2PPXA

Crystal structure of a hth xre-family like protein from agrobacterium tumefaciens
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
62
structure length
62
Chain Sequence
MPRIKIIRRALKLTQEEFSARYHIPLGTLRDWEQGRSEPDQPARAYLKIIAVDPEGTAAALR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a HTH XRE-family like protein from Agrobacterium tumefaciens.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein Atu1735
total genus 24
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2007-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2ppxA00
5A7LA 1LCCA 3RZZA 1L1MA 1HF0A 4JQDA 1ZS4A 3LFPA 2GRMA 1BDHA 1LQCA 4X4FA 4J1WA 1WIZA 3FYAA 3CECA 1QPZA 1Y7YA 4O8BA 2B5AA 2AWIA 3BD1A 3U3WA 4Z5CA 2AW6A 4GHJA 2BJCA 2BNNA 1DW9A 2LYPA 1BDIA 1WH8A 3G5GA 1ZZ8A 3IVPA 3JXBC 2KZ8A 3LISA 2PIJA 1PNRA 1R69A 4OB4A 2LYRA 3HZIB 3GN5B 1QP4A 2CROA 3OQOA 4I6TA 1IC8A 4FN3A 3G7DA 4YBAA 1RZRD 2JCGA 2BNMA 1QP7A 3B7HA 4IWRA 1UXDA 4JCXA 2AXZA 4MCTA 1QP0A 2IV1A 3DNVB 3F51A 1WETA 3QF3A 2PUEA 2PUAA 2OR1L 3QQ6A 4YG1A 1X57A 4YG4A 1PRVA 2XIUA 4X4BA 4X4CA 1JFSA 2LYKA 2KPJA 3CROL 2IUOA 3BS3A 2HINA 3TRBA 2BNOA 4IVZA 3KJXA 3H5TA 1AU7A 3D1NI 2IU7A 1ZZ9A 1S7EA 3EUSA 1JWLA 4X4IA 3CLCA 4Z5DA 1ZZ6A 1LCDA 2CSFA 4I6RA 1ZAYA 1GT0C 1Y9QA 3GN5A 1ZUGA 2AXVA 4Z58A 2D5VA 2XJ3A 3OMTA 1SQ8A 1RZSA 4Z59A 3SCGA 2KEKA 2H8RA 3QWGA 4FBIA 2LYQA 2MEZA 4Y42A 4YG7B 4PU3C 5K98B 1O4XA 2AXUA 1R63A 3SCFA 1UTXA 1B0NA 3O9XA 1POUA 2EF8A 1LMB3 3PXPA 4X4EA 3UFDA 4PU4C 1DWKA 2XI8A 3FMYA 2ICPA 4Z5HA 2EBYA 4GQMA 3L1PA 2KEIA 2IVGA 3OQMA 4X4HA 1QQBA 1VPWA 1ADRA 1ZZBA 4JCYA 2GZUA 2PPXA 1OSLA 2IVQA 2LYLA 3S8QA 1JH9A 2R63A 2EWTA 1ZZ7A 2LCVA 2O49A 1E3OC 2OFYA 2XCJA 2R1JL 2PUDA 2FJRA 2PUGA 2L8NA 2PUFA 3JXCL 3GBFA 4IA8A 2MQKA 1NERA 2XSDC 3ZKCA 1OCTC 1NEQA 2JVLA 4I6UA 4NDWA 1YSEA 2WUSR 3F52A 1PERL 4MCXA 1X2LA 1ZPQA 1EFAA 3OQNA 1PRAA 1XWRA 2A6CA 2GRLA 3BDNA 4X4GA 1RPEL 2PUCA 3ZHIA 2WIUB 1ZVVA 1CQTA 2O38A 4J1XA 3KXAA 1RZRA 4YARA 3OP9A 1PRUA 2O4AA 1RIOA 2PUBA 3SCHA 1ZZCA 2ICTA 1WH6A 3R1FA 4PU7A 2L49A 3QYXA 4I8TA 4X4DA 2AUWA 2IVBA 2PE5A 1LLIA 3MLFA 3FYMA 2HSGA 2LYSA 2LYJA 1JFTA 1CJGA 4PU8A 2KEJA 3VK0A 4F8DA 1UXCA 3F6WA 3JXDL 3ZHMA 3KZ3A 1QQAA
chains in the Genus database with same CATH superfamily
4JQDA 1LQCA 4X4FA 4J1WA 1WIZA 3CECA 4Z5CA 4GHJA 1DW9A 1ZZ8A 3IVPA 3LISA 1HQ1A 2LYRA 1QP4A 1IC8A 3SR4A 2XXQA 2HCSA 1QP0A 2IV1A 2J7UA 2XIUA 4X4BA 1U2ZA 2IUOA 4IVZA 4ER0A 1ZZ9A 4Z5DA 2CSFA 3GN5A 1ZUGA 2D5VA 2XJ3A 2KEKA 4Z59A 3QWGA 4FBIA 2LYQA 2MEZA 4YG7B 5DSXA 2AXUA 1B0NA 3GZDC 3O9XA 1POUA 3PXPA 4X4EA 3FMYA 1ZZBA 4JCYA 2GZUA 1OSLA 2R63A 2EWTA 2XCJA 2PUGA 4DE9A 1OCTC 1NEQA 3F52A 3UWPA 1PRAA 2LNMA 3BDNA 3TELA 2FFHA 1CQTA 1PRUA 1RIOA 2PUBA 3SCHA 2ICTA 1WH6A 3QYXA 4X4DA 2IVBA 2PE5A 1DULA 1LLIA 3A9YA 2LYSA 2LYJA 3R09A 3KZ3A 1QQAA 3RZZA 1HF0A 3U3WA 3TEPA 2KZ8A 1R69A 3HZIB 2LLVA 2JCGA 3B7HA 4IWRA 1QB2A 4MCTA 1WETA 3QF3A 2OR1L 3QQ6A 4YG4A 2LYKA 3CROL 2HINA 5JUWA 4EKGA 1JWLA 2PXUA 4X4IA 3CLCA 1ZZ6A 1ZAYA 4EK9A 3SCGA 2PXTA 3OKZA 4PU3C 3LQXA 2PXDA 2M4HA 1UTXA 1QZXA 4PU4C 3NZLA 4Q2JA 1DWKA 2EBYA 4GQMA 2IVGA 3NXHA 3QOWA 3ZPXA 4ER7A 2PPXA 2IVQA 1JH9A 2O49A 2PUDA 2XSDC 4EKIA 1ADRA 3ZKCA 4NDWA 2JVLA 4I6UA 1YSEA 4MCXA 2HFZA 2ODRD 1ZPQA 1XWRA 3PE5A 3GUUA 2WIUB 1RZRA 4ER5A 4YARA 3A9ZA 3M9LA 3NDBB 4EZIA 2KEJA 3VK0A 5DT2A 3SX0A 5A7LA 3GZDA 1LCCA 5DTRA 2GRMA 4DE8A 5DRTA 2PXKA 1QPZA 1Y7YA 4O8BA 3BD1A 4ER3A 2AW6A 1BDIA 1WH8A 3JXBC 2PXEA 1PNRA 4OB4A 1MFQC 3GN5B 4HRAA 4FN3A 4YBAA 2BNMA 2XXPA 4JCXA 2PXQA 3DM5A 3DNVB 2PUEA 4YG1A 4X4CA 1PRVA 3GZCA 1JFSA 2KPJA 3BS3A 3H5TA 1AU7A 3D1NI 2IU7A 1LCDA 4I6RA 1Y9QA 2AXVA 4Z58A 1SQ8A 1RZSA 2H8RA 2PXLA 4Y42A 5K98B 1O4XA 1R63A 3SCFA 1LMB3 2ICPA 3L1PA 2PXFA 3S8QA 2LYLA 1ZZ7A 1E3OC 2OFYA 3ME5A 2XXAA 2FJRA 2L8NA 3GBFA 2MQKA 3A9XA 2WUSR 2JQEA 5DTQA 3OQNA 2GRLA 4X4GA 2PUCA 1ZVVA 3QOXA 4EQZA 4J1XA 3KXAA 2PXVA 2O4AA 1ZZCA 4PU7A 2L49A 4WVLA 1JFTA 3ZHMA 4OBMA 1UXCA 3F6WA 3NROA 2L1PA 2LLWA 1L1MA 1ZS4A 3LFPA 1BDHA 3VWSA 3FYAA 3TFLA 2B5AA 2AWIA 2BJCA 2BNNA 2LYPA 3G5GA 4ER6A 2PIJA 2VEOA 2CROA 3KL4A 3OQOA 4I6TA 3G7DA 1RZRD 1QP7A 2J7WA 5GAHi 2HCNA 1UXDA 2AXZA 3F51A 2V3CC 2PUAA 1X57A 3QFIA 3TRBA 2BNOA 3KJXA 1S7EA 3EUSA 3G0TA 1GT0C 3OMTA 2MXDA 2PXPA 3OWQA 2EF8A 3UFDA 5DRYA 2XI8A 4Z5HA 2KEIA 2YBDA 2PXBA 3OQMA 4X4HA 1QQBA 1VPWA 2LCVA 2R1JL 2PUFA 3JXCL 1NERA 1PERL 1X2LA 1EFAA 5DTMA 2A6CA 5GAGi 1RPEL 3ZHIA 2O38A 3OP9A 3MEJA 3R1FA 4I8TA 2AUWA 3MLFA 3FYMA 2HSGA 1CJGA 4PU8A 4F8DA 3JXDL 4IA8A 1NW3A
chains in the Genus database with same CATH topology
5A7LA 1LCCA 3RZZA 1L1MA 1HF0A 4JQDA 1ZS4A 3LFPA 2GRMA 1BDHA 1LQCA 4X4FA 4J1WA 1WIZA 3FYAA 3CECA 1QPZA 1Y7YA 4O8BA 2B5AA 2AWIA 3BD1A 3U3WA 4Z5CA 2AW6A 4GHJA 2BJCA 2BNNA 1DW9A 2LYPA 1BDIA 1WH8A 3G5GA 1ZZ8A 3IVPA 3JXBC 2KZ8A 3LISA 2PIJA 1PNRA 1R69A 4OB4A 2LYRA 3HZIB 3GN5B 1QP4A 2CROA 3OQOA 4I6TA 1IC8A 4FN3A 3G7DA 4YBAA 1RZRD 2JCGA 2BNMA 1QP7A 3B7HA 4IWRA 1UXDA 4JCXA 2AXZA 4MCTA 1QP0A 2IV1A 3DNVB 3F51A 1WETA 3QF3A 2PUEA 2PUAA 2OR1L 3QQ6A 4YG1A 1X57A 4YG4A 1PRVA 2XIUA 4X4BA 4X4CA 1JFSA 2LYKA 2KPJA 3CROL 2IUOA 3BS3A 2HINA 3TRBA 2BNOA 4IVZA 3KJXA 3H5TA 1AU7A 3D1NI 2IU7A 1ZZ9A 1S7EA 3EUSA 1JWLA 4X4IA 3CLCA 4Z5DA 1ZZ6A 1LCDA 2CSFA 4I6RA 1ZAYA 1GT0C 1Y9QA 3GN5A 1ZUGA 2AXVA 4Z58A 2D5VA 2XJ3A 3OMTA 1SQ8A 1RZSA 4Z59A 3SCGA 2KEKA 2H8RA 3QWGA 4FBIA 2LYQA 2MEZA 4Y42A 4YG7B 4PU3C 5K98B 1O4XA 2AXUA 1R63A 3SCFA 1UTXA 1B0NA 3O9XA 1POUA 2EF8A 1LMB3 3PXPA 4X4EA 3UFDA 4PU4C 1DWKA 2XI8A 3FMYA 2ICPA 4Z5HA 2EBYA 4GQMA 3L1PA 2KEIA 2IVGA 3OQMA 4X4HA 1QQBA 1VPWA 1ADRA 1ZZBA 4JCYA 2GZUA 2PPXA 1OSLA 2IVQA 2LYLA 3S8QA 1JH9A 2R63A 2EWTA 1ZZ7A 2LCVA 2O49A 1E3OC 2OFYA 2XCJA 2R1JL 2PUDA 2FJRA 2PUGA 2L8NA 2PUFA 3JXCL 3GBFA 4IA8A 2MQKA 1NERA 2XSDC 3ZKCA 1OCTC 1NEQA 2JVLA 4I6UA 4NDWA 1YSEA 2WUSR 3F52A 1PERL 4MCXA 1X2LA 1ZPQA 1EFAA 3OQNA 1PRAA 1XWRA 2A6CA 2GRLA 3BDNA 4X4GA 1RPEL 2PUCA 3ZHIA 2WIUB 1ZVVA 1CQTA 2O38A 4J1XA 3KXAA 1RZRA 4YARA 3OP9A 1PRUA 2O4AA 1RIOA 2PUBA 3SCHA 1ZZCA 2ICTA 1WH6A 3R1FA 4PU7A 2L49A 3QYXA 4I8TA 4X4DA 2AUWA 2IVBA 2PE5A 1LLIA 3MLFA 3FYMA 2HSGA 2LYSA 2LYJA 1JFTA 1CJGA 4PU8A 2KEJA 3VK0A 4F8DA 1UXCA 3F6WA 3JXDL 3ZHMA 3KZ3A 1QQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A7L A;  1LCC A;  3RZZ A;  1L1M A;  1HF0 A;  4JQD A;  1ZS4 A;  3LFP A;  2GRM A;  1BDH A;  1LQC A;  4X4F A;  4J1W A;  1WIZ A;  3FYA A;  3CEC A;  1QPZ A;  1Y7Y A;  4O8B A;  2B5A A;  2AWI A;  3BD1 A;  3U3W A;  4Z5C A;  2AW6 A;  4GHJ A;  2BJC A;  2BNN A;  1DW9 A;  2LYP A;  1BDI A;  1WH8 A;  3G5G A;  1ZZ8 A;  3IVP A;  3JXB C;  2KZ8 A;  3LIS A;  2PIJ A;  1PNR A;  1R69 A;  4OB4 A;  2LYR A;  3HZI B;  3GN5 B;  1QP4 A;  2CRO A;  3OQO A;  4I6T A;  1IC8 A;  4FN3 A;  3G7D A;  4YBA A;  1RZR D;  2JCG A;  2BNM A;  1QP7 A;  3B7H A;  4IWR A;  1UXD A;  4JCX A;  2AXZ A;  4MCT A;  1QP0 A;  2IV1 A;  3DNV B;  3F51 A;  1WET A;  3QF3 A;  2PUE A;  2PUA A;  2OR1 L;  3QQ6 A;  4YG1 A;  1X57 A;  4YG4 A;  1PRV A;  2XIU A;  4X4B A;  4X4C A;  1JFS A;  2LYK A;  2KPJ A;  3CRO L;  2IUO A;  3BS3 A;  2HIN A;  3TRB A;  2BNO A;  4IVZ A;  3KJX A;  3H5T A;  1AU7 A;  3D1N I;  2IU7 A;  1ZZ9 A;  1S7E A;  3EUS A;  1JWL A;  4X4I A;  3CLC A;  4Z5D A;  1ZZ6 A;  1LCD A;  2CSF A;  4I6R A;  1ZAY A;  1GT0 C;  1Y9Q A;  3GN5 A;  1ZUG A;  2AXV A;  4Z58 A;  2D5V A;  2XJ3 A;  3OMT A;  1SQ8 A;  1RZS A;  4Z59 A;  3SCG A;  2KEK A;  2H8R A;  3QWG A;  4FBI A;  2LYQ A;  2MEZ A;  4Y42 A;  4YG7 B;  4PU3 C;  5K98 B;  1O4X A;  2AXU A;  1R63 A;  3SCF A;  1UTX A;  1B0N A;  3O9X A;  1POU A;  2EF8 A;  1LMB 3;  3PXP A;  4X4E A;  3UFD A;  4PU4 C;  1DWK A;  2XI8 A;  3FMY A;  2ICP A;  4Z5H A;  2EBY A;  4GQM A;  3L1P A;  2KEI A;  2IVG A;  3OQM A;  4X4H A;  1QQB A;  1VPW A;  1ADR A;  1ZZB A;  4JCY A;  2GZU A;  2PPX A;  1OSL A;  2IVQ A;  2LYL A;  3S8Q A;  1JH9 A;  2R63 A;  2EWT A;  1ZZ7 A;  2LCV A;  2O49 A;  1E3O C;  2OFY A;  2XCJ A;  2R1J L;  2PUD A;  2FJR A;  2PUG A;  2L8N A;  2PUF A;  3JXC L;  3GBF A;  4IA8 A;  2MQK A;  1NER A;  2XSD C;  3ZKC A;  1OCT C;  1NEQ A;  2JVL A;  4I6U A;  4NDW A;  1YSE A;  2WUS R;  3F52 A;  1PER L;  4MCX A;  1X2L A;  1ZPQ A;  1EFA A;  3OQN A;  1PRA A;  1XWR A;  2A6C A;  2GRL A;  3BDN A;  4X4G A;  1RPE L;  2PUC A;  3ZHI A;  2WIU B;  1ZVV A;  1CQT A;  2O38 A;  4J1X A;  3KXA A;  1RZR A;  4YAR A;  3OP9 A;  1PRU A;  2O4A A;  1RIO A;  2PUB A;  3SCH A;  1ZZC A;  2ICT A;  1WH6 A;  3R1F A;  4PU7 A;  2L49 A;  3QYX A;  4I8T A;  4X4D A;  2AUW A;  2IVB A;  2PE5 A;  1LLI A;  3MLF A;  3FYM A;  2HSG A;  2LYS A;  2LYJ A;  1JFT A;  1CJG A;  4PU8 A;  2KEJ A;  3VK0 A;  4F8D A;  1UXC A;  3F6W A;  3JXD L;  3ZHM A;  3KZ3 A;  1QQA A; 
#chains in the Genus database with same CATH topology
 4JQD A;  1LQC A;  4X4F A;  4J1W A;  1WIZ A;  3CEC A;  4Z5C A;  4GHJ A;  1DW9 A;  1ZZ8 A;  3IVP A;  3LIS A;  1HQ1 A;  2LYR A;  1QP4 A;  1IC8 A;  3SR4 A;  2XXQ A;  2HCS A;  1QP0 A;  2IV1 A;  2J7U A;  2XIU A;  4X4B A;  1U2Z A;  2IUO A;  4IVZ A;  4ER0 A;  1ZZ9 A;  4Z5D A;  2CSF A;  3GN5 A;  1ZUG A;  2D5V A;  2XJ3 A;  2KEK A;  4Z59 A;  3QWG A;  4FBI A;  2LYQ A;  2MEZ A;  4YG7 B;  5DSX A;  2AXU A;  1B0N A;  3GZD C;  3O9X A;  1POU A;  3PXP A;  4X4E A;  3FMY A;  1ZZB A;  4JCY A;  2GZU A;  1OSL A;  2R63 A;  2EWT A;  2XCJ A;  2PUG A;  4DE9 A;  1OCT C;  1NEQ A;  3F52 A;  3UWP A;  1PRA A;  2LNM A;  3BDN A;  3TEL A;  2FFH A;  1CQT A;  1PRU A;  1RIO A;  2PUB A;  3SCH A;  2ICT A;  1WH6 A;  3QYX A;  4X4D A;  2IVB A;  2PE5 A;  1DUL A;  1LLI A;  3A9Y A;  2LYS A;  2LYJ A;  3R09 A;  3KZ3 A;  1QQA A;  3RZZ A;  1HF0 A;  3U3W A;  3TEP A;  2KZ8 A;  1R69 A;  3HZI B;  2LLV A;  2JCG A;  3B7H A;  4IWR A;  1QB2 A;  4MCT A;  1WET A;  3QF3 A;  2OR1 L;  3QQ6 A;  4YG4 A;  2LYK A;  3CRO L;  2HIN A;  5JUW A;  4EKG A;  1JWL A;  2PXU A;  4X4I A;  3CLC A;  1ZZ6 A;  1ZAY A;  4EK9 A;  3SCG A;  2PXT A;  3OKZ A;  4PU3 C;  3LQX A;  2PXD A;  2M4H A;  1UTX A;  1QZX A;  4PU4 C;  3NZL A;  4Q2J A;  1DWK A;  2EBY A;  4GQM A;  2IVG A;  3NXH A;  3QOW A;  3ZPX A;  4ER7 A;  2PPX A;  2IVQ A;  1JH9 A;  2O49 A;  2PUD A;  2XSD C;  4EKI A;  1ADR A;  3ZKC A;  4NDW A;  2JVL A;  4I6U A;  1YSE A;  4MCX A;  2HFZ A;  2ODR D;  1ZPQ A;  1XWR A;  3PE5 A;  3GUU A;  2WIU B;  1RZR A;  4ER5 A;  4YAR A;  3A9Z A;  3M9L A;  3NDB B;  4EZI A;  2KEJ A;  3VK0 A;  5DT2 A;  3SX0 A;  5A7L A;  3GZD A;  1LCC A;  5DTR A;  2GRM A;  4DE8 A;  5DRT A;  2PXK A;  1QPZ A;  1Y7Y A;  4O8B A;  3BD1 A;  4ER3 A;  2AW6 A;  1BDI A;  1WH8 A;  3JXB C;  2PXE A;  1PNR A;  4OB4 A;  1MFQ C;  3GN5 B;  4HRA A;  4FN3 A;  4YBA A;  2BNM A;  2XXP A;  4JCX A;  2PXQ A;  3DM5 A;  3DNV B;  2PUE A;  4YG1 A;  4X4C A;  1PRV A;  3GZC A;  1JFS A;  2KPJ A;  3BS3 A;  3H5T A;  1AU7 A;  3D1N I;  2IU7 A;  1LCD A;  4I6R A;  1Y9Q A;  2AXV A;  4Z58 A;  1SQ8 A;  1RZS A;  2H8R A;  2PXL A;  4Y42 A;  5K98 B;  1O4X A;  1R63 A;  3SCF A;  1LMB 3;  2ICP A;  3L1P A;  2PXF A;  3S8Q A;  2LYL A;  1ZZ7 A;  1E3O C;  2OFY A;  3ME5 A;  2XXA A;  2FJR A;  2L8N A;  3GBF A;  2MQK A;  3A9X A;  2WUS R;  2JQE A;  5DTQ A;  3OQN A;  2GRL A;  4X4G A;  2PUC A;  1ZVV A;  3QOX A;  4EQZ A;  4J1X A;  3KXA A;  2PXV A;  2O4A A;  1ZZC A;  4PU7 A;  2L49 A;  4WVL A;  1JFT A;  3ZHM A;  4OBM A;  1UXC A;  3F6W A;  3NRO A;  2L1P A;  2LLW A;  1L1M A;  1ZS4 A;  3LFP A;  1BDH A;  3VWS A;  3FYA A;  3TFL A;  2B5A A;  2AWI A;  2BJC A;  2BNN A;  2LYP A;  3G5G A;  4ER6 A;  2PIJ A;  2VEO A;  2CRO A;  3KL4 A;  3OQO A;  4I6T A;  3G7D A;  1RZR D;  1QP7 A;  2J7W A;  5GAH i;  2HCN A;  1UXD A;  2AXZ A;  3F51 A;  2V3C C;  2PUA A;  1X57 A;  3QFI A;  3TRB A;  2BNO A;  3KJX A;  1S7E A;  3EUS A;  3G0T A;  1GT0 C;  3OMT A;  2MXD A;  2PXP A;  3OWQ A;  2EF8 A;  3UFD A;  5DRY A;  2XI8 A;  4Z5H A;  2KEI A;  2YBD A;  2PXB A;  3OQM A;  4X4H A;  1QQB A;  1VPW A;  2LCV A;  2R1J L;  2PUF A;  3JXC L;  1NER A;  1PER L;  1X2L A;  1EFA A;  5DTM A;  2A6C A;  5GAG i;  1RPE L;  3ZHI A;  2O38 A;  3OP9 A;  3MEJ A;  3R1F A;  4I8T A;  2AUW A;  3MLF A;  3FYM A;  2HSG A;  1CJG A;  4PU8 A;  4F8D A;  3JXD L;  4IA8 A;  1NW3 A; 
#chains in the Genus database with same CATH homology
 5A7L A;  1LCC A;  3RZZ A;  1L1M A;  1HF0 A;  4JQD A;  1ZS4 A;  3LFP A;  2GRM A;  1BDH A;  1LQC A;  4X4F A;  4J1W A;  1WIZ A;  3FYA A;  3CEC A;  1QPZ A;  1Y7Y A;  4O8B A;  2B5A A;  2AWI A;  3BD1 A;  3U3W A;  4Z5C A;  2AW6 A;  4GHJ A;  2BJC A;  2BNN A;  1DW9 A;  2LYP A;  1BDI A;  1WH8 A;  3G5G A;  1ZZ8 A;  3IVP A;  3JXB C;  2KZ8 A;  3LIS A;  2PIJ A;  1PNR A;  1R69 A;  4OB4 A;  2LYR A;  3HZI B;  3GN5 B;  1QP4 A;  2CRO A;  3OQO A;  4I6T A;  1IC8 A;  4FN3 A;  3G7D A;  4YBA A;  1RZR D;  2JCG A;  2BNM A;  1QP7 A;  3B7H A;  4IWR A;  1UXD A;  4JCX A;  2AXZ A;  4MCT A;  1QP0 A;  2IV1 A;  3DNV B;  3F51 A;  1WET A;  3QF3 A;  2PUE A;  2PUA A;  2OR1 L;  3QQ6 A;  4YG1 A;  1X57 A;  4YG4 A;  1PRV A;  2XIU A;  4X4B A;  4X4C A;  1JFS A;  2LYK A;  2KPJ A;  3CRO L;  2IUO A;  3BS3 A;  2HIN A;  3TRB A;  2BNO A;  4IVZ A;  3KJX A;  3H5T A;  1AU7 A;  3D1N I;  2IU7 A;  1ZZ9 A;  1S7E A;  3EUS A;  1JWL A;  4X4I A;  3CLC A;  4Z5D A;  1ZZ6 A;  1LCD A;  2CSF A;  4I6R A;  1ZAY A;  1GT0 C;  1Y9Q A;  3GN5 A;  1ZUG A;  2AXV A;  4Z58 A;  2D5V A;  2XJ3 A;  3OMT A;  1SQ8 A;  1RZS A;  4Z59 A;  3SCG A;  2KEK A;  2H8R A;  3QWG A;  4FBI A;  2LYQ A;  2MEZ A;  4Y42 A;  4YG7 B;  4PU3 C;  5K98 B;  1O4X A;  2AXU A;  1R63 A;  3SCF A;  1UTX A;  1B0N A;  3O9X A;  1POU A;  2EF8 A;  1LMB 3;  3PXP A;  4X4E A;  3UFD A;  4PU4 C;  1DWK A;  2XI8 A;  3FMY A;  2ICP A;  4Z5H A;  2EBY A;  4GQM A;  3L1P A;  2KEI A;  2IVG A;  3OQM A;  4X4H A;  1QQB A;  1VPW A;  1ADR A;  1ZZB A;  4JCY A;  2GZU A;  2PPX A;  1OSL A;  2IVQ A;  2LYL A;  3S8Q A;  1JH9 A;  2R63 A;  2EWT A;  1ZZ7 A;  2LCV A;  2O49 A;  1E3O C;  2OFY A;  2XCJ A;  2R1J L;  2PUD A;  2FJR A;  2PUG A;  2L8N A;  2PUF A;  3JXC L;  3GBF A;  4IA8 A;  2MQK A;  1NER A;  2XSD C;  3ZKC A;  1OCT C;  1NEQ A;  2JVL A;  4I6U A;  4NDW A;  1YSE A;  2WUS R;  3F52 A;  1PER L;  4MCX A;  1X2L A;  1ZPQ A;  1EFA A;  3OQN A;  1PRA A;  1XWR A;  2A6C A;  2GRL A;  3BDN A;  4X4G A;  1RPE L;  2PUC A;  3ZHI A;  2WIU B;  1ZVV A;  1CQT A;  2O38 A;  4J1X A;  3KXA A;  1RZR A;  4YAR A;  3OP9 A;  1PRU A;  2O4A A;  1RIO A;  2PUB A;  3SCH A;  1ZZC A;  2ICT A;  1WH6 A;  3R1F A;  4PU7 A;  2L49 A;  3QYX A;  4I8T A;  4X4D A;  2AUW A;  2IVB A;  2PE5 A;  1LLI A;  3MLF A;  3FYM A;  2HSG A;  2LYS A;  2LYJ A;  1JFT A;  1CJG A;  4PU8 A;  2KEJ A;  3VK0 A;  4F8D A;  1UXC A;  3F6W A;  3JXD L;  3ZHM A;  3KZ3 A;  1QQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...