2PQWA

Crystal structure of l3mbtl1 in complex with h4k20me2 (residues 17-25), trigonal form
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
315
structure length
315
Chain Sequence
WSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title L3MBTL1 recognition of mono- and dimethylated histones.
pubmed doi rcsb
molecule keywords Lethal(3)malignant brain tumor-like protein
molecule tags Transcription
source organism Homo sapiens
total genus 78
structure length 315
sequence length 315
ec nomenclature
pdb deposition date 2007-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2pqwA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2pqwA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2pqwA03
2PQWA 3OYJA 2RI2A 2RHYA 5KCOA 1H3ZA 4UC4A 3L2UA 1OZ2A 2RJEA 3NTHA 3DB3A 5FRNA 3OMGA 2YRVA 1WJSA 2RJCA 2BIVA 2LRQA 2RI5A 2L3RA 2O4XA 2E6NA 3GOXA 3FEOA 4C5IA 3L2RA 3OYAA 4IUUA 4A4HA 3BDLA 4N4GA 4E7JA 4ZTJA 3L2QA 4X34A 2L89A 2X4WA 4C5GA 3L2VA 2HQEA 2E5QA 3S3NA 4A4EA 2L8DA 3C4SA 4QVZA 3PMIA 3OYCA 3OYFA 2BKDN 4QQDA 5KE2A 2LVMA 4L59A 1MHNA 2XK0A 1SSFA 4FL6A 3OS2A 2CKKA 3OB9A 2GFUA 2MWPA 2B8AA 4IUVA 4A4GA 3MEWA 2NLUA 5KE3A 3L42A 3LX7A 4LD6A 5J39A 4B9WA 2DIGA 2LCCA 1N27A 1WJQA 3E9GA 5FRMA 3FDRA 4IUQA 1OI1A 4BACA 2BUDA 2RHXA 2EQJA 2XDPA 5KCHA 3MP1A 3QIIA 3UWNA 3QBYA 4E7HA 1XNIA 3MEUA 3LGLA 4HCZA 2QQRA 3OS0A 2EFIA 3MP6A 5D6WA 5M9OA 3OYGA 3F70A 3OYBA 1G5VA 2R5MA 2DIQA 3H8ZA 2JZ2A 2EQMA 2RHUA 3P8DA 1WGSA 1WJRA 4RG2A 4BE2A 5D6XA 2RHZA 1RI0A 2G3RA 4PLIA 4A4FA 3MO8A 4E7LA 5C6SA 3MEVA 2F5KA 3QKJA 3P8HA 1OZ3A 1OYXA 3OYLA 4E7KA 2X4XA 4PLLA 3OYHA 2O4XB 3KUFA 3PFSA 3PNWC 3LYIA 3QJ6A 4QQ6A 4BDYA 4IKFA 4BE0A 4Q5WA 3OYEA 4BE1A 3OYMA 3MEAA 4II1A 3M9QA 3OQ5A 2X4YA 3MP8A 5KH6A 4QQGA 4C5HA 4GY5A 2RHIA 2D9TA 4IURA 3OYNA 2EQKA 3FC3A 3S3OA 2RO0A 2RI3A 2FHDA 3O8VA 2JTFA 3LGFA 3S6WA 2EKOA 4IUTA 2GFAA 4N4HA 3OMCA 4Z02A 3NTKA 4EDUA 3ME9A 4BD3A 3Q1JA 3LH0A 5D6YA 1KHCA 3META 4B9XA 2X35A 4E7IA 3NTIA 2IG0A 2RJDA 2WACA 4BDZA 2M1HA 4QW2A 5IN1A 3LLRA 5C0MA 3OYDA 3OYKA 3E9FA 3UT1A 2R57A 3FLGA 3OA6A 2QQSA 4PL6A 2M0OA 2RJFA 3L2WA 5IAYA 2LTOA 2EQUA 2M16A 5CIUA 3H6ZA 3OS1A 4FU6A 4OVAA 2VYTA 3OY9A 3PMTA 3EAEA 2DAQA 2HQXA 3SD4A 2R58A 4N4IA 4ZTFA 5J26A 3ASKA 2MWOA 3OYIA 4C5EA 2K3XA 4IUPA 3DLMA 4CRIA 3CEYA 3DB4A 3ZEHA 2R5AA 2GF7A 5FROA 4NS5A 2P0KA 3S3MA 2K3YA 2LDMA
chains in the Genus database with same CATH superfamily
2JN0A 1H3ZA 2PVDB 1VQ4T 1AWXA 1WDXA 1RAHB 2BIVA 4XU1A 2O4XA 4F14A 5GJVB 4C5IA 1YJ9Q 4X9DA 1PRMC 5IXBA 2ZCFB 3OS5A 5FU7B 3S3NA 1UTIA 2DM1A 1JEGA 2RK2A 1PWTA 1V1CA 4QQDA 1VIFA 3M58A 1VQPQ 1MNEA 4MMKA 5LJ5j 2O31A 2EKHA 1QMCA 2E10A 1YHQA 1I07A 3CCJA 2BUDA 2XICA 4MDXA 5KCHA 5GMKl 1Q82C 2CYZB 4E7HA 3LH5A 3CCQT 1NPPA 3OS0A 4DBQA 3EGUA 3MP6A 4E7SA 3A5ZB 1R0CB 1LPLA 2DF6A 4R55A 4DBFA 4JJCA 1XOVA 3QKJA 1VQ5T 4RTZA 4P5NA 2C0TA 1ZA1B 1ZUKA 1VQ6T 3M9QA 1YI2A 4FSXA 3VS4A 4A4KA 4C8QC 2YHTA 3JB9F 4C8QF 2BE9B 1M1KC 2CSQA 4J9FA 4Z02A 2HNIA 1M3CA 2L3PA 3CCLT 4KULA 4E7IA 2DETA 4RTYA 4BDZA 4AFQC 1Z9ZA 1QP3A 3MCAB 3CCQQ 4C92A 5IAYA 5I2SA 2LTOA 2EQUA 4JJNK 1Y7XA 2D0QB 3GP8A 2D8HA 2G6FX 1S72A 1K9AA 1N8RC 4JLGA 4CC7A 2EYZA 2E12A 1X43A 4M75D 1MMGA 2KXDA 1UGSB 2EBPA 1Q7YC 3ZEHA 2XIDA 1VQ5Q 3PVQA 4OB3B 3GLXA 2PUOB 4X9CA 4XTUA 4JS4A 1VQ6Q 1TH7A 1VQ9A 3L2UA 4M7AE 1T3SA 1M2VB 2M02A 3A8LB 5LJ5g 2KYBA 1GCPA 1LJOA 2DBMA 3QYGB 3L2QA 2YUQA 4A4EA 2HBPA 2V8KA 3CCLQ 2DVJA 2RNAA 1WHKA 1IXDA 3HRSA 4MDWA 5FW9A 2K5FA 2J06A 2B8AA 2JM8A 2QI2A 3MEWA 1W2BP 2ECZA 2CS7A 2MIOA 2HSPA 4D8DA 4F7UF 1TXQA 1VQMT 3QBYA 1UGQB 5LJ3h 3CCVA 5LJ5e 2QDLA 1U06A 5GAN6 1VYVA 4PJMA 5I22A 3H41A 2JVVA 1YJNQ 2DXCA 4MZPA 3JB9J 4PFZA 1M1FA 3HRUA 4RUGA 5KYUA 1NEGA 4R0KA 1YP5A 4QQ6A 3QJ6A 1VQ7T 3EG2A 3VS3A 2V26A 4N0AA 4II1A 1BI3A 1M30A 1PC0A 2K2MA 2X4YA 1QWEA 4LE9A 4M75F 2JJ9A 1D1BA 2RO0A 2XD0A 4KT0E 4BD3A 2SEMA 3BE3A 4J83A 1JRIA 1GRIA 1X6OA 1VQMQ 1VQLA 2FPDA 4PJJA 1D1CA 1N8RU 2JTMA 2B86A 3LW5E 3VUBA 5LL6S 5CQYA 1QCNA 1YBYA 4M7DE 4OP0A 4OMNA 3OYIA 2DTHA 1WXTA 4OMFB 1YJ9A 2CSIA 2DMOA 4M78E 1BI0A 1VQ7Q 3EGXB 4C8QA 3WXMB 3OYJA 3PT9A 4PJOF 2FRWA 2DYIA 4Y91A 1Y57A 4ZNXA 1NE8A 1TUDA 1SPKA 2LX7A 4RMOA 1M8VA 4N4GA 1MNDA 3JCMQ 1I1JA 3QWYA 4OGEA 1FWZA 4WF2A 1HYOA 3C4SA 2XMFA 2A37A 2EGCA 3T9NA 2XG8D 2JOYA 3URGA 2NUTA 2GNCA 3CCST 1HJDA 3RMSA 5J39A 2LNHB 4M7AB 1OI1A 5GAN8 1VYTA 3V7RA 1O9SA 3M4GA 3RDVA 3JCMW 1UG1A 2J7IA 3GBQA 3JCMb 1WGSA 4GBQA 4WTOB 4FIBA 1FMWA 3UPUA 1ZUYA 3OYLA 5FU6B 2WSEE 4KRTA 4JPBW 5GAN7 3X20B 3VU3C 4A54A 3BW1A 1XJWB 2CZ6B 1IGUA 2YRDA 1NJIR 3OYNA 3J7AF 3RNJA 1X75C 3NHNA 4F7UA 3CCSQ 3TEEA 1V76A 1M3AA 1D1AA 4E6RA 3LH0A 1KHCA 1GCQA 1VQ5A 2IPOB 5LJ3j 1U5SA 3OA6A 1VIEA 2XU8A 1PHTA 3E19A 1AOJA 1VQNT 3OY9A 4MMLA 2CP7A 1DJ7B 2HEQA 4M75A 2LQWA 1I4K1 3UDCA 2K3YA 2PQWA 2DFUA 1N6AA 1M4ZA 3X24B 1BCOA 2X3WD 3OMGA 2KK4A 2VC8A 2M9UA 2GGRA 3CC2A 3HPWA 3M0RA 4QVDA 1TU0B 5GAOl 1J3TA 1NM7A 3G71A 4M7DB 1G3WA 1WHJA 1D0XA 1X69A 2JS2A 2P0QA 4AG2C 1D09B 2MWPA 3EG9B 2DL3A 4M78B 3A98A 2JS0A 4E47A 2VUBA 2DKGA 4BACA 1PM3A 2D1XA 3U23A 9ATCB 3CCUT 1YJNA 4ATOA 2COYA 1I0CA 2HKNA 4HVWA 3LGLA 3V8KA 4PJOA 2EGEA 2JMAA 2FO0A 1RUWA 1HSQA 2K4YA 2EQMA 3VKIA 1QP2A 2DL7A 1QKWA 2KYMA 1TWBA 1C0MA 1SHGA 1Y07A 2KSSA 3INZA 2MK5A 4C0DC 1G83A 1Y71A 1V29B 4BE1A 4XTXA 5FWCA 2QYZA 5IHNA 2GQVA 1K0SA 2FHDA 3LGFA 4C0GA 3FIFA 5LJ3g 1QVFP 4N4HA 3CPWS 2CH4W 2OAUA 5IHKA 2RQWA 3VRYA 2OTJA 1AZEA 3VS2A 4AFSC 3CCUQ 4QVCA 1ZBXA 2I0NA 2YLBA 1ZHIA 4C92G 4RTVA 2PVOB 2QAZA 4J9CA 5I11A 4FYXB 2YUNA 2PZ1A 1ABQA 2VYTA 4GLKA 3PMTA 4HVUA 1Q86U 2GBQA 5LJ3d 2R58A 2MF2A 4IUPA 4HCBA 3KXTA 3AT1B 3TSZA 1ZSZA 2W10A 4PNOA 1GXIE 3IQLA 2P0KA 5IHIA 1BCMA 4Z88A 5LJ3e 1CKBA 3REAB 1ARKA 3TCJA 4J8OA 4C92D 3DLLA 4IIMA 1R77A 1TG0A 2JW4A 2QQAA 2EWNA 4EPCA 4PFPA 3L2RA 2LC4A 2X4WA 1NYGA 1RAAB 1VQ8T 3HKSA 1WHMA 2V8IA 4AMCA 2RQTA 2CUDA 1M2OA 3QHSA 2GFUA 2VXFA 1UDLA 4J9HA 4DOWA 4FT2A 1M3BA 4B9WA 1C1AA 3UATA 1IHVA 2AKKA 3HP9A 3M0TA 5GAN2 3CBOA 4HT8A 1NLPC 4FT4A 1W1FA 4AFZC 1KQSP 2LNVA 2O88A 3A1PA 4LDWA 1RLPC 3P8DA 1NBEB 4OMQA 4QKUA 3M0QA 1I81A 4OB0B 2DEUA 3UA7A 1BU1A 3EGDA 2DO3A 2F5KA 1YIJA 3PVLA 3PNWC 3G6EA 5LJ3f 3M53A 1K73R 3M4YA 4JJBA 2DTIA 2E64A 2FRYA 4HKEA 3FC3A 1UECA 1RADB 1QWFA 2DEQA 4OMPA 2AKLA 4EDUA 4C0FA 2HL3A 4C92C 2P0PA 3RR6A 4XU3A 1U8RA 5D7UA 3NTIA 2EW3A 3JCMV 3RUXA 3OYDA 3I55Q 3E9FA 1Q95G 3CCEA 3FLGA 1YWOA 2EGAA 3SWNB 4JJDA 2DL5A 2CT4A 5GMKi 4JRKA 2HL5C 2HQXA 3KFVA 2SRCA 1K9MR 1YITT 2DD4A 3JB9G 1JJ2S 4C8QG 1D3BA 4O6JA 2KQWA 1WQ7A 4A63B 4JRQA 1IRXA 3DB3A 4M77E 3V8LA 1VQOT 2LX9A 1JXMA 2ESWA 3NMZC 3ULRB 4EMKA 1ZUUA 2KY9A 2A3LA 4IUUA 2L5QA 4F16A 4X34A 4C0ZA 2K2VA 2XDDA 3X25B 2LVMA 2FPEA 3JCMh 2QTVA 2CKKA 3JB9D 4RTTA 4OMLA 2DZ9A 3VS0A 1B3QA 3A8OB 3KBGA 1KD1U 3E9GA 4DEYA 2JUFA 2J6FA 1G3TA 2KRNA 1EZZB 1YITQ 1IHWA 5D6WA 5M9OA 3SHWA 1SKUB 5GAN4 2RHUA 1KQ1A 3G7ZA 4BE2A 1MMDA 4N0AC 4KGXB 1VQOQ 1PKTA 1X6BA 1OPLA 2WSCE 2JNGA 2YSQA 3SDZA 4MZTA 3I56T 3VYGA 1Y96A 3UF4A 3CC4T 3CCUA 4RTXA 5CVIA 3CC7T 4IURA 1PSEA 1K8AC 4F7UG 8ATCB 2K6DA 2WSFE 3QDFA 2FPFA 4OMMA 2QEXT 3NTKA 1BK2A 1FXXA 1LCKA 2NWMA 1VQ4Q 1UB4A 2DA9A 2LCLA 1ZQ1A 2ED0A 1RAIB 3EH2A 4NOYA 4PFOA 1B34A 2DERA 1TSFA 2C0OA 2CP6A 1PRLC 3V7CA 2J05A 4OVAA 5EC7A 2MCNA 5FLXE 4M75G 3M59A 3DLMA 2C06A 3J81E 1Z9QA 3HSBA 2VB6A 1S1NA 3I56Q 3L2ZA 1GBRA 4DBHA 2CP5A 3CC4Q 3CC7Q 4Z8AA 2JM9A 1JB0E 3THKA 3OW2P 2KBTA 2LP5A 1UGVA 2QEXQ 2RQRA 2FZCB 4QVZA 2MPXC 3E2UA 4ELZC 5L23A 5AT1B 3H9NA 5GAOn 3PTAA 2QASA 4A4GA 2NLUA 2YUOA 5FWBA 3OSVA 3CBPA 5KYXA 3G4ST 1U1SA 1OX8A 2CUBA 2KRSA 4M77B 3QIIA 4PJOG 3OW2A 1N9RA 5CAIA 2DIQA 3QSUA 3JSCA 4HXJA 1JQQA 3FJ5A 4FW2A 1NPRA 1WJRA 4RG2A 5KYYA 2NUPB 1OPKA 3JCMc 2C0IA 3MEAA 2O9SA 1T3LA 1Q82U 4QQGA 1K8AU 5GAN5 4PJOD 4BY6B 3I55A 3SEMA 3S3OA 1W4SA 2GCXA 4KUDK 1U1TA 3RMQA 1GCQC 3Q1JA 1KC8C 4QW2A 3LLRA 3OYKA 5A0DA 2EQIA 4M7AD 2W0ZA 1I5LA 4M75C 3AHUA 2X9HA 3OS1A 8AT1B 4JDSA 4ZTFA 5CCAA 1M1KU 3DB4A 1KJWA 2CZ0B 2LQKA 3ZL7C 1SHFA 5FRNA 2ENMA 1M90C 1PCXA 2KNBB 3L1AA 3EFSA 2RI5A 2L3RA 4GLMA 2BE7D 2BZXA 1OX9A 2VGMA 1M5Q1 2VVKA 3CPWA 2VV5A 4IIOA 2E5QA 3RKWA 1OULA 1Q7YU 2DRMA 5KE2A 3DKMA 4L59A 2E65A 2BZYA 2FL7A 4ANJA 5HY6A 1KSWA 2O2OA 1Q81C 4PJOC 1QVGS 2RQVA 4F04B 3EFOB 1VQPA 3CXCP 3CMAT 1I8FA 1D0YA 4XTVA 4YTLA 1QW1A 2MOXA 2EFIA 1WQWA 1OU9A 3TVTA 2HAXA 3QJYA 4OF1A 3JCMg 3M55A 2Y4XA 1OZ3A 2CP3A 1OYXA 4E7KA 4M7AF 2X4XA 2DX1A 1WHHA 3RBBB 2ROTA 4BDYA 3CXCA 1XQHA 2JT4A 1VQ4A 5KH6A 1QVPA 4FCYA 4D6WA 1M2VA 2KMTA 1YJWT 4XQ3A 2NUZA 1BI1A 2QA4T 4IUTA 2GFAA 3M0SA 5HCKA 3H0HA 3A8GB 4M7DD 3JCMd 2VWFA 3FJPA 1KC8U 1B07A 2LJ0A 5IT9E 4FW1A 2OTLT 3MJXA 2A0FB 3CMAQ 2RJDA 3PE0A 4M78D 3E1SA 1WLPB 3JCMe 2HBWA 1ZSZC 3TREA 5CIUA 3VS6A 3CC4A 1N8RR 4N4IA 1UHCA 3CCQA 5HK3A 4O5VA 1H8KA 1MMNA 2R5AA 3C95A 5L8RE 1TUGB 1QCFA 3EH1A 5KCOA 3HRTA 1M90U 4FYYB 3OYYA 1R8OB 4J7IA 1FMVA 1G3YA 1YJWQ 1MGQA 2QA4Q 3R6OA 1VQ6A 2ABLA 1KHIA 2J6KA 4LXCA 2H3JA 4LN2A 2VASA 5CR2A 2OTLQ 1WNLA 1Q81U 1NZ9A 2K5IA 3VUZA 3CCLA 1X2KA 1X2QA 2RHXA 4LD9K 3BFMA 2HZYA 4KGVB 4M7DC 4OMOA 4AT1B 1JJ2A 3JCMf 4KGZB 5I2MA 4M7DF 3OYGA 3H8ZA 2XDBA 1VQKT 2RHZA 1WI7A 4M78F 4XTZA 3MO8A 4KH1B 3UA6A 3OSSC 3EGXA 2ZPFB 2DXTA 1VQNQ 5KYWB 1MV0B 4M4ZA 1K9MC 3BY7A 2LQ8A 1G8XA 2E5KA 2GTJA 2ZPIB 3JCMJ 1YHQT 4V2SA 1EIFA 3META 5I21A 3CCJT 4DQ2A 5GAMh 1ABOA 5EG2A 1W2BS 2F2XA 3JRZA 2K7AA 4PL6A 5GAOr 1LOJA 4M7AA 2HMAA 1UE9A 2DE0X 2ZPEB 1VQMA 2V8JA 1VQKQ 1HXDA 2MWOA 1OQKA 5FROA 1UEBA 3C0CA 4EMKC 4C92E 2IVWA 1UGPB 4EMGA 3I5SA 1YI2T 1OZ2A 3NTHA 1A0NB 4JRPA 5GMKh 3JB9I 3FB9A 3EHQA 3JAME 2E6NA 2PU9B 4C0DB 1VQ7A 3HTRA 5CKEA 4KUIA 4R56A 2CREA 4C5GA 2CDTA 3QDRB 1SRMA 3OYFA 2AZVA 1YHQQ 2KI7A 2BKDN 2A08A 2RD1A 4FL6A 2DLPA 2KE9A 4BI4A 4PKCC 3QG1A 1M8MA 2F5TX 1G3SA 1LNXA 1SG5A 4OB2B 1HK9A 3UWNA 1WZOA 5ECAA 3OBYA 2FEIA 1NG2A 1WA7A 5GAOq 5D6XA 4PLIA 4RKUE 2DL4A 3LWHA 4BUGA 2KT1A 2DILA 1TUCA 2L3SA 1AWJA 2FVUA 2O4XB 3KUFA 2QGFB 3QWXX 2D8JA 1PD1A 2DTOA 2RHIA 5J3BA 4AG1C 1CKAA 2EQKA 1W6XA 2GQIA 2ZZDA 2LMJA 5GANh 2RMOA 2RN8A 1G2BA 2VKNA 4M7DA 5AYFA 4ESRA 3GNFB 2HDAA 2M1HA 3EG9A 4M78A 3CCSA 4ZGDB 3CCMT 3CCVT 3M57A 1PG5B 1VQ8Q 3H6ZA 1RL2A 2DAQA 2KAFA 1Q86R 5A2QE 5GAN3 4Y92A 2FG0A 4XU2A 7AT1B 4JZ4A 3V8JA 1KFZA 1EX4A 2DBKA 1YFNA 3SWNC 2F2WA 3NGPA 2OTLA 4FYWB 5IXFA 5IH2A 3X28B 4ZTJA 2DZCA 2DXUA 3L2VA 2HQEA 4J5YA 2L8DA 4C8QE 3EG3A 2E3IA 1KG1A 2LJ3A 5GAMj 1VUBA 2XK0A 4FSSA 3OBWA 2RA2A 4IUVA 3CCMQ 4C92B 2YXYA 3GF5A 3L42A 3LWIA 3BDUA 1WPYA 1N27A 2LCCA 1CSKA 1JXOA 1T0JA 1IO6A 2CZ7B 2E6ZA 1Y0MA 2QQRA 2H8HA 3EFRA 5GMKm 2EJ9A 3OYBA 1VQNA 1YJ9T 5KYNA 4Y28E 3CD6T 5GMKj 2P4RA 2RF0A 1FYNA 4EMHA 2K5LA 3HFNA 1HD3A 3PFSA 2D6FA 3MKDA 1TS9A 4DEXA 3MP8A 2CH4A 5FU7C 2D9TA 2F2VA 3PGGA 2A7YA 4HT9A 3OMCA 3C12A 1BIAA 2O01E 3M54A 2DNUA 3CMET 2E1HA 1VQKA 2FZGB 1AD5A 2JXBA 4ME7A 2ED1A 2KT8A 2EYQA 2M0YA 2M0OA 2QQ9A 1W70A 2QQBA 4M77D 1M1GA 4F7UE 4JS5A 1NYFA 1H3HA 2KGTA 4HCCA 3CD6Q 3I35A 4J9EA 4CRIA 1AVZC 2GTOA 3A8HB 5KYUB 5DM7R 2YRCA 1VOMA 2RI2A 3RKXA 1ZSGA 3GIBA 5GAMg 2YRVA 2EVRA 1YCSB 1JO8A 2COWA 1BIBA 5GANj 4M75E 2FB7A 4BI3A 3PMIA 1RLQC 3CMEQ 4A53A 3OB9A 2IIMA 2LZ6B 1QVFS 1AEYA 4XAXB 1P92A 5KE3A 5GAMd 3M0PA 1KD1R 4CI0C 2X3XD 2XDPA 1AT1B 1RAGB 1RI9A 2RB6A 2CGHA 1PSFA 1EFNA 1D0ZA 1XNIA 5GAMe 2QK0A 4J6YA 4B6MA 3SWNA 4J9IA 2Y90A 2P4TA 2PNIA 1H641 1T0HA 4C8QB 2G3RA 2YT6A 3TU4K 1ACMB 4M77C 2X4JA 3CC2T 2LT4A 4M77F 2A28A 3JV3A 4RCBA 4PJOE 4BE0A 4J9DA 3VS7A 3OYMA 2MMPA 1K0XA 2MAMA 3CQTA 4CC4B 4C5HA 3G71T 1NJIC 3FRNA 5GMKe 2JTFA 1WIEA 3I5RA 1ZBJA 2KROA 2CZ1B 2NUTB 1VQ8A 3ME9A 1UHFA 5D6YA 2DPPB 4B9XA 2FZKB 2X35A 2LT1A 1YJNT 4D8KA 2JMCA 2IG0A 2RH2A 4MZMA 2LCSA 4BY6C 4M7AG 4WCIA 3H0IA 4FU6A 2MYSA 4HA8A 4XK8E 4RG8A 3SD4A 1SF9A 1IREB 3ASKA 4C5EA 2K3XA 3HHTB 5GAMf 3CC2Q 4NS5A 1BB9A 1KQSS 5GANg 2BZ8A 2OX7A 2KVQG 3G4SQ 1M9SA 5LJ5d 2V1RA 4DA4A 3WVEB 3G71Q 2ATCB 2ZGWA 3CCMA 4ORZA 1BKBA 4F7UB 4E7JA 3CPWP 2JTEA 4LDUA 2OTJT 4X1VA 2E41A 1TOVA 1SSFA 5GANd 4J9GA 1FMKA 3QZ5B 1W2BA 4NL2A 2A36A 5FRMA 5GANe 3FDRA 4LDXA 3QYHB 3P8BB 1X27A 2K57A 3J80E 2F1LA 3MEUA 3ZBDA 3HL8A 5DY9A 2KRMA 1AZGB 4M75B 3F70A 3C94A 4Z89A 1IB8A 2RM4A 3M5AA 6AT1B 1RI0A 2RQUA 1YITA 5C6SA 1I5OB 4XTYA 2E4HA 4PLLA 2RK1A 3LYIA 4Q5WA 4ZN3A 4CC2A 5A0LA 1OU8A 1NJIU 1IGQA 1NEBA 1VQOA 5CQXA 2OI3A 1Q82R 2OTJQ 1QKXA 2YWWA 1K8AR 2RI3A 3O8VA 2X51A 3S6WA 1KQ2A 2ZAEA 4RTWA 1AWOA 1U3OA 4M7DG 5LJ5f 4PJNA 4M7AC 3CD6A 1YN8A 2DJQA 4M78G 2WACA 2HQHA 3UT1A 4XU0A 3RERA 2Z0WA 4PJOB 3JB9H 2RJFA 3CCRT 2EYXA 4M77A 2LJ1A 1E7OA 5GANf 5GJWB 1QCOA 1KK7A 3HFOA 3CEYA 1M1KR 4ELYC 2GF7A 1YIJT 5FU6C 1BYMA 2L2PA 3S3MA 2LDMA 3G6ET 2D0NA 3CMEA 2HD0A 4KBMB 2NUPA 2KDSA 4NL3A 2LRQA 1E6HA 1YNZA 2HKQB 3I56A 3GOXA 3FEOA 3OYAA 4A4HA 2HCKA 3NFCA 1WXBA 2YUPA 4OGCA 1ZA2B 3CC7A 3OYCA 2CP2A 2O9VA 5GAOm 1R0BG 1Q7YR 3R6NA 1PD0A 4XTWA 2LQNA 2QEXA 2QG9B 4RCCA 2YLCA 4VUBA 3CCET 4LD6A 1SEMA 2DIGA 1WJQA 3CCRQ 1ZLMA 4J6WA 1N9SA 3SFMA 4RTUA 3VJPA 1JBMA 4ZGJB 1WX6A 1ZSZB 1JJ2P 2XHCA 1YIJQ 1G5VA 2JZ2A 2QDYB 3G6EQ 2PUKB 4LNPA 1YCYA 3A8MB 4KH0B 4A4FA 4E7LA 3D7SB 3SB2A 1VA7A 3P8HA 1MV3A 3OYHA 4IKFA 1QQJA 2AIRB 2L0AA 2Y4YA 1K73C 2DYBA 3OQ5A 1TTHB 2RPNA 4HCKA 2J6OA 4CC3A 2DL8A 1UUEA 1Q86C 4L5GA 3OW2S 2MI6A 1X01A 3QZ9B 2DRKA 1YWPA 4HVVA 4M78C 4OB1B 3TQ7P 3CCEQ 2VGNA 4LDYA 1X6GA 3PIPA 4TVRA 1KC8R 2AT1B 5IN1A 2I2LA 2P84A 3QUIA 4JZ3A 2EYWA 1C6VX 1WHLA 3JCMX 2COZA 3EFOA 3G4SA 3PIOA 3EG0A 5CKDA 1OOTA 3CBMA 1OV3A 5CKHA 2OAWA 3EGDB 3EG1A 3RIRA 2NYSA 2F69A 4DBRA 4ZGEB 2RHYA 1B7TA 2ZPBB 4J7FA 1M90R 1WJSA 2QTXA 4DOVA 2RJCA 1IZ6A 4L6V5 4JUVA 2KR3A 1WHGA 1XTDA 1UJYA 2L89A 3WVDB 4BI8B 1GBQA 1MHNA 1LVKA 3RESA 3OS2A 3MHXA 3VS1A 3JCMP 4FYVB 5CO7A 2QXFA 4E7ZA 1Q81R 3N5BB 2L3QA 4JLIA 2EQJA 5CKFA 3MP1A 2ROLA 5HKCA 1KIKA 1D3BB 4AFUC 1JU5C 2HSEB 1H92A 2VXEA 2AK5A 1RACB 1GFCA 1O75A 3CCJQ 2EPDA 1PNJA 3ER0A 2V1QA 3H0FA 1K73U 1VYUA 4EMKB 3OYEA 2K3BA 2EAYA 3V7SA 1UFFA 1S72T 3O5ZA 1BBZA 1QLYA 3NPFA 3ZFJA 4J6XA 1QVFA 2DK3A 4LDVA 1K1ZA 2EJGA 3REBB 2BTTA 1YI2Q 1VQ9T 3VRZA 4LUDA 5LJ5h 5C0MA 2XKOC 4BB7A 2QQSA 3VYHB 5CKBA 3CMAA 1K9MU 3CXCS 2AZSA 5GAOp 1MMAA 3EAEA 1GFDA 2OJ2A 5J26A 2EJFA 2DD5A 2EYYA 2DXBA 3VV0A 1AWWA 4UC4A 1WFWA 1K4US 2K79A 2PTKA 2RJEA 1Y96B 1S72Q 1KD1C 5DLOA 1GL5A 2M51A 2K9GA 3I55T 4QT7A 3BDLA 2PVGB 3CCRA 3GNGA 5KYWA 3QPHA 1VQ9Q 2ZPHB 4LUEA 1YJWA 1ZX6A 2QA4A 1WXUA 1K76A 1B34B 3LX7A 3RKYA 1RABB 4IUQA 3QXEB 2EIFA 4EIKA 2DJZA 4J9BA 4HCZA 2FYKA 3G1JA 1KQSA 3MPUB 2ZPGB 2CP0A 2KXCA 3I9QA 2R5MA 1FX7A 1RAEB 1PKSA 2AHJB 1NLOC 3M0UA 2YDLA 4C92F 3MEVA 1E6GA 1M27C 1WYXA 1N5ZA 3TSWA 4ZN1A 1VQLT 3CCVQ 2KEAA 1UJ0A 2CT3A 3QO3A 4E2FB 4GY5A 4F17A 1F1BB 4PK4A 4JRIA 5DLQE 2H3EB 2EKOA 3CPFA 2XI9A 1QVGP 3GPLA 1AHJB 1SSHA 5KYXB 1VQPT 3X26B 5HK0A 2R57A 2DVEA 4PJLA 5CK9A 3L2WA 4FM4B 4M77G 4K11A 3EHRA 2M16A 5A0GA 1SRLA 1RAFB 3M56A 2E3HA 2E70A 5KYYB 3VS5A 1OEBA 1UGRB 1VQLQ 1QVGA 2QGGA 4C8QD 1BI2A 1MUZA
chains in the Genus database with same CATH topology
2KVQG 2JN0A 5KCOA 1H3ZA 3HRTA 1M90U 2PVDB 1M9SA 3OYYA 4J8OA 3TCJA 5LJ5d 1VQ4T 1R8OB 4J7IA 4C92D 1G3YA 3WVEB 4DA4A 3DLLA 2BIVA 4XU1A 2O4XA 4EPCA 2QQAA 2EWNA 1MGQA 2ZGWA 4C5IA 3L2RA 3CCMA 3R6OA 1VQ6A 2LC4A 1BKBA 4X9DA 4F7UB 4E7JA 2X4WA 2ZCFB 3OS5A 5FU7B 3S3NA 4M7AC 1VQ8T 3HKSA 1KHIA 2RK2A 4LDUA 2V8IA 2H3JA 4QQDA 2OTJT 2E41A 1VIFA 3M58A 5CR2A 1SSFA 5GANd 1WNLA 4MMKA 3QHSA 5LJ5j 3QZ5B 2GFUA 2VXFA 4DOWA 1W2BA 4NL2A 1Q81U 1NZ9A 2K5IA 4FT2A 5FRMA 2E10A 4B9WA 3VUZA 1YHQA 3CCLA 5GANe 3FDRA 3CCJA 2BUDA 2XICA 4LDXA 2RHXA 3HP9A 4LD9K 4MDXA 5KCHA 5GAN2 3QYHB 3P8BB 3BFMA 2K57A 3CBOA 5GMKl 4HT8A 3J80E 1Q82C 2CYZB 4E7HA 4M7DC 3MEUA 3ZBDA 3CCQT 3HL8A 5DY9A 1NPPA 3OS0A 3JCMf 1JJ2A 3MP6A 4FT4A 5I2MA 4M7DF 4M75B 3A5ZB 2LNVA 3F70A 4LDWA 3OYGA 3H8ZA 2XDBA 3C94A 3P8DA 2RM4A 3M5AA 1I81A 4OB0B 1VQKT 2RHZA 1RI0A 4M78F 4XTZA 4R55A 2DO3A 3MO8A 5C6SA 1YITA 1XOVA 2F5KA 3QKJA 4XTYA 1YIJA 1VQ5T 4PLLA 4P5NA 2RK1A 3OSSC 3PNWC 3LYIA 3G6EA 2ZPFB 2DXTA 4Q5WA 4ZN3A 5LJ3f 3M53A 1VQ6T 3M4YA 3M9QA 1YI2A 5A0LA 1NJIU 4FSXA 1VQOA 5CQXA 2DTIA 2E64A 4A4KA 4C8QC 4HKEA 3FC3A 1K9MC 3BY7A 2YHTA 2RI3A 3JB9F 3O8VA 2LQ8A 3S6WA 4C8QF 1KQ2A 2DEQA 1M1KC 4M7DG 4Z02A 2HNIA 5LJ5f 4EDUA 4C0FA 4C92C 2P0PA 2ZPIB 3JCMJ 1YHQT 4V2SA 1EIFA 4XU3A 3CCLT 3META 5I21A 3CCJT 4DQ2A 1U8RA 4KULA 5GAMh 4E7IA 3CD6A 3NTIA 4M78G 4BDZA 2WACA 3JCMV 3RUXA 5EG2A 3OYDA 3E9FA 3UT1A 4XU0A 1QP3A 3MCAB 3CCEA 1W2BS 3FLGA 3RERA 4C92A 4PL6A 3JRZA 2RJFA 3SWNB 3JB9H 4PJOB 5IAYA 1LOJA 5GAOr 5I2SA 2LTOA 2EQUA 4JRKA 5GMKi 3CCRT 1Y7XA 4JJNK 2D0QB 3GP8A 4M7AA 4M77A 2ZPEB 5GANf 1S72A 1N8RC 2HQXA 1VQMA 2V8JA 4JLGA 1HXDA 2MWOA 2E12A 4M75D 3HFOA 1Q7YC 1UGSB 1YITT 3CEYA 3ZEHA 2DD4A 2XIDA 4ELYC 3JB9G 1JJ2S 2GF7A 5FROA 4C8QG 1D3BA 4O6JA 1UEBA 3GLXA 4OB3B 5FU6C 1YIJT 2PUOB 4X9CA 3S3MA 1BYMA 2LDMA 4XTUA 4EMKC 3G6ET 2KQWA 2IVWA 4C92E 1WQ7A 1UGPB 4JS4A 4EMGA 1TH7A 1VQ9A 3L2UA 3CMEA 4M7AE 4JRQA 1YI2T 1OZ2A 3NTHA 2HD0A 3DB3A 4JRPA 4M77E 5GMKh 3JB9I 3V8LA 1VQOT 2LX9A 4KBMB 2KDSA 4NL3A 2LRQA 3A8LB 3FB9A 5LJ5g 3JAME 2E6NA 1LJOA 2PU9B 4C0DB 2KY9A 2A3LA 3FEOA 5CKEA 4EMKA 3I56A 3OYAA 4IUUA 4A4HA 4KUIA 3QYGB 2L5QA 3L2QA 4X34A 3NFCA 4C5GA 4R56A 3QDRB 4OGCA 4C0ZA 4A4EA 3CC7A 2HBPA 2V8KA 2K2VA 2XDDA 3X25B 3OYCA 3OYFA 2BKDN 5GAOm 2LVMA 3JCMh 2RD1A 4FL6A 2CKKA 4XTWA 3HRSA 4MDWA 4BI4A 3JB9D 2QEXA 2K5FA 4PKCC 2B8AA 2QI2A 4RCCA 2DZ9A 2YLCA 3MEWA 3QG1A 4VUBA 3CCET 3A8OB 3KBGA 4LD6A 2DIGA 2CS7A 1WJQA 2F5TX 3E9GA 1KD1U 1VQ7A 4J6WA 1G3SA 2JUFA 1LNXA 1N9SA 3SFMA 4OB2B 1HK9A 4F7UF 3UWNA 1VQMT 3QBYA 1G3TA 3VJPA 1UGQB 1JBMA 4ZGJB 5LJ3h 3CCVA 5LJ5e 5D6WA 5M9OA 2XHCA 5GAN6 1G5VA 3OBYA 5GAN4 2JZ2A 2QDYB 2RHUA 2PUKB 1YCYA 3A8MB 1KQ1A 3G7ZA 5GAOq 4BE2A 2JVVA 5D6XA 4A4FA 4N0AC 4PLIA 4RKUE 2DXCA 4MZPA 4E7LA 3LWHA 3JB9J 3SB2A 4BUGA 3P8HA 2WSCE 2JNGA 1M1FA 3HRUA 3SDZA 3OYHA 2O4XB 2FVUA 3KUFA 4MZTA 3I56T 4QQ6A 3QJ6A 1VQ7T 3VYGA 4IKFA 2Y4YA 4II1A 4N0AA 1BI3A 1K73C 3OQ5A 2X4YA 1Y96A 3CC4T 3CCUA 3CC7T 5CVIA 2DTOA 2RHIA 5J3BA 4IURA 1PSEA 4M75F 1K8AC 2EQKA 4F7UG 2RO0A 1Q86C 2WSFE 4L5GA 2ZZDA 3OW2S 2MI6A 1X01A 2XD0A 2QEXT 4KT0E 3QZ9B 5GANh 3NTKA 4M78C 4OB1B 2VGNA 4LDYA 4BD3A 1FXXA 4J83A 4M7DA 1UB4A 5AYFA 3PIPA 4TVRA 1JRIA 2LCLA 1ZQ1A 1X6OA 3GNFB 2M1HA 5IN1A 2I2LA 3QUIA 4NOYA 4M78A 1B34A 3CCSA 1VQLA 4ZGDB 3CCMT 3JCMX 3CCVT 3M57A 3G4SA 1N8RU 3V7CA 2JTMA 3H6ZA 1RL2A 3PIOA 4OVAA 5CKDA 3LW5E 2DAQA 3VUBA 5LL6S 5CQYA 1YBYA 3CBMA 2KAFA 4OP0A 4M7DE 3OYIA 5FLXE 5CKHA 4M75G 5A2QE 3M59A 2DTHA 5GAN3 3DLMA 2C06A 3J81E 3HSBA 3RIRA 4OMFB 4XU2A 1YJ9A 2F69A 3V8JA 4M78E 4ZGEB 1BI0A 4C8QA 3WXMB 3OYJA 2RHYA 3L2ZA 3SWNC 2ZPBB 3PT9A 4J7FA 4PJOF 2OTLA 1WJSA 2QTXA 4DOVA 2RJCA 1IZ6A 1JB0E 4L6V5 4Y91A 1NE8A 4JUVA 3X28B 4RMOA 1M8VA 4N4GA 2DZCA 3JCMQ 4ZTJA 1XTDA 2DXUA 1FWZA 2L89A 2HQEA 4OGEA 3WVDB 4J5YA 3L2VA 4BI8B 4WF2A 2L8DA 3C4SA 4QVZA 4C8QE 4ELZC 1KG1A 5GAMj 1MHNA 1VUBA 2XK0A 3RESA 3OS2A 3MHXA 5GAOn 3OBWA 3T9NA 2XG8D 3PTAA 2JOYA 2RA2A 3URGA 4IUVA 4A4GA 3JCMP 3CCST 5CO7A 2NLUA 2QXFA 4C92B 3GF5A 3L42A 3LWIA 3BDUA 3RMSA 5J39A 1WPYA 1N27A 2LCCA 3OSVA 3N5BB 4M7AB 3CBPA 1OI1A 3G4ST 1U1SA 4JLIA 4M77B 2CZ7B 2EQJA 5GAN8 2E6ZA 5CKFA 3V7RA 3MP1A 3QIIA 4PJOG 1O9SA 3M4GA 3OW2A 1N9RA 3JCMW 2QQRA 5CAIA 5HKCA 3EFRA 5GMKm 3JCMb 2EJ9A 3OYBA 1VQNA 1D3BB 1YJ9T 2DIQA 3QSUA 3JSCA 2VXEA 1NPRA 1WGSA 1WJRA 4RG2A 1O75A 4Y28E 3ER0A 3CD6T 5GMKj 4FIBA 3UPUA 4EMHA 2K5LA 3OYLA 5FU6B 2WSEE 3HFNA 3PFSA 1K73U 2D6FA 4EMKB 3JCMc 5GAN7 3X20B 3OYEA 3MEAA 3VU3C 3MP8A 1Q82U 2EAYA 3V7SA 4QQGA 5FU7C 1S72T 5GAN5 1K8AU 4A54A 4PJOD 2D9TA 3BW1A 2CZ6B 3PGGA 4BY6B 3OYNA 3I55A 3J7AF 3ZFJA 3S3OA 1X75C 1W4SA 2GCXA 4J6XA 4KUDK 1U1TA 2DK3A 4LDVA 2EJGA 3RMQA 1QVFA 2A7YA 4F7UA 4HT9A 3OMCA 3C12A 3TEEA 1BIAA 2O01E 3M54A 3Q1JA 1VQ9T 3CMET 2E1HA 3LH0A 1VQKA 1KHCA 1KC8C 4QW2A 4ME7A 3LLRA 5C0MA 5LJ5h 3OYKA 2XKOC 1VQ5A 5A0DA 2EYQA 4BB7A 5LJ3j 3OA6A 4M7AD 2QQSA 1VIEA 2M0OA 3VYHB 2QQ9A 2QQBA 2XU8A 1I5LA 4M77D 1M1GA 3E19A 4F7UE 5CKBA 4M75C 3AHUA 1VQNT 4JS5A 3OS1A 3OY9A 3CMAA 3CXCS 1K9MU 5GAOp 3EAEA 4JDSA 4ZTFA 5CCAA 5J26A 1M1KU 2EJFA 4MMLA 4HCCA 1DJ7B 4CRIA 3DB4A 2CZ0B 3A8HB 4M75A 1I4K1 2DD5A 2LQKA 3UDCA 5DM7R 2K3YA 2PQWA 2DXBA 2RI2A 3VV0A 1N6AA 3RKXA 4UC4A 1M4ZA 3X24B 2RJEA 1Y96B 5FRNA 3GIBA 5GAMg 3OMGA 2KK4A 2VC8A 2YRVA 2M9UA 1KD1C 3L1AA 1M90C 3EFSA 5DLOA 2RI5A 3CC2A 2L3RA 3I55T 3HPWA 1BIBA 2VGMA 1M5Q1 4QVDA 3BDLA 3CPWA 2VV5A 5GAOl 2PVGB 3CCRA 3GNGA 4M75E 5GANj 2E5QA 2FB7A 4BI3A 3QPHA 3PMIA 3RKWA 1Q7YU 3G71A 4M7DB 1G3WA 2ZPHB 5KE2A 3DKMA 4L59A 1YJWA 2E65A 4A53A 2QA4A 2FL7A 3OB9A 2P0QA 2MWPA 1QVFS 5HY6A 4XAXB 4M78B 1B34B 1P92A 4E47A 5KE3A 3LX7A 5GAMd 1Q81C 4PJOC 3RKYA 1QVGS 2VUBA 2DKGA 4IUQA 4BACA 1VQPA 1YJNA 3QXEB 3CCUT 2EIFA 4CI0C 3CMAT 4ATOA 2XDPA 1I8FA 2DJZA 2RB6A 2CGHA 1PSFA 4XTVA 1XNIA 1QW1A 3LGLA 4HCZA 2FYKA 4J6YA 4YTLA 3SWNA 3V8KA 5GAMe 4PJOA 2Y90A 2EFIA 2P4TA 1KQSA 1H641 2ZPGB 1WQWA 2R5MA 1FX7A 2K4YA 2EQMA 2AHJB 4C8QB 2HAXA 3VKIA 1QP2A 3QJYA 2G3RA 4OF1A 3TU4K 3JCMg 3M55A 4C92F 3MEVA 2Y4XA 4M77C 1Y07A 1OZ3A 2X4JA 1OYXA 4E7KA 4ZN1A 2X4XA 2KSSA 1VQLT 3CC2T 2LT4A 4M7AF 4M77F 3INZA 4C0DC 4RCBA 1Y71A 4BDYA 4PJOE 4BE0A 1V29B 3CXCA 4XTXA 3OYMA 2MMPA 4BE1A 1XQHA 2MAMA 1VQ4A 3QO3A 1QVPA 5KH6A 4C5HA 4GY5A 4D6WA 2GQVA 4JRIA 3G71T 1NJIC 2KMTA 5DLQE 1YJWT 3FRNA 5GMKe 2FHDA 4XQ3A 2JTFA 1BI1A 3LGFA 3FIFA 4C0GA 5LJ3g 2QA4T 2EKOA 4IUTA 2GFAA 2CZ1B 4N4HA 3CPFA 3CPWS 3A8GB 2XI9A 1VQ8A 4M7DD 3JCMd 3ME9A 3FJPA 3GPLA 1AHJB 2OAUA 1KC8U 2OTJA 5IT9E 5D6YA 2DPPB 4B9XA 2X35A 1VQPT 2LT1A 4QVCA 1YJNT 2OTLT 3X26B 5HK0A 1ZBXA 2IG0A 2RJDA 1ZHIA 2YLBA 4M78D 4C92G 3E1SA 2R57A 3JCMe 2RH2A 4MZMA 4M7AG 4BY6C 2DVEA 2PVOB 5CK9A 3L2WA 4FM4B 4M77G 2M16A 5A0GA 3TREA 5CIUA 4FU6A 2VYTA 4GLKA 4XK8E 3PMTA 4HA8A 4RG8A 3M56A 1Q86U 3CC4A 3SD4A 5LJ3d 2R58A 1IREB 4N4IA 2MF2A 3GOXA 3ASKA 3CCQA 2E70A 5HK3A 4O5VA 4C5EA 2K3XA 4IUPA 3HHTB 4HCBA 3KXTA 5GAMf 1UGRB 2R5AA 3C95A 4PNOA 1QVGA 4NS5A 4C8QD 2P0KA 1KQSS 1BI2A 1GXIE 5GANg 5L8RE 5LJ3e
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PQW A;  3OYJ A;  2RI2 A;  2RHY A;  5KCO A;  1H3Z A;  4UC4 A;  3L2U A;  1OZ2 A;  2RJE A;  3NTH A;  3DB3 A;  5FRN A;  3OMG A;  2YRV A;  1WJS A;  2RJC A;  2BIV A;  2LRQ A;  2RI5 A;  2L3R A;  2O4X A;  2E6N A;  3GOX A;  3FEO A;  4C5I A;  3L2R A;  3OYA A;  4IUU A;  4A4H A;  3BDL A;  4N4G A;  4E7J A;  4ZTJ A;  3L2Q A;  4X34 A;  2L89 A;  2X4W A;  4C5G A;  3L2V A;  2HQE A;  2E5Q A;  3S3N A;  4A4E A;  2L8D A;  3C4S A;  4QVZ A;  3PMI A;  3OYC A;  3OYF A;  2BKD N;  4QQD A;  5KE2 A;  2LVM A;  4L59 A;  1MHN A;  2XK0 A;  1SSF A;  4FL6 A;  3OS2 A;  2CKK A;  3OB9 A;  2GFU A;  2MWP A;  2B8A A;  4IUV A;  4A4G A;  3MEW A;  2NLU A;  5KE3 A;  3L42 A;  3LX7 A;  4LD6 A;  5J39 A;  4B9W A;  2DIG A;  2LCC A;  1N27 A;  1WJQ A;  3E9G A;  5FRM A;  3FDR A;  4IUQ A;  1OI1 A;  4BAC A;  2BUD A;  2RHX A;  2EQJ A;  2XDP A;  5KCH A;  3MP1 A;  3QII A;  3UWN A;  3QBY A;  4E7H A;  1XNI A;  3MEU A;  3LGL A;  4HCZ A;  2QQR A;  3OS0 A;  2EFI A;  3MP6 A;  5D6W A;  5M9O A;  3OYG A;  3F70 A;  3OYB A;  1G5V A;  2R5M A;  2DIQ A;  3H8Z A;  2JZ2 A;  2EQM A;  2RHU A;  3P8D A;  1WGS A;  1WJR A;  4RG2 A;  4BE2 A;  5D6X A;  2RHZ A;  1RI0 A;  2G3R A;  4PLI A;  4A4F A;  3MO8 A;  4E7L A;  5C6S A;  3MEV A;  2F5K A;  3QKJ A;  3P8H A;  1OZ3 A;  1OYX A;  3OYL A;  4E7K A;  2X4X A;  4PLL A;  3OYH A;  2O4X B;  3KUF A;  3PFS A;  3PNW C;  3LYI A;  3QJ6 A;  4QQ6 A;  4BDY A;  4IKF A;  4BE0 A;  4Q5W A;  3OYE A;  4BE1 A;  3OYM A;  3MEA A;  4II1 A;  3M9Q A;  3OQ5 A;  2X4Y A;  3MP8 A;  5KH6 A;  4QQG A;  4C5H A;  4GY5 A;  2RHI A;  2D9T A;  4IUR A;  3OYN A;  2EQK A;  3FC3 A;  3S3O A;  2RO0 A;  2RI3 A;  2FHD A;  3O8V A;  2JTF A;  3LGF A;  3S6W A;  2EKO A;  4IUT A;  2GFA A;  4N4H A;  3OMC A;  4Z02 A;  3NTK A;  4EDU A;  3ME9 A;  4BD3 A;  3Q1J A;  3LH0 A;  5D6Y A;  1KHC A;  3MET A;  4B9X A;  2X35 A;  4E7I A;  3NTI A;  2IG0 A;  2RJD A;  2WAC A;  4BDZ A;  2M1H A;  4QW2 A;  5IN1 A;  3LLR A;  5C0M A;  3OYD A;  3OYK A;  3E9F A;  3UT1 A;  2R57 A;  3FLG A;  3OA6 A;  2QQS A;  4PL6 A;  2M0O A;  2RJF A;  3L2W A;  5IAY A;  2LTO A;  2EQU A;  2M16 A;  5CIU A;  3H6Z A;  3OS1 A;  4FU6 A;  4OVA A;  2VYT A;  3OY9 A;  3PMT A;  3EAE A;  2DAQ A;  2HQX A;  3SD4 A;  2R58 A;  4N4I A;  4ZTF A;  5J26 A;  3ASK A;  2MWO A;  3OYI A;  4C5E A;  2K3X A;  4IUP A;  3DLM A;  4CRI A;  3CEY A;  3DB4 A;  3ZEH A;  2R5A A;  2GF7 A;  5FRO A;  4NS5 A;  2P0K A;  3S3M A;  2K3Y A;  2LDM A; 
#chains in the Genus database with same CATH topology
 2JN0 A;  1H3Z A;  2PVD B;  1VQ4 T;  1AWX A;  1WDX A;  1RAH B;  2BIV A;  4XU1 A;  2O4X A;  4F14 A;  5GJV B;  4C5I A;  1YJ9 Q;  4X9D A;  1PRM C;  5IXB A;  2ZCF B;  3OS5 A;  5FU7 B;  3S3N A;  1UTI A;  2DM1 A;  1JEG A;  2RK2 A;  1PWT A;  1V1C A;  4QQD A;  1VIF A;  3M58 A;  1VQP Q;  1MNE A;  4MMK A;  5LJ5 j;  2O31 A;  2EKH A;  1QMC A;  2E10 A;  1YHQ A;  1I07 A;  3CCJ A;  2BUD A;  2XIC A;  4MDX A;  5KCH A;  5GMK l;  1Q82 C;  2CYZ B;  4E7H A;  3LH5 A;  3CCQ T;  1NPP A;  3OS0 A;  4DBQ A;  3EGU A;  3MP6 A;  4E7S A;  3A5Z B;  1R0C B;  1LPL A;  2DF6 A;  4R55 A;  4DBF A;  4JJC A;  1XOV A;  3QKJ A;  1VQ5 T;  4RTZ A;  4P5N A;  2C0T A;  1ZA1 B;  1ZUK A;  1VQ6 T;  3M9Q A;  1YI2 A;  4FSX A;  3VS4 A;  4A4K A;  4C8Q C;  2YHT A;  3JB9 F;  4C8Q F;  2BE9 B;  1M1K C;  2CSQ A;  4J9F A;  4Z02 A;  2HNI A;  1M3C A;  2L3P A;  3CCL T;  4KUL A;  4E7I A;  2DET A;  4RTY A;  4BDZ A;  4AFQ C;  1Z9Z A;  1QP3 A;  3MCA B;  3CCQ Q;  4C92 A;  5IAY A;  5I2S A;  2LTO A;  2EQU A;  4JJN K;  1Y7X A;  2D0Q B;  3GP8 A;  2D8H A;  2G6F X;  1S72 A;  1K9A A;  1N8R C;  4JLG A;  4CC7 A;  2EYZ A;  2E12 A;  1X43 A;  4M75 D;  1MMG A;  2KXD A;  1UGS B;  2EBP A;  1Q7Y C;  3ZEH A;  2XID A;  1VQ5 Q;  3PVQ A;  4OB3 B;  3GLX A;  2PUO B;  4X9C A;  4XTU A;  4JS4 A;  1VQ6 Q;  1TH7 A;  1VQ9 A;  3L2U A;  4M7A E;  1T3S A;  1M2V B;  2M02 A;  3A8L B;  5LJ5 g;  2KYB A;  1GCP A;  1LJO A;  2DBM A;  3QYG B;  3L2Q A;  2YUQ A;  4A4E A;  2HBP A;  2V8K A;  3CCL Q;  2DVJ A;  2RNA A;  1WHK A;  1IXD A;  3HRS A;  4MDW A;  5FW9 A;  2K5F A;  2J06 A;  2B8A A;  2JM8 A;  2QI2 A;  3MEW A;  1W2B P;  2ECZ A;  2CS7 A;  2MIO A;  2HSP A;  4D8D A;  4F7U F;  1TXQ A;  1VQM T;  3QBY A;  1UGQ B;  5LJ3 h;  3CCV A;  5LJ5 e;  2QDL A;  1U06 A;  5GAN 6;  1VYV A;  4PJM A;  5I22 A;  3H41 A;  2JVV A;  1YJN Q;  2DXC A;  4MZP A;  3JB9 J;  4PFZ A;  1M1F A;  3HRU A;  4RUG A;  5KYU A;  1NEG A;  4R0K A;  1YP5 A;  4QQ6 A;  3QJ6 A;  1VQ7 T;  3EG2 A;  3VS3 A;  2V26 A;  4N0A A;  4II1 A;  1BI3 A;  1M30 A;  1PC0 A;  2K2M A;  2X4Y A;  1QWE A;  4LE9 A;  4M75 F;  2JJ9 A;  1D1B A;  2RO0 A;  2XD0 A;  4KT0 E;  4BD3 A;  2SEM A;  3BE3 A;  4J83 A;  1JRI A;  1GRI A;  1X6O A;  1VQM Q;  1VQL A;  2FPD A;  4PJJ A;  1D1C A;  1N8R U;  2JTM A;  2B86 A;  3LW5 E;  3VUB A;  5LL6 S;  5CQY A;  1QCN A;  1YBY A;  4M7D E;  4OP0 A;  4OMN A;  3OYI A;  2DTH A;  1WXT A;  4OMF B;  1YJ9 A;  2CSI A;  2DMO A;  4M78 E;  1BI0 A;  1VQ7 Q;  3EGX B;  4C8Q A;  3WXM B;  3OYJ A;  3PT9 A;  4PJO F;  2FRW A;  2DYI A;  4Y91 A;  1Y57 A;  4ZNX A;  1NE8 A;  1TUD A;  1SPK A;  2LX7 A;  4RMO A;  1M8V A;  4N4G A;  1MND A;  3JCM Q;  1I1J A;  3QWY A;  4OGE A;  1FWZ A;  4WF2 A;  1HYO A;  3C4S A;  2XMF A;  2A37 A;  2EGC A;  3T9N A;  2XG8 D;  2JOY A;  3URG A;  2NUT A;  2GNC A;  3CCS T;  1HJD A;  3RMS A;  5J39 A;  2LNH B;  4M7A B;  1OI1 A;  5GAN 8;  1VYT A;  3V7R A;  1O9S A;  3M4G A;  3RDV A;  3JCM W;  1UG1 A;  2J7I A;  3GBQ A;  3JCM b;  1WGS A;  4GBQ A;  4WTO B;  4FIB A;  1FMW A;  3UPU A;  1ZUY A;  3OYL A;  5FU6 B;  2WSE E;  4KRT A;  4JPB W;  5GAN 7;  3X20 B;  3VU3 C;  4A54 A;  3BW1 A;  1XJW B;  2CZ6 B;  1IGU A;  2YRD A;  1NJI R;  3OYN A;  3J7A F;  3RNJ A;  1X75 C;  3NHN A;  4F7U A;  3CCS Q;  3TEE A;  1V76 A;  1M3A A;  1D1A A;  4E6R A;  3LH0 A;  1KHC A;  1GCQ A;  1VQ5 A;  2IPO B;  5LJ3 j;  1U5S A;  3OA6 A;  1VIE A;  2XU8 A;  1PHT A;  3E19 A;  1AOJ A;  1VQN T;  3OY9 A;  4MML A;  2CP7 A;  1DJ7 B;  2HEQ A;  4M75 A;  2LQW A;  1I4K 1;  3UDC A;  2K3Y A;  2PQW A;  2DFU A;  1N6A A;  1M4Z A;  3X24 B;  1BCO A;  2X3W D;  3OMG A;  2KK4 A;  2VC8 A;  2M9U A;  2GGR A;  3CC2 A;  3HPW A;  3M0R A;  4QVD A;  1TU0 B;  5GAO l;  1J3T A;  1NM7 A;  3G71 A;  4M7D B;  1G3W A;  1WHJ A;  1D0X A;  1X69 A;  2JS2 A;  2P0Q A;  4AG2 C;  1D09 B;  2MWP A;  3EG9 B;  2DL3 A;  4M78 B;  3A98 A;  2JS0 A;  4E47 A;  2VUB A;  2DKG A;  4BAC A;  1PM3 A;  2D1X A;  3U23 A;  9ATC B;  3CCU T;  1YJN A;  4ATO A;  2COY A;  1I0C A;  2HKN A;  4HVW A;  3LGL A;  3V8K A;  4PJO A;  2EGE A;  2JMA A;  2FO0 A;  1RUW A;  1HSQ A;  2K4Y A;  2EQM A;  3VKI A;  1QP2 A;  2DL7 A;  1QKW A;  2KYM A;  1TWB A;  1C0M A;  1SHG A;  1Y07 A;  2KSS A;  3INZ A;  2MK5 A;  4C0D C;  1G83 A;  1Y71 A;  1V29 B;  4BE1 A;  4XTX A;  5FWC A;  2QYZ A;  5IHN A;  2GQV A;  1K0S A;  2FHD A;  3LGF A;  4C0G A;  3FIF A;  5LJ3 g;  1QVF P;  4N4H A;  3CPW S;  2CH4 W;  2OAU A;  5IHK A;  2RQW A;  3VRY A;  2OTJ A;  1AZE A;  3VS2 A;  4AFS C;  3CCU Q;  4QVC A;  1ZBX A;  2I0N A;  2YLB A;  1ZHI A;  4C92 G;  4RTV A;  2PVO B;  2QAZ A;  4J9C A;  5I11 A;  4FYX B;  2YUN A;  2PZ1 A;  1ABQ A;  2VYT A;  4GLK A;  3PMT A;  4HVU A;  1Q86 U;  2GBQ A;  5LJ3 d;  2R58 A;  2MF2 A;  4IUP A;  4HCB A;  3KXT A;  3AT1 B;  3TSZ A;  1ZSZ A;  2W10 A;  4PNO A;  1GXI E;  3IQL A;  2P0K A;  5IHI A;  1BCM A;  4Z88 A;  5LJ3 e;  1CKB A;  3REA B;  1ARK A;  3TCJ A;  4J8O A;  4C92 D;  3DLL A;  4IIM A;  1R77 A;  1TG0 A;  2JW4 A;  2QQA A;  2EWN A;  4EPC A;  4PFP A;  3L2R A;  2LC4 A;  2X4W A;  1NYG A;  1RAA B;  1VQ8 T;  3HKS A;  1WHM A;  2V8I A;  4AMC A;  2RQT A;  2CUD A;  1M2O A;  3QHS A;  2GFU A;  2VXF A;  1UDL A;  4J9H A;  4DOW A;  4FT2 A;  1M3B A;  4B9W A;  1C1A A;  3UAT A;  1IHV A;  2AKK A;  3HP9 A;  3M0T A;  5GAN 2;  3CBO A;  4HT8 A;  1NLP C;  4FT4 A;  1W1F A;  4AFZ C;  1KQS P;  2LNV A;  2O88 A;  3A1P A;  4LDW A;  1RLP C;  3P8D A;  1NBE B;  4OMQ A;  4QKU A;  3M0Q A;  1I81 A;  4OB0 B;  2DEU A;  3UA7 A;  1BU1 A;  3EGD A;  2DO3 A;  2F5K A;  1YIJ A;  3PVL A;  3PNW C;  3G6E A;  5LJ3 f;  3M53 A;  1K73 R;  3M4Y A;  4JJB A;  2DTI A;  2E64 A;  2FRY A;  4HKE A;  3FC3 A;  1UEC A;  1RAD B;  1QWF A;  2DEQ A;  4OMP A;  2AKL A;  4EDU A;  4C0F A;  2HL3 A;  4C92 C;  2P0P A;  3RR6 A;  4XU3 A;  1U8R A;  5D7U A;  3NTI A;  2EW3 A;  3JCM V;  3RUX A;  3OYD A;  3I55 Q;  3E9F A;  1Q95 G;  3CCE A;  3FLG A;  1YWO A;  2EGA A;  3SWN B;  4JJD A;  2DL5 A;  2CT4 A;  5GMK i;  4JRK A;  2HL5 C;  2HQX A;  3KFV A;  2SRC A;  1K9M R;  1YIT T;  2DD4 A;  3JB9 G;  1JJ2 S;  4C8Q G;  1D3B A;  4O6J A;  2KQW A;  1WQ7 A;  4A63 B;  4JRQ A;  1IRX A;  3DB3 A;  4M77 E;  3V8L A;  1VQO T;  2LX9 A;  1JXM A;  2ESW A;  3NMZ C;  3ULR B;  4EMK A;  1ZUU A;  2KY9 A;  2A3L A;  4IUU A;  2L5Q A;  4F16 A;  4X34 A;  4C0Z A;  2K2V A;  2XDD A;  3X25 B;  2LVM A;  2FPE A;  3JCM h;  2QTV A;  2CKK A;  3JB9 D;  4RTT A;  4OML A;  2DZ9 A;  3VS0 A;  1B3Q A;  3A8O B;  3KBG A;  1KD1 U;  3E9G A;  4DEY A;  2JUF A;  2J6F A;  1G3T A;  2KRN A;  1EZZ B;  1YIT Q;  1IHW A;  5D6W A;  5M9O A;  3SHW A;  1SKU B;  5GAN 4;  2RHU A;  1KQ1 A;  3G7Z A;  4BE2 A;  1MMD A;  4N0A C;  4KGX B;  1VQO Q;  1PKT A;  1X6B A;  1OPL A;  2WSC E;  2JNG A;  2YSQ A;  3SDZ A;  4MZT A;  3I56 T;  3VYG A;  1Y96 A;  3UF4 A;  3CC4 T;  3CCU A;  4RTX A;  5CVI A;  3CC7 T;  4IUR A;  1PSE A;  1K8A C;  4F7U G;  8ATC B;  2K6D A;  2WSF E;  3QDF A;  2FPF A;  4OMM A;  2QEX T;  3NTK A;  1BK2 A;  1FXX A;  1LCK A;  2NWM A;  1VQ4 Q;  1UB4 A;  2DA9 A;  2LCL A;  1ZQ1 A;  2ED0 A;  1RAI B;  3EH2 A;  4NOY A;  4PFO A;  1B34 A;  2DER A;  1TSF A;  2C0O A;  2CP6 A;  1PRL C;  3V7C A;  2J05 A;  4OVA A;  5EC7 A;  2MCN A;  5FLX E;  4M75 G;  3M59 A;  3DLM A;  2C06 A;  3J81 E;  1Z9Q A;  3HSB A;  2VB6 A;  1S1N A;  3I56 Q;  3L2Z A;  1GBR A;  4DBH A;  2CP5 A;  3CC4 Q;  3CC7 Q;  4Z8A A;  2JM9 A;  1JB0 E;  3THK A;  3OW2 P;  2KBT A;  2LP5 A;  1UGV A;  2QEX Q;  2RQR A;  2FZC B;  4QVZ A;  2MPX C;  3E2U A;  4ELZ C;  5L23 A;  5AT1 B;  3H9N A;  5GAO n;  3PTA A;  2QAS A;  4A4G A;  2NLU A;  2YUO A;  5FWB A;  3OSV A;  3CBP A;  5KYX A;  3G4S T;  1U1S A;  1OX8 A;  2CUB A;  2KRS A;  4M77 B;  3QII A;  4PJO G;  3OW2 A;  1N9R A;  5CAI A;  2DIQ A;  3QSU A;  3JSC A;  4HXJ A;  1JQQ A;  3FJ5 A;  4FW2 A;  1NPR A;  1WJR A;  4RG2 A;  5KYY A;  2NUP B;  1OPK A;  3JCM c;  2C0I A;  3MEA A;  2O9S A;  1T3L A;  1Q82 U;  4QQG A;  1K8A U;  5GAN 5;  4PJO D;  4BY6 B;  3I55 A;  3SEM A;  3S3O A;  1W4S A;  2GCX A;  4KUD K;  1U1T A;  3RMQ A;  1GCQ C;  3Q1J A;  1KC8 C;  4QW2 A;  3LLR A;  3OYK A;  5A0D A;  2EQI A;  4M7A D;  2W0Z A;  1I5L A;  4M75 C;  3AHU A;  2X9H A;  3OS1 A;  8AT1 B;  4JDS A;  4ZTF A;  5CCA A;  1M1K U;  3DB4 A;  1KJW A;  2CZ0 B;  2LQK A;  3ZL7 C;  1SHF A;  5FRN A;  2ENM A;  1M90 C;  1PCX A;  2KNB B;  3L1A A;  3EFS A;  2RI5 A;  2L3R A;  4GLM A;  2BE7 D;  2BZX A;  1OX9 A;  2VGM A;  1M5Q 1;  2VVK A;  3CPW A;  2VV5 A;  4IIO A;  2E5Q A;  3RKW A;  1OUL A;  1Q7Y U;  2DRM A;  5KE2 A;  3DKM A;  4L59 A;  2E65 A;  2BZY A;  2FL7 A;  4ANJ A;  5HY6 A;  1KSW A;  2O2O A;  1Q81 C;  4PJO C;  1QVG S;  2RQV A;  4F04 B;  3EFO B;  1VQP A;  3CXC P;  3CMA T;  1I8F A;  1D0Y A;  4XTV A;  4YTL A;  1QW1 A;  2MOX A;  2EFI A;  1WQW A;  1OU9 A;  3TVT A;  2HAX A;  3QJY A;  4OF1 A;  3JCM g;  3M55 A;  2Y4X A;  1OZ3 A;  2CP3 A;  1OYX A;  4E7K A;  4M7A F;  2X4X A;  2DX1 A;  1WHH A;  3RBB B;  2ROT A;  4BDY A;  3CXC A;  1XQH A;  2JT4 A;  1VQ4 A;  5KH6 A;  1QVP A;  4FCY A;  4D6W A;  1M2V A;  2KMT A;  1YJW T;  4XQ3 A;  2NUZ A;  1BI1 A;  2QA4 T;  4IUT A;  2GFA A;  3M0S A;  5HCK A;  3H0H A;  3A8G B;  4M7D D;  3JCM d;  2VWF A;  3FJP A;  1KC8 U;  1B07 A;  2LJ0 A;  5IT9 E;  4FW1 A;  2OTL T;  3MJX A;  2A0F B;  3CMA Q;  2RJD A;  3PE0 A;  4M78 D;  3E1S A;  1WLP B;  3JCM e;  2HBW A;  1ZSZ C;  3TRE A;  5CIU A;  3VS6 A;  3CC4 A;  1N8R R;  4N4I A;  1UHC A;  3CCQ A;  5HK3 A;  4O5V A;  1H8K A;  1MMN A;  2R5A A;  3C95 A;  5L8R E;  1TUG B;  1QCF A;  3EH1 A;  5KCO A;  3HRT A;  1M90 U;  4FYY B;  3OYY A;  1R8O B;  4J7I A;  1FMV A;  1G3Y A;  1YJW Q;  1MGQ A;  2QA4 Q;  3R6O A;  1VQ6 A;  2ABL A;  1KHI A;  2J6K A;  4LXC A;  2H3J A;  4LN2 A;  2VAS A;  5CR2 A;  2OTL Q;  1WNL A;  1Q81 U;  1NZ9 A;  2K5I A;  3VUZ A;  3CCL A;  1X2K A;  1X2Q A;  2RHX A;  4LD9 K;  3BFM A;  2HZY A;  4KGV B;  4M7D C;  4OMO A;  4AT1 B;  1JJ2 A;  3JCM f;  4KGZ B;  5I2M A;  4M7D F;  3OYG A;  3H8Z A;  2XDB A;  1VQK T;  2RHZ A;  1WI7 A;  4M78 F;  4XTZ A;  3MO8 A;  4KH1 B;  3UA6 A;  3OSS C;  3EGX A;  2ZPF B;  2DXT A;  1VQN Q;  5KYW B;  1MV0 B;  4M4Z A;  1K9M C;  3BY7 A;  2LQ8 A;  1G8X A;  2E5K A;  2GTJ A;  2ZPI B;  3JCM J;  1YHQ T;  4V2S A;  1EIF A;  3MET A;  5I21 A;  3CCJ T;  4DQ2 A;  5GAM h;  1ABO A;  5EG2 A;  1W2B S;  2F2X A;  3JRZ A;  2K7A A;  4PL6 A;  5GAO r;  1LOJ A;  4M7A A;  2HMA A;  1UE9 A;  2DE0 X;  2ZPE B;  1VQM A;  2V8J A;  1VQK Q;  1HXD A;  2MWO A;  1OQK A;  5FRO A;  1UEB A;  3C0C A;  4EMK C;  4C92 E;  2IVW A;  1UGP B;  4EMG A;  3I5S A;  1YI2 T;  1OZ2 A;  3NTH A;  1A0N B;  4JRP A;  5GMK h;  3JB9 I;  3FB9 A;  3EHQ A;  3JAM E;  2E6N A;  2PU9 B;  4C0D B;  1VQ7 A;  3HTR A;  5CKE A;  4KUI A;  4R56 A;  2CRE A;  4C5G A;  2CDT A;  3QDR B;  1SRM A;  3OYF A;  2AZV A;  1YHQ Q;  2KI7 A;  2BKD N;  2A08 A;  2RD1 A;  4FL6 A;  2DLP A;  2KE9 A;  4BI4 A;  4PKC C;  3QG1 A;  1M8M A;  2F5T X;  1G3S A;  1LNX A;  1SG5 A;  4OB2 B;  1HK9 A;  3UWN A;  1WZO A;  5ECA A;  3OBY A;  2FEI A;  1NG2 A;  1WA7 A;  5GAO q;  5D6X A;  4PLI A;  4RKU E;  2DL4 A;  3LWH A;  4BUG A;  2KT1 A;  2DIL A;  1TUC A;  2L3S A;  1AWJ A;  2FVU A;  2O4X B;  3KUF A;  2QGF B;  3QWX X;  2D8J A;  1PD1 A;  2DTO A;  2RHI A;  5J3B A;  4AG1 C;  1CKA A;  2EQK A;  1W6X A;  2GQI A;  2ZZD A;  2LMJ A;  5GAN h;  2RMO A;  2RN8 A;  1G2B A;  2VKN A;  4M7D A;  5AYF A;  4ESR A;  3GNF B;  2HDA A;  2M1H A;  3EG9 A;  4M78 A;  3CCS A;  4ZGD B;  3CCM T;  3CCV T;  3M57 A;  1PG5 B;  1VQ8 Q;  3H6Z A;  1RL2 A;  2DAQ A;  2KAF A;  1Q86 R;  5A2Q E;  5GAN 3;  4Y92 A;  2FG0 A;  4XU2 A;  7AT1 B;  4JZ4 A;  3V8J A;  1KFZ A;  1EX4 A;  2DBK A;  1YFN A;  3SWN C;  2F2W A;  3NGP A;  2OTL A;  4FYW B;  5IXF A;  5IH2 A;  3X28 B;  4ZTJ A;  2DZC A;  2DXU A;  3L2V A;  2HQE A;  4J5Y A;  2L8D A;  4C8Q E;  3EG3 A;  2E3I A;  1KG1 A;  2LJ3 A;  5GAM j;  1VUB A;  2XK0 A;  4FSS A;  3OBW A;  2RA2 A;  4IUV A;  3CCM Q;  4C92 B;  2YXY A;  3GF5 A;  3L42 A;  3LWI A;  3BDU A;  1WPY A;  1N27 A;  2LCC A;  1CSK A;  1JXO A;  1T0J A;  1IO6 A;  2CZ7 B;  2E6Z A;  1Y0M A;  2QQR A;  2H8H A;  3EFR A;  5GMK m;  2EJ9 A;  3OYB A;  1VQN A;  1YJ9 T;  5KYN A;  4Y28 E;  3CD6 T;  5GMK j;  2P4R A;  2RF0 A;  1FYN A;  4EMH A;  2K5L A;  3HFN A;  1HD3 A;  3PFS A;  2D6F A;  3MKD A;  1TS9 A;  4DEX A;  3MP8 A;  2CH4 A;  5FU7 C;  2D9T A;  2F2V A;  3PGG A;  2A7Y A;  4HT9 A;  3OMC A;  3C12 A;  1BIA A;  2O01 E;  3M54 A;  2DNU A;  3CME T;  2E1H A;  1VQK A;  2FZG B;  1AD5 A;  2JXB A;  4ME7 A;  2ED1 A;  2KT8 A;  2EYQ A;  2M0Y A;  2M0O A;  2QQ9 A;  1W70 A;  2QQB A;  4M77 D;  1M1G A;  4F7U E;  4JS5 A;  1NYF A;  1H3H A;  2KGT A;  4HCC A;  3CD6 Q;  3I35 A;  4J9E A;  4CRI A;  1AVZ C;  2GTO A;  3A8H B;  5KYU B;  5DM7 R;  2YRC A;  1VOM A;  2RI2 A;  3RKX A;  1ZSG A;  3GIB A;  5GAM g;  2YRV A;  2EVR A;  1YCS B;  1JO8 A;  2COW A;  1BIB A;  5GAN j;  4M75 E;  2FB7 A;  4BI3 A;  3PMI A;  1RLQ C;  3CME Q;  4A53 A;  3OB9 A;  2IIM A;  2LZ6 B;  1QVF S;  1AEY A;  4XAX B;  1P92 A;  5KE3 A;  5GAM d;  3M0P A;  1KD1 R;  4CI0 C;  2X3X D;  2XDP A;  1AT1 B;  1RAG B;  1RI9 A;  2RB6 A;  2CGH A;  1PSF A;  1EFN A;  1D0Z A;  1XNI A;  5GAM e;  2QK0 A;  4J6Y A;  4B6M A;  3SWN A;  4J9I A;  2Y90 A;  2P4T A;  2PNI A;  1H64 1;  1T0H A;  4C8Q B;  2G3R A;  2YT6 A;  3TU4 K;  1ACM B;  4M77 C;  2X4J A;  3CC2 T;  2LT4 A;  4M77 F;  2A28 A;  3JV3 A;  4RCB A;  4PJO E;  4BE0 A;  4J9D A;  3VS7 A;  3OYM A;  2MMP A;  1K0X A;  2MAM A;  3CQT A;  4CC4 B;  4C5H A;  3G71 T;  1NJI C;  3FRN A;  5GMK e;  2JTF A;  1WIE A;  3I5R A;  1ZBJ A;  2KRO A;  2CZ1 B;  2NUT B;  1VQ8 A;  3ME9 A;  1UHF A;  5D6Y A;  2DPP B;  4B9X A;  2FZK B;  2X35 A;  2LT1 A;  1YJN T;  4D8K A;  2JMC A;  2IG0 A;  2RH2 A;  4MZM A;  2LCS A;  4BY6 C;  4M7A G;  4WCI A;  3H0I A;  4FU6 A;  2MYS A;  4HA8 A;  4XK8 E;  4RG8 A;  3SD4 A;  1SF9 A;  1IRE B;  3ASK A;  4C5E A;  2K3X A;  3HHT B;  5GAM f;  3CC2 Q;  4NS5 A;  1BB9 A;  1KQS S;  5GAN g;  2BZ8 A;  2OX7 A;  2KVQ G;  3G4S Q;  1M9S A;  5LJ5 d;  2V1R A;  4DA4 A;  3WVE B;  3G71 Q;  2ATC B;  2ZGW A;  3CCM A;  4ORZ A;  1BKB A;  4F7U B;  4E7J A;  3CPW P;  2JTE A;  4LDU A;  2OTJ T;  4X1V A;  2E41 A;  1TOV A;  1SSF A;  5GAN d;  4J9G A;  1FMK A;  3QZ5 B;  1W2B A;  4NL2 A;  2A36 A;  5FRM A;  5GAN e;  3FDR A;  4LDX A;  3QYH B;  3P8B B;  1X27 A;  2K57 A;  3J80 E;  2F1L A;  3MEU A;  3ZBD A;  3HL8 A;  5DY9 A;  2KRM A;  1AZG B;  4M75 B;  3F70 A;  3C94 A;  4Z89 A;  1IB8 A;  2RM4 A;  3M5A A;  6AT1 B;  1RI0 A;  2RQU A;  1YIT A;  5C6S A;  1I5O B;  4XTY A;  2E4H A;  4PLL A;  2RK1 A;  3LYI A;  4Q5W A;  4ZN3 A;  4CC2 A;  5A0L A;  1OU8 A;  1NJI U;  1IGQ A;  1NEB A;  1VQO A;  5CQX A;  2OI3 A;  1Q82 R;  2OTJ Q;  1QKX A;  2YWW A;  1K8A R;  2RI3 A;  3O8V A;  2X51 A;  3S6W A;  1KQ2 A;  2ZAE A;  4RTW A;  1AWO A;  1U3O A;  4M7D G;  5LJ5 f;  4PJN A;  4M7A C;  3CD6 A;  1YN8 A;  2DJQ A;  4M78 G;  2WAC A;  2HQH A;  3UT1 A;  4XU0 A;  3RER A;  2Z0W A;  4PJO B;  3JB9 H;  2RJF A;  3CCR T;  2EYX A;  4M77 A;  2LJ1 A;  1E7O A;  5GAN f;  5GJW B;  1QCO A;  1KK7 A;  3HFO A;  3CEY A;  1M1K R;  4ELY C;  2GF7 A;  1YIJ T;  5FU6 C;  1BYM A;  2L2P A;  3S3M A;  2LDM A;  3G6E T;  2D0N A;  3CME A;  2HD0 A;  4KBM B;  2NUP A;  2KDS A;  4NL3 A;  2LRQ A;  1E6H A;  1YNZ A;  2HKQ B;  3I56 A;  3GOX A;  3FEO A;  3OYA A;  4A4H A;  2HCK A;  3NFC A;  1WXB A;  2YUP A;  4OGC A;  1ZA2 B;  3CC7 A;  3OYC A;  2CP2 A;  2O9V A;  5GAO m;  1R0B G;  1Q7Y R;  3R6N A;  1PD0 A;  4XTW A;  2LQN A;  2QEX A;  2QG9 B;  4RCC A;  2YLC A;  4VUB A;  3CCE T;  4LD6 A;  1SEM A;  2DIG A;  1WJQ A;  3CCR Q;  1ZLM A;  4J6W A;  1N9S A;  3SFM A;  4RTU A;  3VJP A;  1JBM A;  4ZGJ B;  1WX6 A;  1ZSZ B;  1JJ2 P;  2XHC A;  1YIJ Q;  1G5V A;  2JZ2 A;  2QDY B;  3G6E Q;  2PUK B;  4LNP A;  1YCY A;  3A8M B;  4KH0 B;  4A4F A;  4E7L A;  3D7S B;  3SB2 A;  1VA7 A;  3P8H A;  1MV3 A;  3OYH A;  4IKF A;  1QQJ A;  2AIR B;  2L0A A;  2Y4Y A;  1K73 C;  2DYB A;  3OQ5 A;  1TTH B;  2RPN A;  4HCK A;  2J6O A;  4CC3 A;  2DL8 A;  1UUE A;  1Q86 C;  4L5G A;  3OW2 S;  2MI6 A;  1X01 A;  3QZ9 B;  2DRK A;  1YWP A;  4HVV A;  4M78 C;  4OB1 B;  3TQ7 P;  3CCE Q;  2VGN A;  4LDY A;  1X6G A;  3PIP A;  4TVR A;  1KC8 R;  2AT1 B;  5IN1 A;  2I2L A;  2P84 A;  3QUI A;  4JZ3 A;  2EYW A;  1C6V X;  1WHL A;  3JCM X;  2COZ A;  3EFO A;  3G4S A;  3PIO A;  3EG0 A;  5CKD A;  1OOT A;  3CBM A;  1OV3 A;  5CKH A;  2OAW A;  3EGD B;  3EG1 A;  3RIR A;  2NYS A;  2F69 A;  4DBR A;  4ZGE B;  2RHY A;  1B7T A;  2ZPB B;  4J7F A;  1M90 R;  1WJS A;  2QTX A;  4DOV A;  2RJC A;  1IZ6 A;  4L6V 5;  4JUV A;  2KR3 A;  1WHG A;  1XTD A;  1UJY A;  2L89 A;  3WVD B;  4BI8 B;  1GBQ A;  1MHN A;  1LVK A;  3RES A;  3OS2 A;  3MHX A;  3VS1 A;  3JCM P;  4FYV B;  5CO7 A;  2QXF A;  4E7Z A;  1Q81 R;  3N5B B;  2L3Q A;  4JLI A;  2EQJ A;  5CKF A;  3MP1 A;  2ROL A;  5HKC A;  1KIK A;  1D3B B;  4AFU C;  1JU5 C;  2HSE B;  1H92 A;  2VXE A;  2AK5 A;  1RAC B;  1GFC A;  1O75 A;  3CCJ Q;  2EPD A;  1PNJ A;  3ER0 A;  2V1Q A;  3H0F A;  1K73 U;  1VYU A;  4EMK B;  3OYE A;  2K3B A;  2EAY A;  3V7S A;  1UFF A;  1S72 T;  3O5Z A;  1BBZ A;  1QLY A;  3NPF A;  3ZFJ A;  4J6X A;  1QVF A;  2DK3 A;  4LDV A;  1K1Z A;  2EJG A;  3REB B;  2BTT A;  1YI2 Q;  1VQ9 T;  3VRZ A;  4LUD A;  5LJ5 h;  5C0M A;  2XKO C;  4BB7 A;  2QQS A;  3VYH B;  5CKB A;  3CMA A;  1K9M U;  3CXC S;  2AZS A;  5GAO p;  1MMA A;  3EAE A;  1GFD A;  2OJ2 A;  5J26 A;  2EJF A;  2DD5 A;  2EYY A;  2DXB A;  3VV0 A;  1AWW A;  4UC4 A;  1WFW A;  1K4U S;  2K79 A;  2PTK A;  2RJE A;  1Y96 B;  1S72 Q;  1KD1 C;  5DLO A;  1GL5 A;  2M51 A;  2K9G A;  3I55 T;  4QT7 A;  3BDL A;  2PVG B;  3CCR A;  3GNG A;  5KYW A;  3QPH A;  1VQ9 Q;  2ZPH B;  4LUE A;  1YJW A;  1ZX6 A;  2QA4 A;  1WXU A;  1K76 A;  1B34 B;  3LX7 A;  3RKY A;  1RAB B;  4IUQ A;  3QXE B;  2EIF A;  4EIK A;  2DJZ A;  4J9B A;  4HCZ A;  2FYK A;  3G1J A;  1KQS A;  3MPU B;  2ZPG B;  2CP0 A;  2KXC A;  3I9Q A;  2R5M A;  1FX7 A;  1RAE B;  1PKS A;  2AHJ B;  1NLO C;  3M0U A;  2YDL A;  4C92 F;  3MEV A;  1E6G A;  1M27 C;  1WYX A;  1N5Z A;  3TSW A;  4ZN1 A;  1VQL T;  3CCV Q;  2KEA A;  1UJ0 A;  2CT3 A;  3QO3 A;  4E2F B;  4GY5 A;  4F17 A;  1F1B B;  4PK4 A;  4JRI A;  5DLQ E;  2H3E B;  2EKO A;  3CPF A;  2XI9 A;  1QVG P;  3GPL A;  1AHJ B;  1SSH A;  5KYX B;  1VQP T;  3X26 B;  5HK0 A;  2R57 A;  2DVE A;  4PJL A;  5CK9 A;  3L2W A;  4FM4 B;  4M77 G;  4K11 A;  3EHR A;  2M16 A;  5A0G A;  1SRL A;  1RAF B;  3M56 A;  2E3H A;  2E70 A;  5KYY B;  3VS5 A;  1OEB A;  1UGR B;  1VQL Q;  1QVG A;  2QGG A;  4C8Q D;  1BI2 A;  1MUZ A; 
#chains in the Genus database with same CATH homology
 2KVQ G;  2JN0 A;  5KCO A;  1H3Z A;  3HRT A;  1M90 U;  2PVD B;  1M9S A;  3OYY A;  4J8O A;  3TCJ A;  5LJ5 d;  1VQ4 T;  1R8O B;  4J7I A;  4C92 D;  1G3Y A;  3WVE B;  4DA4 A;  3DLL A;  2BIV A;  4XU1 A;  2O4X A;  4EPC A;  2QQA A;  2EWN A;  1MGQ A;  2ZGW A;  4C5I A;  3L2R A;  3CCM A;  3R6O A;  1VQ6 A;  2LC4 A;  1BKB A;  4X9D A;  4F7U B;  4E7J A;  2X4W A;  2ZCF B;  3OS5 A;  5FU7 B;  3S3N A;  4M7A C;  1VQ8 T;  3HKS A;  1KHI A;  2RK2 A;  4LDU A;  2V8I A;  2H3J A;  4QQD A;  2OTJ T;  2E41 A;  1VIF A;  3M58 A;  5CR2 A;  1SSF A;  5GAN d;  1WNL A;  4MMK A;  3QHS A;  5LJ5 j;  3QZ5 B;  2GFU A;  2VXF A;  4DOW A;  1W2B A;  4NL2 A;  1Q81 U;  1NZ9 A;  2K5I A;  4FT2 A;  5FRM A;  2E10 A;  4B9W A;  3VUZ A;  1YHQ A;  3CCL A;  5GAN e;  3FDR A;  3CCJ A;  2BUD A;  2XIC A;  4LDX A;  2RHX A;  3HP9 A;  4LD9 K;  4MDX A;  5KCH A;  5GAN 2;  3QYH B;  3P8B B;  3BFM A;  2K57 A;  3CBO A;  5GMK l;  4HT8 A;  3J80 E;  1Q82 C;  2CYZ B;  4E7H A;  4M7D C;  3MEU A;  3ZBD A;  3CCQ T;  3HL8 A;  5DY9 A;  1NPP A;  3OS0 A;  3JCM f;  1JJ2 A;  3MP6 A;  4FT4 A;  5I2M A;  4M7D F;  4M75 B;  3A5Z B;  2LNV A;  3F70 A;  4LDW A;  3OYG A;  3H8Z A;  2XDB A;  3C94 A;  3P8D A;  2RM4 A;  3M5A A;  1I81 A;  4OB0 B;  1VQK T;  2RHZ A;  1RI0 A;  4M78 F;  4XTZ A;  4R55 A;  2DO3 A;  3MO8 A;  5C6S A;  1YIT A;  1XOV A;  2F5K A;  3QKJ A;  4XTY A;  1YIJ A;  1VQ5 T;  4PLL A;  4P5N A;  2RK1 A;  3OSS C;  3PNW C;  3LYI A;  3G6E A;  2ZPF B;  2DXT A;  4Q5W A;  4ZN3 A;  5LJ3 f;  3M53 A;  1VQ6 T;  3M4Y A;  3M9Q A;  1YI2 A;  5A0L A;  1NJI U;  4FSX A;  1VQO A;  5CQX A;  2DTI A;  2E64 A;  4A4K A;  4C8Q C;  4HKE A;  3FC3 A;  1K9M C;  3BY7 A;  2YHT A;  2RI3 A;  3JB9 F;  3O8V A;  2LQ8 A;  3S6W A;  4C8Q F;  1KQ2 A;  2DEQ A;  1M1K C;  4M7D G;  4Z02 A;  2HNI A;  5LJ5 f;  4EDU A;  4C0F A;  4C92 C;  2P0P A;  2ZPI B;  3JCM J;  1YHQ T;  4V2S A;  1EIF A;  4XU3 A;  3CCL T;  3MET A;  5I21 A;  3CCJ T;  4DQ2 A;  1U8R A;  4KUL A;  5GAM h;  4E7I A;  3CD6 A;  3NTI A;  4M78 G;  4BDZ A;  2WAC A;  3JCM V;  3RUX A;  5EG2 A;  3OYD A;  3E9F A;  3UT1 A;  4XU0 A;  1QP3 A;  3MCA B;  3CCE A;  1W2B S;  3FLG A;  3RER A;  4C92 A;  4PL6 A;  3JRZ A;  2RJF A;  3SWN B;  3JB9 H;  4PJO B;  5IAY A;  1LOJ A;  5GAO r;  5I2S A;  2LTO A;  2EQU A;  4JRK A;  5GMK i;  3CCR T;  1Y7X A;  4JJN K;  2D0Q B;  3GP8 A;  4M7A A;  4M77 A;  2ZPE B;  5GAN f;  1S72 A;  1N8R C;  2HQX A;  1VQM A;  2V8J A;  4JLG A;  1HXD A;  2MWO A;  2E12 A;  4M75 D;  3HFO A;  1Q7Y C;  1UGS B;  1YIT T;  3CEY A;  3ZEH A;  2DD4 A;  2XID A;  4ELY C;  3JB9 G;  1JJ2 S;  2GF7 A;  5FRO A;  4C8Q G;  1D3B A;  4O6J A;  1UEB A;  3GLX A;  4OB3 B;  5FU6 C;  1YIJ T;  2PUO B;  4X9C A;  3S3M A;  1BYM A;  2LDM A;  4XTU A;  4EMK C;  3G6E T;  2KQW A;  2IVW A;  4C92 E;  1WQ7 A;  1UGP B;  4JS4 A;  4EMG A;  1TH7 A;  1VQ9 A;  3L2U A;  3CME A;  4M7A E;  4JRQ A;  1YI2 T;  1OZ2 A;  3NTH A;  2HD0 A;  3DB3 A;  4JRP A;  4M77 E;  5GMK h;  3JB9 I;  3V8L A;  1VQO T;  2LX9 A;  4KBM B;  2KDS A;  4NL3 A;  2LRQ A;  3A8L B;  3FB9 A;  5LJ5 g;  3JAM E;  2E6N A;  1LJO A;  2PU9 B;  4C0D B;  2KY9 A;  2A3L A;  3FEO A;  5CKE A;  4EMK A;  3I56 A;  3OYA A;  4IUU A;  4A4H A;  4KUI A;  3QYG B;  2L5Q A;  3L2Q A;  4X34 A;  3NFC A;  4C5G A;  4R56 A;  3QDR B;  4OGC A;  4C0Z A;  4A4E A;  3CC7 A;  2HBP A;  2V8K A;  2K2V A;  2XDD A;  3X25 B;  3OYC A;  3OYF A;  2BKD N;  5GAO m;  2LVM A;  3JCM h;  2RD1 A;  4FL6 A;  2CKK A;  4XTW A;  3HRS A;  4MDW A;  4BI4 A;  3JB9 D;  2QEX A;  2K5F A;  4PKC C;  2B8A A;  2QI2 A;  4RCC A;  2DZ9 A;  2YLC A;  3MEW A;  3QG1 A;  4VUB A;  3CCE T;  3A8O B;  3KBG A;  4LD6 A;  2DIG A;  2CS7 A;  1WJQ A;  2F5T X;  3E9G A;  1KD1 U;  1VQ7 A;  4J6W A;  1G3S A;  2JUF A;  1LNX A;  1N9S A;  3SFM A;  4OB2 B;  1HK9 A;  4F7U F;  3UWN A;  1VQM T;  3QBY A;  1G3T A;  3VJP A;  1UGQ B;  1JBM A;  4ZGJ B;  5LJ3 h;  3CCV A;  5LJ5 e;  5D6W A;  5M9O A;  2XHC A;  5GAN 6;  1G5V A;  3OBY A;  5GAN 4;  2JZ2 A;  2QDY B;  2RHU A;  2PUK B;  1YCY A;  3A8M B;  1KQ1 A;  3G7Z A;  5GAO q;  4BE2 A;  2JVV A;  5D6X A;  4A4F A;  4N0A C;  4PLI A;  4RKU E;  2DXC A;  4MZP A;  4E7L A;  3LWH A;  3JB9 J;  3SB2 A;  4BUG A;  3P8H A;  2WSC E;  2JNG A;  1M1F A;  3HRU A;  3SDZ A;  3OYH A;  2O4X B;  2FVU A;  3KUF A;  4MZT A;  3I56 T;  4QQ6 A;  3QJ6 A;  1VQ7 T;  3VYG A;  4IKF A;  2Y4Y A;  4II1 A;  4N0A A;  1BI3 A;  1K73 C;  3OQ5 A;  2X4Y A;  1Y96 A;  3CC4 T;  3CCU A;  3CC7 T;  5CVI A;  2DTO A;  2RHI A;  5J3B A;  4IUR A;  1PSE A;  4M75 F;  1K8A C;  2EQK A;  4F7U G;  2RO0 A;  1Q86 C;  2WSF E;  4L5G A;  2ZZD A;  3OW2 S;  2MI6 A;  1X01 A;  2XD0 A;  2QEX T;  4KT0 E;  3QZ9 B;  5GAN h;  3NTK A;  4M78 C;  4OB1 B;  2VGN A;  4LDY A;  4BD3 A;  1FXX A;  4J83 A;  4M7D A;  1UB4 A;  5AYF A;  3PIP A;  4TVR A;  1JRI A;  2LCL A;  1ZQ1 A;  1X6O A;  3GNF B;  2M1H A;  5IN1 A;  2I2L A;  3QUI A;  4NOY A;  4M78 A;  1B34 A;  3CCS A;  1VQL A;  4ZGD B;  3CCM T;  3JCM X;  3CCV T;  3M57 A;  3G4S A;  1N8R U;  3V7C A;  2JTM A;  3H6Z A;  1RL2 A;  3PIO A;  4OVA A;  5CKD A;  3LW5 E;  2DAQ A;  3VUB A;  5LL6 S;  5CQY A;  1YBY A;  3CBM A;  2KAF A;  4OP0 A;  4M7D E;  3OYI A;  5FLX E;  5CKH A;  4M75 G;  5A2Q E;  3M59 A;  2DTH A;  5GAN 3;  3DLM A;  2C06 A;  3J81 E;  3HSB A;  3RIR A;  4OMF B;  4XU2 A;  1YJ9 A;  2F69 A;  3V8J A;  4M78 E;  4ZGE B;  1BI0 A;  4C8Q A;  3WXM B;  3OYJ A;  2RHY A;  3L2Z A;  3SWN C;  2ZPB B;  3PT9 A;  4J7F A;  4PJO F;  2OTL A;  1WJS A;  2QTX A;  4DOV A;  2RJC A;  1IZ6 A;  1JB0 E;  4L6V 5;  4Y91 A;  1NE8 A;  4JUV A;  3X28 B;  4RMO A;  1M8V A;  4N4G A;  2DZC A;  3JCM Q;  4ZTJ A;  1XTD A;  2DXU A;  1FWZ A;  2L89 A;  2HQE A;  4OGE A;  3WVD B;  4J5Y A;  3L2V A;  4BI8 B;  4WF2 A;  2L8D A;  3C4S A;  4QVZ A;  4C8Q E;  4ELZ C;  1KG1 A;  5GAM j;  1MHN A;  1VUB A;  2XK0 A;  3RES A;  3OS2 A;  3MHX A;  5GAO n;  3OBW A;  3T9N A;  2XG8 D;  3PTA A;  2JOY A;  2RA2 A;  3URG A;  4IUV A;  4A4G A;  3JCM P;  3CCS T;  5CO7 A;  2NLU A;  2QXF A;  4C92 B;  3GF5 A;  3L42 A;  3LWI A;  3BDU A;  3RMS A;  5J39 A;  1WPY A;  1N27 A;  2LCC A;  3OSV A;  3N5B B;  4M7A B;  3CBP A;  1OI1 A;  3G4S T;  1U1S A;  4JLI A;  4M77 B;  2CZ7 B;  2EQJ A;  5GAN 8;  2E6Z A;  5CKF A;  3V7R A;  3MP1 A;  3QII A;  4PJO G;  1O9S A;  3M4G A;  3OW2 A;  1N9R A;  3JCM W;  2QQR A;  5CAI A;  5HKC A;  3EFR A;  5GMK m;  3JCM b;  2EJ9 A;  3OYB A;  1VQN A;  1D3B B;  1YJ9 T;  2DIQ A;  3QSU A;  3JSC A;  2VXE A;  1NPR A;  1WGS A;  1WJR A;  4RG2 A;  1O75 A;  4Y28 E;  3ER0 A;  3CD6 T;  5GMK j;  4FIB A;  3UPU A;  4EMH A;  2K5L A;  3OYL A;  5FU6 B;  2WSE E;  3HFN A;  3PFS A;  1K73 U;  2D6F A;  4EMK B;  3JCM c;  5GAN 7;  3X20 B;  3OYE A;  3MEA A;  3VU3 C;  3MP8 A;  1Q82 U;  2EAY A;  3V7S A;  4QQG A;  5FU7 C;  1S72 T;  5GAN 5;  1K8A U;  4A54 A;  4PJO D;  2D9T A;  3BW1 A;  2CZ6 B;  3PGG A;  4BY6 B;  3OYN A;  3I55 A;  3J7A F;  3ZFJ A;  3S3O A;  1X75 C;  1W4S A;  2GCX A;  4J6X A;  4KUD K;  1U1T A;  2DK3 A;  4LDV A;  2EJG A;  3RMQ A;  1QVF A;  2A7Y A;  4F7U A;  4HT9 A;  3OMC A;  3C12 A;  3TEE A;  1BIA A;  2O01 E;  3M54 A;  3Q1J A;  1VQ9 T;  3CME T;  2E1H A;  3LH0 A;  1VQK A;  1KHC A;  1KC8 C;  4QW2 A;  4ME7 A;  3LLR A;  5C0M A;  5LJ5 h;  3OYK A;  2XKO C;  1VQ5 A;  5A0D A;  2EYQ A;  4BB7 A;  5LJ3 j;  3OA6 A;  4M7A D;  2QQS A;  1VIE A;  2M0O A;  3VYH B;  2QQ9 A;  2QQB A;  2XU8 A;  1I5L A;  4M77 D;  1M1G A;  3E19 A;  4F7U E;  5CKB A;  4M75 C;  3AHU A;  1VQN T;  4JS5 A;  3OS1 A;  3OY9 A;  3CMA A;  3CXC S;  1K9M U;  5GAO p;  3EAE A;  4JDS A;  4ZTF A;  5CCA A;  5J26 A;  1M1K U;  2EJF A;  4MML A;  4HCC A;  1DJ7 B;  4CRI A;  3DB4 A;  2CZ0 B;  3A8H B;  4M75 A;  1I4K 1;  2DD5 A;  2LQK A;  3UDC A;  5DM7 R;  2K3Y A;  2PQW A;  2DXB A;  2RI2 A;  3VV0 A;  1N6A A;  3RKX A;  4UC4 A;  1M4Z A;  3X24 B;  2RJE A;  1Y96 B;  5FRN A;  3GIB A;  5GAM g;  3OMG A;  2KK4 A;  2VC8 A;  2YRV A;  2M9U A;  1KD1 C;  3L1A A;  1M90 C;  3EFS A;  5DLO A;  2RI5 A;  3CC2 A;  2L3R A;  3I55 T;  3HPW A;  1BIB A;  2VGM A;  1M5Q 1;  4QVD A;  3BDL A;  3CPW A;  2VV5 A;  5GAO l;  2PVG B;  3CCR A;  3GNG A;  4M75 E;  5GAN j;  2E5Q A;  2FB7 A;  4BI3 A;  3QPH A;  3PMI A;  3RKW A;  1Q7Y U;  3G71 A;  4M7D B;  1G3W A;  2ZPH B;  5KE2 A;  3DKM A;  4L59 A;  1YJW A;  2E65 A;  4A53 A;  2QA4 A;  2FL7 A;  3OB9 A;  2P0Q A;  2MWP A;  1QVF S;  5HY6 A;  4XAX B;  4M78 B;  1B34 B;  1P92 A;  4E47 A;  5KE3 A;  3LX7 A;  5GAM d;  1Q81 C;  4PJO C;  3RKY A;  1QVG S;  2VUB A;  2DKG A;  4IUQ A;  4BAC A;  1VQP A;  1YJN A;  3QXE B;  3CCU T;  2EIF A;  4CI0 C;  3CMA T;  4ATO A;  2XDP A;  1I8F A;  2DJZ A;  2RB6 A;  2CGH A;  1PSF A;  4XTV A;  1XNI A;  1QW1 A;  3LGL A;  4HCZ A;  2FYK A;  4J6Y A;  4YTL A;  3SWN A;  3V8K A;  5GAM e;  4PJO A;  2Y90 A;  2EFI A;  2P4T A;  1KQS A;  1H64 1;  2ZPG B;  1WQW A;  2R5M A;  1FX7 A;  2K4Y A;  2EQM A;  2AHJ B;  4C8Q B;  2HAX A;  3VKI A;  1QP2 A;  3QJY A;  2G3R A;  4OF1 A;  3TU4 K;  3JCM g;  3M55 A;  4C92 F;  3MEV A;  2Y4X A;  4M77 C;  1Y07 A;  1OZ3 A;  2X4J A;  1OYX A;  4E7K A;  4ZN1 A;  2X4X A;  2KSS A;  1VQL T;  3CC2 T;  2LT4 A;  4M7A F;  4M77 F;  3INZ A;  4C0D C;  4RCB A;  1Y71 A;  4BDY A;  4PJO E;  4BE0 A;  1V29 B;  3CXC A;  4XTX A;  3OYM A;  2MMP A;  4BE1 A;  1XQH A;  2MAM A;  1VQ4 A;  3QO3 A;  1QVP A;  5KH6 A;  4C5H A;  4GY5 A;  4D6W A;  2GQV A;  4JRI A;  3G71 T;  1NJI C;  2KMT A;  5DLQ E;  1YJW T;  3FRN A;  5GMK e;  2FHD A;  4XQ3 A;  2JTF A;  1BI1 A;  3LGF A;  3FIF A;  4C0G A;  5LJ3 g;  2QA4 T;  2EKO A;  4IUT A;  2GFA A;  2CZ1 B;  4N4H A;  3CPF A;  3CPW S;  3A8G B;  2XI9 A;  1VQ8 A;  4M7D D;  3JCM d;  3ME9 A;  3FJP A;  3GPL A;  1AHJ B;  2OAU A;  1KC8 U;  2OTJ A;  5IT9 E;  5D6Y A;  2DPP B;  4B9X A;  2X35 A;  1VQP T;  2LT1 A;  4QVC A;  1YJN T;  2OTL T;  3X26 B;  5HK0 A;  1ZBX A;  2IG0 A;  2RJD A;  1ZHI A;  2YLB A;  4M78 D;  4C92 G;  3E1S A;  2R57 A;  3JCM e;  2RH2 A;  4MZM A;  4M7A G;  4BY6 C;  2DVE A;  2PVO B;  5CK9 A;  3L2W A;  4FM4 B;  4M77 G;  2M16 A;  5A0G A;  3TRE A;  5CIU A;  4FU6 A;  2VYT A;  4GLK A;  4XK8 E;  3PMT A;  4HA8 A;  4RG8 A;  3M56 A;  1Q86 U;  3CC4 A;  3SD4 A;  5LJ3 d;  2R58 A;  1IRE B;  4N4I A;  2MF2 A;  3GOX A;  3ASK A;  3CCQ A;  2E70 A;  5HK3 A;  4O5V A;  4C5E A;  2K3X A;  4IUP A;  3HHT B;  4HCB A;  3KXT A;  5GAM f;  1UGR B;  2R5A A;  3C95 A;  4PNO A;  1QVG A;  4NS5 A;  4C8Q D;  2P0K A;  1KQS S;  1BI2 A;  1GXI E;  5GAN g;  5L8R E;  5LJ3 e; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...