 3UQBA 3O5MA 4URIA 4G2PA 4ODPA 3UI4A 3UF8A 3RM9A 1JNTA 1HKMA 3WD0A 1W9PA 2K8IA 1NWUA 3IHZA 1D7JA 1ZBKA 3G6MA 1FKRA 2A3BA 1FKFA 3ARSA 2PV3A 4WJXA 1VF8A 1OGBA 2AOSA 5HKGA 2ZQSA 3PRDA 1E6ZA 3CGMA 5HW8A 4DRJA 1WB0A 4IT6A 3PRAA 1FKIA 2L2SA 1W1VA 2KO7A 3FXYA 1H0GA 1LG1A 4ZS6A 3WL0A 1E15A 1NH6A 1J4IA 4XAKA 1ZCNA 3WD3A 2XPBA 1D2KA 3B9DA 5BXJA 2MPHA 2G8ZA 3AS0A 2FAPA 1M5YA 2WM0A 3ARZA 1Q6UA 4LGXA 1YATA 1W26A 5GQBA 4HARA 1EYMA 1PINA 1YW5A 3KCEA 2LGOA 1E9LA 2XP4A 3ARRA 4Q22A 4ZPTR 3AS1A 1Q6IA 3ARWA 3UI6A 1PBKA 3GPKA 1GPFA 4U86A 4NNRA 1ZK6A 3B8SA 3AS2A 3ARXA 1HJVA 3KACA 3NTPA 2MNTA 2RUDA 3ARTA 4JFKA 4Z2HA 2M08A 2DG3A 2A3CA 2MLZA 5DF0A 2XP3A 4WK9A 3JYJA 3JYMA 1OGGA 4ODOA 3EY6A 1E6NA 2XP5A 3CH9A 1H0IA 3WQWA 1ZB5A 3KAFA 2IF4A 4TNSA 2DSZA 4HBEA 4QIBA 4MNMA 3KAHA 5HWBA 4DH0A 5HW6A 1WNOA 2DT2A 1EHNA 2Y78A 3ARVA 3AROA 1J4RA 4Z2GA 3O5GA 4W5UA 4LAWA 1FKBA 2KR7A 4KR0B 4MSPA 2PPOA 4DRPA 4DRMA 4HBOA 4DT4A 2LPVA 4DRQA 1NWSA 1KT1A 3WH0A 2XPAA 2ITKA 4ODQA 1HKKA 4DRNA 2OFNA 2PV2A 3WL1A 1Q1CA 4TW6A 4DRKA 5HTGA 1HKIA 3KADA 1W1PA 1SR0A 1D6OA 4N19A 4IQ2A 1LL6A 2VN1A 4DRHA 3NRKA 2MF9A 3TC5A 4R0XA 3CHDA 4P8XA 3ARYA 4TYOA 1E6PA 1LG2A 1K9TA 4ITZA 2RURA 2O9OA 2VCDA 3CHEA 1W9VA 3UQAA 1CTNA 1FKSA 1LL4A 4WKAA 4J4NA 2DSVA 3ODKA 2XP8A 2FKEA 1KT0A 1KFWA 4FAPA 1FD9A 3FAPA 4IPXA 4NSBA 1GUVA 3O5IA 2ZR6A 2DSUA 1WAWA 1FKKA 3G6LA 2XP6A 3CZ8A 1ITXA 2D9FA 2PI6A 2XP9A 1ZBVA 3CGNA 3MDYB 4L3NA 4U84A 1ZU8A 2KI3A 1HJXA 4J4OA 3O5FA 2IUZA 1QPFA 2DG4A 2PV1A 5D75A 4O2TA 4W9OA 5GPGA 4AY1A 4R5EA 2MLYA 3O5JA 1F40A 4ZPVR 4ML4A 4MGVA 2WK2A 3RMEA 4QT2A 1NMVA 3RFWA 3O5RA 1X6LA 1J6YA 4WKHA 2PPNA 1J4HA 5DITA 2RUQA 1NMWA 3B9EA 1C9HA 4DZ3A 2LJ4A 5DIUA 1W1TA 2A3EA 1U79A 2DT0A 2FDMA 2F4EA 1FAPA 1NSGA 1FFRA 4Q7NA 4FN2A 2ZQTA 4JYSA 5HUAA 1A7XA 2AWGA 1HJWA 3QOKA 5HT1A 3FY1A 2ZR4A 5GPRA 4ODKA 4ODLA 4W9PA 2F21A 3ARUA 4LAXA 4WKFA 3I6CA 1RD6A 4DRIA 3JXVA 3KABA 3PRBA 4P8UA 4JFJA 4KQZA 3KZ7A 4S3JA 1BL4A 1ZL1A 2RUCA 4ODNA 1QPLA 1UR8A 1OWQA 2YBUA 2B31A 2RQSA 4Z2IA 1TFVA 2F2DA 4IQCA 5I98A 4QT3A 4Z2KA 3OOBA 3TDBA 3ARPA 3O5QA 1FKDA 4DWSD 4DROA 4MNLA 3TCZA 1FFQA 2DG9A 2KGJA 4MTVA 3O5OA 1E6RA 1D7HA 4GIVA 4S3KA 1JNSA 3VAWA 1N1AA 4DZ2A 4NZCA 3NI6A 5DEZA 4DIPA 1HKJA 4L72B 2OLHA 2PPPA 2ZQVA 2DPEA 1LL7A 2UZ5A 3CHFA 2Q5AA 4LAYA 4Z2JA 2ZR5A 2WLZA 1L1PA 3KAIA 1QZ2A 3AS3A 5DO2A 3PA7A 3O5PA 4MPKA 4P8WA 1JNEA 1Q6HA 4Z2LA 1EDQA 2G41A 5HBFA 4G50A 1IX5A 1R9HA 1TCOC 1EQ3A 1LJYA 1ZBWA 1ROUA 1FKJA 3AQUA 3B7XA 1NWRA 3LUOA 4JFMA 3UQIA 1P5QA 3H9RB 4QZVB 1FKGA 3WKZA 2DT1A 1O6IA 3IKDA 1BKFA 1XHGA 3OA5A 2LKNA 3PR9A 2M2AA 1T11A 4ZPWR 3CHCA 3O5EA 1FKTA 1XRVA 2MLXA 4LAVA 2QF8A 2ZQUA 1ZBCA 1F8AB 1W9UA 2DSWA 3RGCA 1ROTA 3WD4A 4ODMA 4W9QA 3B9AA 4PTMA 5HWCA 4DWSA 5JH8A 2ESCA 4JFLA 3O5LA 1GOIA 3KAGA 4IT4A 3WD1A 4BF8A 5J6EA 3ALFA 4JFIA 1HXVA 2PBCA 1Y0OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UQA A;  1B6C A;  1FKS A;  2F2D A;  4IQC A;  5I98 A;  2KE0 A;  4QT3 A;  4C02 B;  4GGQ A;  4J4N A;  1Q6I A;  2RSE A;  3ODK A;  4TX0 A;  3OOB A;  3UI6 A;  2XP8 A;  1PBK A;  2FKE A;  1KT0 A;  3GPK A;  3TDB A;  4FAP A;  4TW8 A;  3O5Q A;  4U86 A;  1FKD A;  4NNR A;  4DRO A;  1FD9 A;  1ZK6 A;  3FAP A;  4IPX A;  3TCZ A;  5HW7 A;  2DG9 A;  2KGJ A;  2KFW A;  3O5I A;  3O5O A;  1FKH A;  2ZR6 A;  1D7H A;  2N87 A;  4GIV A;  1FJD A;  1JNS A;  1FKK A;  2XP6 A;  3VAW A;  1D7I A;  3KAC A;  1N1A A;  3NTP A;  2MNT A;  1JVW A;  2RUD A;  2D9F A;  4JFK A;  2XP9 A;  3CGN A;  2M08 A;  3MDY B;  3NI6 A;  3UI5 A;  4DIP A;  4U84 A;  2DG3 A;  2KI3 A;  5B8I C;  2MLZ A;  4U85 A;  4ODR A;  4TW7 A;  4J4O A;  2XP3 A;  3O5F A;  3O5K A;  1QPF A;  2DG4 A;  2PPP A;  2ZQV A;  2PV1 A;  5D75 A;  4O2T A;  4W9O A;  5GPG A;  3JYJ A;  3JYM A;  2XP7 A;  3O5D A;  1FKL A;  2MLY A;  2UZ5 A;  3IKG A;  3O5J A;  4ODO A;  3EY6 A;  1F40 A;  2Q5A A;  4LAY A;  2XP5 A;  2M1I A;  2ZR5 A;  1L1P A;  3KAI A;  4MGV A;  3KAF A;  1QZ2 A;  2IF4 A;  4TNS A;  2JZV A;  5DIV A;  3IK8 A;  3UQB A;  3O5M A;  3PA7 A;  4DZ2 A;  3RGC A;  4QIB A;  4QT2 A;  3O5P A;  1NMV A;  4G2P A;  4ODP A;  3KAH A;  3RFW A;  3UI4 A;  3O5R A;  3UF8 A;  1JNT A;  1Q6H A;  1J6Y A;  5HWB A;  4DH0 A;  5HW6 A;  4G50 A;  2K8I A;  2PPN A;  1J4H A;  5DIT A;  2Y78 A;  3IHZ A;  1R9H A;  2RUQ A;  1D7J A;  1TCO C;  1EQ3 A;  1FKR A;  1NMW A;  1C9H A;  1J4R A;  4DZ3 A;  1ROU A;  2LJ4 A;  1FKJ A;  1FKF A;  3O5G A;  3B7X A;  5DIU A;  2PV3 A;  3LUO A;  4LAW A;  4JFM A;  3UQI A;  1P5Q A;  1U79 A;  3H9R B;  5HKG A;  1FKG A;  2F4E A;  1FAP A;  2ZQS A;  3PRD A;  1FKB A;  2KR7 A;  1NSG A;  3CGM A;  3IKD A;  4MSP A;  1BKF A;  4DRJ A;  2PPO A;  4FN2 A;  5HW8 A;  2ZQT A;  2LKN A;  4JYS A;  4DRP A;  5HUA A;  2M2A A;  4DRM A;  1A7X A;  1FKI A;  2AWG A;  4DT4 A;  1T11 A;  2L2S A;  2KO7 A;  2LPV A;  4DRQ A;  1KT1 A;  3WH0 A;  5HT1 A;  3O5E A;  1FKT A;  2MLX A;  2XPA A;  2ITK A;  2ZR4 A;  4LAV A;  4ODQ A;  4ODK A;  4ODL A;  4DRN A;  2ZQU A;  2OFN A;  2PV2 A;  1Q1C A;  1F8A B;  4TW6 A;  4W9P A;  4DRK A;  5HTG A;  2F21 A;  3KAD A;  1J4I A;  4LAX A;  1ROT A;  1ZCN A;  1D6O A;  3I6C A;  2XPB A;  4IQ2 A;  4N19 A;  4ODM A;  2VN1 A;  4W9Q A;  4DRI A;  3JXV A;  3KAB A;  2MF9 A;  2MPH A;  3NRK A;  3PRB A;  3TC5 A;  4DRH A;  4JFJ A;  4JFL A;  5BXJ A;  2FAP A;  4R0X A;  1M5Y A;  3O5L A;  3KZ7 A;  1Q6U A;  4TYO A;  1YAT A;  1BL4 A;  1W26 A;  1EYM A;  1PIN A;  3KAG A;  2RUC A;  4BF8 A;  5HWC A;  5J6E A;  4ODN A;  1YW5 A;  3KCE A;  4ITZ A;  2RUR A;  2LGO A;  1QPL A;  4JFI A;  2XP4 A;  1HXV A;  2VCD A;  2RQS A;  2PBC A;  1Y0O A; 
#chains in the Genus database with same CATH topology
 1B6C A;  2A3A A;  2KE0 A;  4C02 B;  4GGQ A;  3W4R A;  3RM4 A;  1EIB A;  4MAV A;  2RSE A;  4TX0 A;  4MNJ A;  1GRJ A;  4TW8 A;  4DWS B;  2EUL A;  3BXW A;  3WD2 A;  2KFW A;  4WIW A;  3WQV A;  1FKH A;  2N87 A;  1FJD A;  3ARQ A;  4DWS C;  1D7I A;  2WLY A;  1JVW A;  4MNK A;  5HW7 A;  1JND A;  3UI5 A;  1LQ0 A;  3BMB A;  5B8I C;  4U85 A;  4ODR A;  2O92 A;  4TW7 A;  1NWT A;  1UR9 A;  3WIJ A;  3O5K A;  1X6N A;  4P8V A;  2DT3 A;  2XP7 A;  2YBT A;  3O5D A;  1FKL A;  3IKG A;  2M1I A;  1SYT A;  3RM8 A;  3ALG A;  1W1Y A;  5DIV A;  2JZV A;  3IK8 A;  3UQB A;  3O5M A;  4URI A;  4G2P A;  4ODP A;  3UI4 A;  3UF8 A;  2B5U B;  3RM9 A;  1JNT A;  1HKM A;  3WD0 A;  1W9P A;  2K8I A;  1NWU A;  3IHZ A;  1D7J A;  1ZBK A;  3G6M A;  1FKR A;  2A3B A;  1FKF A;  3ARS A;  2PV3 A;  3EIP A;  1VF8 A;  4WJX A;  1OGB A;  2AOS A;  5HKG A;  2ZQS A;  3PRD A;  1E6Z A;  3CGM A;  5HW8 A;  4DRJ A;  1WB0 A;  4IT6 A;  3PRA A;  1FKI A;  2L2S A;  1W1V A;  2KO7 A;  3FXY A;  1H0G A;  1LG1 A;  4ZS6 A;  3WL0 A;  1E15 A;  1NH6 A;  1J4I A;  4XAK A;  1ZCN A;  3WD3 A;  2XPB A;  1D2K A;  3B9D A;  5BXJ A;  2MPH A;  2G8Z A;  3AS0 A;  2FAP A;  1M5Y A;  2WM0 A;  3ARZ A;  1Q6U A;  4LGX A;  1YAT A;  1W26 A;  5GQB A;  4HAR A;  1EYM A;  1PIN A;  1YW5 A;  3KCE A;  2LGO A;  1E9L A;  2XP4 A;  3ARR A;  4Q22 A;  4ZPT R;  3AS1 A;  1Q6I A;  3ARW A;  3UI6 A;  1PBK A;  3GPK A;  1GPF A;  4U86 A;  4NNR A;  1ZK6 A;  3B8S A;  3AS2 A;  3ARX A;  1HJV A;  3KAC A;  3NTP A;  2MNT A;  2RUD A;  3ART A;  4JFK A;  4Z2H A;  2M08 A;  4UDM A;  2DG3 A;  2A3C A;  2MLZ A;  5DF0 A;  2XP3 A;  4WK9 A;  3JYJ A;  3JYM A;  1OGG A;  4ODO A;  3EY6 A;  1E6N A;  2XP5 A;  3CH9 A;  1H0I A;  3WQW A;  1ZB5 A;  3KAF A;  2IF4 A;  4TNS A;  2DSZ A;  4HBE A;  4QIB A;  4MNM A;  3KAH A;  5HWB A;  4DH0 A;  5HW6 A;  1WNO A;  2DT2 A;  1EHN A;  2Y78 A;  3ARV A;  3ARO A;  1J4R A;  4Z2G A;  3O5G A;  4W5U A;  4LAW A;  1FKB A;  2KR7 A;  4KR0 B;  4MSP A;  2PPO A;  4DRP A;  4DRM A;  4HBO A;  4DT4 A;  2LPV A;  4DRQ A;  1NWS A;  1KT1 A;  3WH0 A;  1E44 A;  2XPA A;  2ITK A;  4ODQ A;  1HKK A;  4DRN A;  2OFN A;  2PV2 A;  3WL1 A;  1Q1C A;  4TW6 A;  4DRK A;  5HTG A;  1HKI A;  3KAD A;  1W1P A;  1SR0 A;  1D6O A;  4N19 A;  4IQ2 A;  1LL6 A;  2VN1 A;  4DRH A;  3NRK A;  2MF9 A;  3TC5 A;  4R0X A;  3CHD A;  4P8X A;  3ARY A;  4TYO A;  1E6P A;  1LG2 A;  1K9T A;  4ITZ A;  2RUR A;  2O9O A;  2VCD A;  3CHE A;  1W9V A;  3UQA A;  1CTN A;  1FKS A;  1LL4 A;  4WKA A;  4J4N A;  2DSV A;  3ODK A;  2XP8 A;  2FKE A;  1KT0 A;  1KFW A;  4FAP A;  1FD9 A;  3FAP A;  4IPX A;  4NSB A;  1GUV A;  3O5I A;  2ZR6 A;  2DSU A;  1WAW A;  1FKK A;  3G6L A;  2XP6 A;  3CZ8 A;  1ITX A;  2D9F A;  2PI6 A;  2XP9 A;  1ZBV A;  3CGN A;  3MDY B;  4L3N A;  4U84 A;  1ZU8 A;  2KI3 A;  1HJX A;  4J4O A;  3O5F A;  2IUZ A;  1QPF A;  2DG4 A;  2PV1 A;  5D75 A;  4O2T A;  4W9O A;  5GPG A;  4AY1 A;  4R5E A;  2MLY A;  3O5J A;  1F40 A;  4ZPV R;  4ML4 A;  4MGV A;  2WK2 A;  3RME A;  4QT2 A;  1NMV A;  3RFW A;  3O5R A;  1X6L A;  1J6Y A;  4WKH A;  2PPN A;  1J4H A;  5DIT A;  2RUQ A;  1NMW A;  3B9E A;  1C9H A;  4DZ3 A;  2LJ4 A;  5DIU A;  1W1T A;  2A3E A;  1U79 A;  2DT0 A;  2FDM A;  2F4E A;  1FAP A;  1NSG A;  1FFR A;  4Q7N A;  4FN2 A;  2ZQT A;  4JYS A;  5HUA A;  1A7X A;  2AWG A;  2PN0 A;  1HJW A;  3QOK A;  5HT1 A;  3FY1 A;  2ZR4 A;  5GPR A;  4ODK A;  4ODL A;  4W9P A;  2F21 A;  3ARU A;  4LAX A;  4WKF A;  3I6C A;  1RD6 A;  4DRI A;  3JXV A;  3KAB A;  3PRB A;  4P8U A;  4JFJ A;  4KQZ A;  3KZ7 A;  4S3J A;  1BL4 A;  1ZL1 A;  1JCH B;  2RUC A;  4ODN A;  1QPL A;  1UR8 A;  1OWQ A;  2YBU A;  2B31 A;  2RQS A;  4Z2I A;  1TFV A;  2F2D A;  4IQC A;  5I98 A;  4QT3 A;  4Z2K A;  3OOB A;  3TDB A;  3ARP A;  3O5Q A;  1FKD A;  4DWS D;  4DRO A;  4MNL A;  3TCZ A;  1FFQ A;  2DG9 A;  2KGJ A;  4MTV A;  3O5O A;  1E6R A;  1D7H A;  4GIV A;  4S3K A;  1JNS A;  2F23 A;  3VAW A;  1N1A A;  4DZ2 A;  4NZC A;  3NI6 A;  5DEZ A;  4DIP A;  3GTY X;  1HKJ A;  4L72 B;  2OLH A;  2PPP A;  2ZQV A;  2P4V A;  2DPE A;  1LL7 A;  2UZ5 A;  3CHF A;  2Q5A A;  4LAY A;  4Z2J A;  2ZR5 A;  2WLZ A;  1L1P A;  3KAI A;  1QZ2 A;  3AS3 A;  5DO2 A;  3PA7 A;  3O5P A;  4MPK A;  4P8W A;  1JNE A;  1Q6H A;  4Z2L A;  1EDQ A;  2G41 A;  5HBF A;  4G50 A;  1IX5 A;  1R9H A;  1TCO C;  1EQ3 A;  3GU0 A;  1LJY A;  1ZBW A;  1ROU A;  1FKJ A;  3AQU A;  3B7X A;  1NWR A;  3LUO A;  4JFM A;  3UQI A;  1P5Q A;  3H9R B;  4QZV B;  1FKG A;  3WKZ A;  2DT1 A;  1O6I A;  3IKD A;  1BKF A;  1XHG A;  3OA5 A;  2LKN A;  3PR9 A;  2M2A A;  1T11 A;  4ZPW R;  3CHC A;  3O5E A;  1FKT A;  1XRV A;  2MLX A;  4LAV A;  2QF8 A;  2ZQU A;  1ZBC A;  1F8A B;  1W9U A;  2DSW A;  3RGC A;  1ROT A;  3WD4 A;  4ODM A;  4W9Q A;  3B9A A;  4PTM A;  5HWC A;  4DWS A;  5JH8 A;  2ESC A;  4JFL A;  3O5L A;  1GOI A;  2ETN A;  3KAG A;  4IT4 A;  3WD1 A;  4BF8 A;  5J6E A;  3ALF A;  4JFI A;  1HXV A;  2PBC A;  1Y0O A; 
#chains in the Genus database with same CATH homology
 1B6C A;  2A3A A;  2KE0 A;  4C02 B;  4GGQ A;  3W4R A;  3RM4 A;  1EIB A;  4MAV A;  2RSE A;  4TX0 A;  4MNJ A;  4TW8 A;  4DWS B;  3BXW A;  3WD2 A;  2KFW A;  4WIW A;  3WQV A;  1FKH A;  2N87 A;  1FJD A;  3ARQ A;  4DWS C;  1D7I A;  2WLY A;  1JVW A;  4MNK A;  5HW7 A;  1JND A;  3UI5 A;  1LQ0 A;  5B8I C;  4U85 A;  4ODR A;  2O92 A;  4TW7 A;  1NWT A;  1UR9 A;  3WIJ A;  3O5K A;  1X6N A;  4P8V A;  2DT3 A;  2XP7 A;  2YBT A;  3O5D A;  1FKL A;  3IKG A;  2M1I A;  1SYT A;  3RM8 A;  3ALG A;  1W1Y A;  5DIV A;  2JZV A;  3IK8 A;  3UQB A;  3O5M A;  4URI A;  4G2P A;  4ODP A;  3UI4 A;  3UF8 A;  3RM9 A;  1JNT A;  1HKM A;  3WD0 A;  1W9P A;  2K8I A;  1NWU A;  3IHZ A;  1D7J A;  1ZBK A;  3G6M A;  1FKR A;  2A3B A;  1FKF A;  3ARS A;  2PV3 A;  4WJX A;  1VF8 A;  1OGB A;  2AOS A;  5HKG A;  2ZQS A;  3PRD A;  1E6Z A;  3CGM A;  5HW8 A;  4DRJ A;  1WB0 A;  4IT6 A;  3PRA A;  1FKI A;  2L2S A;  1W1V A;  2KO7 A;  3FXY A;  1H0G A;  1LG1 A;  4ZS6 A;  3WL0 A;  1E15 A;  1NH6 A;  1J4I A;  4XAK A;  1ZCN A;  3WD3 A;  2XPB A;  1D2K A;  3B9D A;  5BXJ A;  2MPH A;  2G8Z A;  3AS0 A;  2FAP A;  1M5Y A;  2WM0 A;  3ARZ A;  1Q6U A;  4LGX A;  1YAT A;  1W26 A;  5GQB A;  4HAR A;  1EYM A;  1PIN A;  1YW5 A;  3KCE A;  2LGO A;  1E9L A;  2XP4 A;  3ARR A;  4Q22 A;  4ZPT R;  3AS1 A;  1Q6I A;  3ARW A;  3UI6 A;  1PBK A;  3GPK A;  1GPF A;  4U86 A;  4NNR A;  1ZK6 A;  3B8S A;  3AS2 A;  3ARX A;  1HJV A;  3KAC A;  3NTP A;  2MNT A;  2RUD A;  3ART A;  4JFK A;  4Z2H A;  2M08 A;  2DG3 A;  2A3C A;  2MLZ A;  5DF0 A;  2XP3 A;  4WK9 A;  3JYJ A;  3JYM A;  1OGG A;  4ODO A;  3EY6 A;  1E6N A;  2XP5 A;  3CH9 A;  1H0I A;  3WQW A;  1ZB5 A;  3KAF A;  2IF4 A;  4TNS A;  2DSZ A;  4HBE A;  4QIB A;  4MNM A;  3KAH A;  5HWB A;  4DH0 A;  5HW6 A;  1WNO A;  2DT2 A;  1EHN A;  2Y78 A;  3ARV A;  3ARO A;  1J4R A;  4Z2G A;  3O5G A;  4W5U A;  4LAW A;  1FKB A;  2KR7 A;  4KR0 B;  4MSP A;  2PPO A;  4DRP A;  4DRM A;  4HBO A;  4DT4 A;  2LPV A;  4DRQ A;  1NWS A;  1KT1 A;  3WH0 A;  2XPA A;  2ITK A;  4ODQ A;  1HKK A;  4DRN A;  2OFN A;  2PV2 A;  3WL1 A;  1Q1C A;  4TW6 A;  4DRK A;  5HTG A;  1HKI A;  3KAD A;  1W1P A;  1SR0 A;  1D6O A;  4N19 A;  4IQ2 A;  1LL6 A;  2VN1 A;  4DRH A;  3NRK A;  2MF9 A;  3TC5 A;  4R0X A;  3CHD A;  4P8X A;  3ARY A;  4TYO A;  1E6P A;  1LG2 A;  1K9T A;  4ITZ A;  2RUR A;  2O9O A;  2VCD A;  3CHE A;  1W9V A;  3UQA A;  1CTN A;  1FKS A;  1LL4 A;  4WKA A;  4J4N A;  2DSV A;  3ODK A;  2XP8 A;  2FKE A;  1KT0 A;  1KFW A;  4FAP A;  1FD9 A;  3FAP A;  4IPX A;  4NSB A;  1GUV A;  3O5I A;  2ZR6 A;  2DSU A;  1WAW A;  1FKK A;  3G6L A;  2XP6 A;  3CZ8 A;  1ITX A;  2D9F A;  2PI6 A;  2XP9 A;  1ZBV A;  3CGN A;  3MDY B;  4L3N A;  4U84 A;  1ZU8 A;  2KI3 A;  1HJX A;  4J4O A;  3O5F A;  2IUZ A;  1QPF A;  2DG4 A;  2PV1 A;  5D75 A;  4O2T A;  4W9O A;  5GPG A;  4AY1 A;  4R5E A;  2MLY A;  3O5J A;  1F40 A;  4ZPV R;  4ML4 A;  4MGV A;  2WK2 A;  3RME A;  4QT2 A;  1NMV A;  3RFW A;  3O5R A;  1X6L A;  1J6Y A;  4WKH A;  2PPN A;  1J4H A;  5DIT A;  2RUQ A;  1NMW A;  3B9E A;  1C9H A;  4DZ3 A;  2LJ4 A;  5DIU A;  1W1T A;  2A3E A;  1U79 A;  2DT0 A;  2FDM A;  2F4E A;  1FAP A;  1NSG A;  1FFR A;  4Q7N A;  4FN2 A;  2ZQT A;  4JYS A;  5HUA A;  1A7X A;  2AWG A;  1HJW A;  3QOK A;  5HT1 A;  3FY1 A;  2ZR4 A;  5GPR A;  4ODK A;  4ODL A;  4W9P A;  2F21 A;  3ARU A;  4LAX A;  4WKF A;  3I6C A;  1RD6 A;  4DRI A;  3JXV A;  3KAB A;  3PRB A;  4P8U A;  4JFJ A;  4KQZ A;  3KZ7 A;  4S3J A;  1BL4 A;  1ZL1 A;  2RUC A;  4ODN A;  1QPL A;  1UR8 A;  1OWQ A;  2YBU A;  2B31 A;  2RQS A;  4Z2I A;  1TFV A;  2F2D A;  4IQC A;  5I98 A;  4QT3 A;  4Z2K A;  3OOB A;  3TDB A;  3ARP A;  3O5Q A;  1FKD A;  4DWS D;  4DRO A;  4MNL A;  3TCZ A;  1FFQ A;  2DG9 A;  2KGJ A;  4MTV A;  3O5O A;  1E6R A;  1D7H A;  4GIV A;  4S3K A;  1JNS A;  3VAW A;  1N1A A;  4DZ2 A;  4NZC A;  3NI6 A;  5DEZ A;  4DIP A;  1HKJ A;  4L72 B;  2OLH A;  2PPP A;  2ZQV A;  2DPE A;  1LL7 A;  2UZ5 A;  3CHF A;  2Q5A A;  4LAY A;  4Z2J A;  2ZR5 A;  2WLZ A;  1L1P A;  3KAI A;  1QZ2 A;  3AS3 A;  5DO2 A;  3PA7 A;  3O5P A;  4MPK A;  4P8W A;  1JNE A;  1Q6H A;  4Z2L A;  1EDQ A;  2G41 A;  5HBF A;  4G50 A;  1IX5 A;  1R9H A;  1TCO C;  1EQ3 A;  1LJY A;  1ZBW A;  1ROU A;  1FKJ A;  3AQU A;  3B7X A;  1NWR A;  3LUO A;  4JFM A;  3UQI A;  1P5Q A;  3H9R B;  4QZV B;  1FKG A;  3WKZ A;  2DT1 A;  1O6I A;  3IKD A;  1BKF A;  1XHG A;  3OA5 A;  2LKN A;  3PR9 A;  2M2A A;  1T11 A;  4ZPW R;  3CHC A;  3O5E A;  1FKT A;  1XRV A;  2MLX A;  4LAV A;  2QF8 A;  2ZQU A;  1ZBC A;  1F8A B;  1W9U A;  2DSW A;  3RGC A;  1ROT A;  3WD4 A;  4ODM A;  4W9Q A;  3B9A A;  4PTM A;  5HWC A;  4DWS A;  5JH8 A;  2ESC A;  4JFL A;  3O5L A;  1GOI A;  3KAG A;  4IT4 A;  3WD1 A;  4BF8 A;  5J6E A;  3ALF A;  4JFI A;  1HXV A;  2PBC A;  1Y0O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...