2PQTA

Human n-acetyltransferase 1
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
295
structure length
294
Chain Sequence
b'GSGSGSDIEAYFERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVVRRNRGGWLQVNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYIVDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDLLEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLTHRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arylamine N-acetyltransferase 1
publication title Structural Basis of Substrate-binding Specificity of Human Arylamine N-Acetyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 294
sequence length 295
ec nomenclature ec 2.3.1.5: Arylamine N-acetyltransferase.
pdb deposition date 2007-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00797 Acetyltransf_2 N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2140.20 Alpha Beta 2-Layer Sandwich Arylamine N-acetyltransferase fold Arylamine N-acetyltransferase fold 2pqtA00
3LNBA 2PFRA 4DMOA 2PQTA 2IJAA
chains in the Genus database with same CATH superfamily
2PFRA 4BGFA 4DMOA 1W5RA 3LNBA 4NV8A 1W6FA 2IJAA 4GUZA 2VFCA 1W4TA 2BSZA 4B55A 3D9WA 1GX3A 4C5PA 3LTWA 2PQTA 4NV7A 2VFBA
chains in the Genus database with same CATH topology
3LNBA 2PFRA 4DMOA 2PQTA 2IJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LNB A;  2PFR A;  4DMO A;  2PQT A;  2IJA A; 
#chains in the Genus database with same CATH topology
 2PFR A;  4BGF A;  4DMO A;  1W5R A;  3LNB A;  4NV8 A;  1W6F A;  2IJA A;  4GUZ A;  2VFC A;  1W4T A;  2BSZ A;  4B55 A;  3D9W A;  1GX3 A;  4C5P A;  3LTW A;  2PQT A;  4NV7 A;  2VFB A; 
#chains in the Genus database with same CATH homology
 3LNB A;  2PFR A;  4DMO A;  2PQT A;  2IJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...