2PQWA

Crystal structure of l3mbtl1 in complex with h4k20me2 (residues 17-25), trigonal form
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
315
structure length
315
Chain Sequence
WSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title L3MBTL1 recognition of mono- and dimethylated histones.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Lethal(3)malignant brain tumor-like protein
total genus 78
structure length 315
sequence length 315
ec nomenclature
pdb deposition date 2007-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2pqwA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2pqwA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2pqwA03
1KHCA 2RO0A 4GY5A 3OYGA 4QQGA 3ASKA 3PNWC 4N4GA 2GF7A 2RJEA 3MP1A 2CKKA 3OYJA 2YRVA 3LGFA 2NLUA 4FU6A 4PL6A 3LX7A 2R5AA 3E9GA 4B9XA 2X4WA 4IUUA 3GOXA 2M16A 3L42A 4UC4A 3SD4A 4C5EA 1WJRA 1RI0A 3C4SA 2MWPA 2RJDA 3H8ZA 4QQDA 4BD3A 3OB9A 3BDLA 2L8DA 2L89A 2K3YA 5J26A 2EKOA 1OZ3A 3OYAA 5FRMA 4BDZA 2R58A 4HCZA 5C0MA 1SSFA 2F5KA 2G3RA 3QBYA 5IAYA 3QKJA 3OY9A 4B9WA 3UWNA 3QJ6A 5KE2A 3S3NA 4QVZA 3H6ZA 2DIGA 4A4GA 2R5MA 4NS5A 2MWOA 2VYTA 2EQKA 3OMCA 2K3XA 3FLGA 3ME9A 3MO8A 3P8DA 1WJSA 2HQEA 3DLMA 4A4FA 3L2WA 3DB3A 4IKFA 1G5VA 1H3ZA 2BKDN 3MEUA 4BE2A 5FRNA 2R57A 5D6YA 2RJCA 2XK0A 3UT1A 4E7KA 3LYIA 1WJQA 2LCCA 4BE0A 2X35A 3Q1JA 3S3OA 3OYCA 1OZ2A 5C6SA 4L59A 4RG2A 2O4XB 3L2UA 3OYMA 3S3MA 3F70A 2M0OA 2RHUA 2B8AA 2DAQA 2EQJA 4N4HA 3DB4A 3OYKA 2RHYA 2FHDA 3NTIA 4X34A 2XDPA 3FC3A 4ZTFA 3OYLA 3MEWA 3S6WA 2JTFA 4BE1A 4IUQA 4IURA 2E5QA 4PLIA 4E7HA 3E9FA 2O4XA 3LGLA 4QW2A 3L2RA 1OI1A 2D9TA 3ZEHA 3OYDA 3LH0A 4IUVA 3PMTA 4IUTA 2EQUA 2LRQA 5D6XA 3OYBA 4C5GA 2WACA 3L2QA 4ZTJA 2HQXA 2QQSA 3CEYA 2X4YA 3OQ5A 2EQMA 2X4XA 3QIIA 4BACA 4C5HA 3OS0A 3FDRA 3MEAA 2GFAA 2E6NA 2RHIA 3MP6A 4A4EA 3OYNA 4BDYA 4EDUA 5CIUA 5KCOA 5KCHA 3OYIA 3PMIA 3M9QA 3MEVA 2GFUA 3PFSA 5D6WA 3OYEA 2RI3A 2L3RA 2JZ2A 4LD6A 2RI5A 5FROA 3FEOA 2DIQA 3P8HA 3OA6A 3OMGA 4E7IA 2M1HA 4QQ6A 1WGSA 3OYFA 2LDMA 4CRIA 5M9OA 4OVAA 3KUFA 4E7JA 3META 2P0KA 1N27A 1XNIA 5J39A 3L2VA 2QQRA 3LLRA 5KH6A 2IG0A 3OS2A 3NTKA 4II1A 2BUDA 2EFIA 3O8VA 1MHNA 5IN1A 2LTOA 1OYXA 3EAEA 2PQWA 4IUPA 4N4IA 4FL6A 4Z02A 3OYHA 2RHXA 4C5IA 4Q5WA 3NTHA 5KE3A 3OS1A 2RHZA 2BIVA 2RI2A 2RJFA 4E7LA 4PLLA 3MP8A 2LVMA 4A4HA
chains in the Genus database with same CATH superfamily
1KHCA 4PJMA 2QDYB 3I35A 3EGXB 2ENMA 1T0JA 2E70A 4J5YA 2JN0A 3FB9A 1YCYA 4A63B 2CP2A 4FM4B 1YJWA 2JVVA 2DZCA 3CBOA 1ZA2B 2ZPFB 4OB1B 4M77E 2FEIA 2ZCFB 1VQKQ 1K9MU 4LDVA 4C92B 3MHXA 5LJ3h 3V8LA 5LJ3g 3CPWP 1OZ3A 2J7IA 4Z88A 2G3RA 3I5SA 4ORZA 5KE2A 3QJ6A 3JCMV 1VQPA 1VQNQ 4F7UE 1ACMB 3REAB 1KQ2A 1OU8A 4BUGA 3DLMA 2DTOA 4PJJA 3EG1A 1VQ6T 2F1LA 1UECA 4JLIA 1NBEB 4M78D 4RG2A 2AKLA 2RHUA 2DF6A 1QKXA 4J9GA 1VQ7A 3NHNA 2JTFA 4L6V5 4BE1A 1WHMA 8ATCB 2YLBA 4E7HA 1TWBA 1OX9A 3LH0A 2DM1A 3QDRB 5EG2A 2LNHB 3M56A 1Q95G 2X4YA 2D0QB 3RIRA 2EYZA 1TUDA 1VA7A 1M5Q1 1ZQ1A 4ZGJB 1UGSB 4M77D 5CQXA 2GQVA 4XAXB 2CP7A 4JS4A 1QVFA 2WSFE 3RNJA 5HY6A 3QYHB 4C8QF 3SDZA 3CCQA 4E6RA 3BE3A 2F2XA 4KUDK 4M7AD 2JMCA 3CCQT 2P0KA 2QYZA 2QQRA 2IG0A 2DL4A 2K3BA 1X2KA 1I5LA 3VV0A 1B34A 1KJWA 4XTXA 2VVKA 2MMPA 1HYOA 1R0BG 2RJFA 3CPWA 2DVEA 1AHJB 1QVFP 2IPOB 2CSIA 4OGCA 4MMKA 3G71Q 5CKHA 3SWNC 3SD4A 5GAOp 4M7DE 3LWIA 5C0MA 2LQNA 4QVCA 5CO7A 1V76A 3VS5A 1HXDA 1WJSA 5FRNA 5D6YA 3VKIA 2VGMA 5GANj 3A98A 4M75F 1QP3A 1JQQA 1Y96A 3REBB 3A8OB 3EGXA 4FT2A 4IURA 3GBQA 4PJOG 1YP5A 3G71A 5L8RE 1BYMA 1VQOA 1FMVA 5IH2A 2ZPGB 2D1XA 2K5FA 2E3IA 3OSVA 1UGPB 2DYIA 2KMTA 2J6OA 2EQMA 2ABLA 2YRCA 3GLXA 2COZA 4Y92A 4C5HA 2RHIA 2KSSA 1PSEA 2LX7A 4FYVB 1XOVA 1S72T 2L3RA 4GLKA 2QG9B 3TEEA 1RADB 4JDSA 4PKCC 5I2SA 4GBQA 4RG8A 3CPFA 3NGPA 4X1VA 3CCQQ 4J6WA 5M9OA 2HAXA 5CQYA 3A8HB 1X2QA 2XICA 5J39A 3L2VA 1M2VB 2DMOA 2BZXA 1SHGA 2BUDA 2CGHA 4II1A 1QVGP 1N8RR 4PJOC 5LL6S 1E7OA 4ME7A 2CZ1B 1BKBA 1HSQA 5KYYA 2ROTA 2RI2A 2L0AA 1YN8A 2E64A 3V7CA 1TOVA 2DL8A 1VQ5Q 4OMMA 1XQHA 2P84A 4KGVB 2HMAA 3QWYA 4C92A 1GFCA 4OF1A 1MNEA 2LZ6B 3HPWA 3JSCA 3AHUA 1MMGA 1WJRA 4JRKA 3I55T 4HKEA 4QQDA 5HK3A 2MCNA 4RTTA 5KYWA 3JRZA 5GAOr 2KYBA 1JXOA 1ZUYA 5LJ3j 2OTJA 3EFOA 2KAFA 3DB3A 1IHVA 1VQ6Q 1VQNA 2DRMA 1RACB 2PZ1A 1I5OB 3SHWA 3HRSA 4TVRA 4J83A 2L3PA 3OYMA 3F70A 3BFMA 1D0ZA 4N4HA 3TVTA 3NTIA 2OTLT 1YBYA 1V1CA 3MEWA 1K9MC 1K9MR 4F17A 4HVWA 1AEYA 2J05A 1ZBJA 1D3BA 3C0CA 2V1RA 1VQPQ 4MZTA 1I4K1 1AVZC 2QTXA 2DO3A 1TXQA 4DBHA 3OW2P 1B07A 2DA9A 1K8AU 3OS0A 4M7AB 1VQKA 2H3JA 2AIRB 3CC4Q 4JS5A 3CD6A 4EDUA 5IHNA 5IHKA 3VS2A 4AG2C 4PJOD 3OA6A 5ECAA 2Y4XA 4OVAA 2M9UA 3X20B 1WI7A 4JZ3A 4P5NA 1ZUUA 1K1ZA 1MV0B 1R77A 5DY9A 4XTYA 5GANh 2YUOA 4M78E 2X9HA 2PQWA 3CCLT 4EMGA 1W1FA 4RTYA 3IQLA 2CZ0B 4QVDA 3OS1A 3GIBA 3MCAB 4M77F 3M54A 2X3XD 3PGGA 5FW9A 2YRVA 2ESWA 2K5IA 1WXTA 4X9DA 1ZSZA 5J26A 3V7SA 3M4GA 2WSCE 3INZA 2RH2A 2MF2A 3JCMX 4A4GA 5GANe 2MI6A 2QEXQ 3CMAQ 1PWTA 3OMCA 3MO8A 4LDWA 4KH0B 1RAFB 1PHTA 3CXCS 4LE9A 4ATOA 5GMKh 2B8AA 5KYYB 2EBPA 4EIKA 4RTWA 3BY7A 5GAMe 4LUDA 4M77B 2LX9A 1OULA 1VUBA 1BI1A 2ZGWA 4JRIA 4NL2A 3L2RA 1OI1A 3M0TA 2A0FB 1BK2A 2DXBA 4OB3B 3VJPA 4C5GA 2E10A 2VB6A 4HVUA 3ULRB 3M0RA 2PNIA 4BY6B 1BCMA 2AK5A 3TSWA 1NEGA 1YITQ 1VYUA 5GAMf 1NPRA 1FMKA 2E6NA 2VGNA 1FX7A 4PJLA 2VXEA 4M7AE 2RI3A 2LT1A 2RMOA 2RI5A 3CCSA 2DERA 5FROA 3VYGA 1SHFA 1M9SA 1YNZA 4EMKA 2HSPA 2E5KA 4A4KA 3HRUA 3RUXA 3CCST 1SG5A 3UATA 2O01E 4D8DA 2NUPB 2AHJB 3OS2A 1BIBA 3PE0A 1JB0E 5LJ5g 2LTOA 1X6GA 4N0AA 1MUZA 3HSBA 3VS3A 4J6YA 1JU5C 1Y07A 1KQSA 5FU6C 2RM4A 1H92A 2D0NA 1NG2A 2L3QA 2QA4T 1UGQB 4OB2B 3R6NA 2G6FX 4M78A 2YUPA 4KGZB 1WIEA 2M02A 1IREB 4Z89A 3OYAA 2RD1A 2V8JA 2DVJA 4EMHA 1VQ6A 2KE9A 2KY9A 2MWOA 2VYTA 1YJWQ 1VYTA 2K3XA 2V8KA 1KSWA 5GJVB 4LXCA 2MPXC 4L5GA 1NZ9A 1SRMA 5FLXE 1MMNA 4BI3A 1QCNA 3M4YA 3R6OA 5I11A 3EGUA 2OJ2A 2CP0A 2KVQG 3JCMb 2EJFA 2KQWA 1BCOA 3E9FA 3GPLA 1N9RA 3HFNA 2JUFA 4M77G 1XJWB 1WLPB 1SPKA 1W6XA 1WQ7A 2WACA 1H641 2HQXA 1B7TA 2LNVA 1MNDA 2EJ9A 1TUCA 3OYYA 3H41A 3JCMP 2DBMA 4A4EA 4MMLA 5KCOA 2IVWA 4ZGDB 1YITA 1M90U 3A8GB 4R56A 1M4ZA 4DOWA 2FO0A 3QYGB 3G1JA 2LDMA 1NLPC 3EH1A 4ZNXA 1ZSZC 3HP9A 1H3HA 4C0ZA 2X3WD 1IGQA 3X25B 3CCVA 1C6VX 2V8IA 1OU9A 1SF9A 3CMEQ 1U06A 2KT8A 2LMJA 1KD1R 1QLYA 1UGVA 4C92E 4ELYC 3HRTA 3QHSA 1B3QA 3LGFA 1VQPT 3SB2A 1I1JA 2FPFA 1KD1C 5LJ5e 1RI0A 5A0GA 2R58A 4AG1C 5FU7C 1YI2A 1FYNA 2DIGA 4XQ3A 3RKYA 2EQKA 1X75C 3NFCA 3FLGA 2JM9A 3RBBB 3CCRA 3QDFA 1JO8A 4IKFA 1K76A 3MEUA 1YI2Q 4ANJA 3G7ZA 4E2FB 1YIJA 1Y7XA 5IXFA 2ECZA 4CC7A 3S3MA 1G83A 2CS7A 4J9FA 3G71T 3C94A 2XDPA 1YIJT 1RLPC 2O88A 2DJZA 3M0UA 4RTXA 4F04B 4PLIA 1M2OA 1IZ6A 3G4SA 2K7AA 3ZEHA 5CKBA 1ARKA 1M1KR 4FSXA 2KR3A 3CMEA 1BU1A 4LDYA 4ZGEB 1VQ5T 1VQ4Q 3UDCA 3V8JA 4EMKB 1H8KA 2F5TX 2RF0A 3VYHB 1VQ9A 1WPYA 1PC0A 2MIOA 1J3TA 1GXIE 2RPNA 2RA2A 1QVGA 3RKWA 3CXCP 1Q82R 1T0HA 1M3BA 2RHZA 3MP8A 2DXTA 3VRYA 1FMWA 4GY5A 2EYXA 1OPKA 3ASKA 2GF7A 3MP1A 3JCMQ 1YI2T 4HXJA 3O5ZA 4DQ2A 1NYGA 5EC7A 1Y71A 3ZBDA 3C12A 4XU1A 4V2SA 3VS6A 1WNLA 4BD3A 1X6BA 2V1QA 2PUOB 1G3YA 4OP0A 4HCKA 3FJPA 4HVVA 2QI2A 3I55A 4ZN1A 2AZVA 5LJ5h 3EG0A 4FW1A 4M7AC 2FVUA 1H3ZA 3QZ5B 3J81E 1RUWA 2DX1A 3AT1B 5GAMd 3PIPA 2A7YA 2QDLA 1W2BP 1QVPA 2DL7A 1YJ9A 2KRSA 1D1CA 4L59A 3VUBA 3M58A 1YJNA 2O2OA 3EG9B 4M78F 3EHQA 1YJ9T 1AWXA 1TS9A 1M90C 2ROLA 1LPLA 1FWZA 2O4XA 3FRNA 4C0DB 5I21A 2DLPA 4IUTA 1R0CB 4BB7A 3V8KA 1VQ9Q 2DFUA 4C8QE 1EX4A 1TTHB 1G8XA 1M1KC 2H3EB 3ER0A 1BB9A 1PNJA 2GFAA 3M9QA 4HA8A 2OTJQ 2EVRA 2EAYA 3PFSA 5D6WA 2QEXT 3CMAT 3FIFA 3J80E 4E7IA 4RTZA 2RK2A 5KYWB 4F7UA 1ZBXA 2DL3A 2LJ1A 2BE9B 2CT3A 4XTWA 1OEBA 2HDAA 1U1TA 1VQOQ 3X28B 3M0QA 1Y57A 4A54A 1MMDA 2ZAEA 1K0SA 2ED0A 2EJGA 2A28A 4M7DG 2OAWA 4M77A 4M7DD 2DEQA 1RAEB 1I8FA 2AT1B 5I2MA 3T9NA 3VUZA 3QXEB 1QWEA 5GAMh 2EGAA 3KFVA 2NLUA 1QQJA 4WTOB 3MJXA 5AT1B 3SWNB 2NUPA 2K57A 1M1KU 1EZZB 2JXBA 2J6KA 4E7SA 1UUEA 4O6JA 2NUTB 5LJ5j 4J9CA 3OY9A 1D1AA 2OTLA 1VQLT 4PK4A 2W0ZA 5GANg 3KXTA 1IXDA 1HK9A 3CCUQ 2CYZB 1V29B 2YSQA 4E7KA 2LCCA 4BE0A 1RLQC 5C6SA 3URGA 1RAGB 1E6GA 2E4HA 3L2UA 1BIAA 1C1AA 1DJ7B 1SSHA 3QPHA 2CP3A 3UPUA 4ZN3A 2QAZA 3EFOB 4IUQA 3LGLA 2E65A 4C92F 1VQKT 2VKNA 3CPWS 1HD3A 5GJWB 3E19A 3PVLA 3L2QA 3A1PA 2ZZDA 3N5BB 1VQLQ 4RCCA 3OQ5A 4PNOA 1VQ8A 2M0YA 2O31A 4CC3A 2L5QA 4DEYA 1Q82U 4C8QA 2BTTA 2QQ9A 3CCRQ 4JLGA 2GFUA 4M7DF 1O75A 4MDXA 1TUGB 3BDUA 1M2VA 4J7IA 2RQWA 1IRXA 3PIOA 1T3LA 4AMCA 2EGCA 3JCMf 3VS0A 3CD6Q 2K9GA 2PUKB 5HK0A 3CCEQ 1MHNA 1BI0A 4GLMA 1N8RC 2FZKB 2RB6A 4J9IA 2CUDA 4PLLA 2ZPIB 1KQSS 4QQGA 3PNWC 3OYJA 2Y4YA 2QA4A 3JCMe 2HBPA 4PJOE 1ABQA 2VWFA 2X4WA 1SKUB 3CCVQ 2MK5A 2JS0A 1K73C 1PD0A 2DK3A 2L8DA 2K3YA 2HL5C 3EHRA 2VV5A 1Z9ZA 2AKKA 2VASA 2QK0A 1UGRB 2LCSA 2X4JA 1VQMQ 1KG1A 4X9CA 5LJ3d 5DLQE 4DBRA 4M75D 3QWXX 4PFPA 4BE2A 3UT1A 3EG9A 1UJ0A 2EGEA 2EWNA 2O4XB 5GANf 1GRIA 3E1SA 4FYXB 3LWHA 2F69A 2FHDA 2CZ7B 1UEBA 2MAMA 3EGDB 1VIFA 3CCRT 2JM8A 2XDBA 1WHHA 4JZ4A 1M3CA 4XTZA 4MZMA 5KYXA 2LJ3A 3KBGA 4JJDA 3I9QA 4JJNK 1GCQC 3GF5A 2CDTA 2C0OA 1VOMA 3M59A 1TH7A 1VQ8Q 4F7UB 2KRMA 5KCHA 4Z8AA 2KYMA 3I5RA 3OSSC 4F14A 1G3WA 2B86A 3CC2Q 4QQ6A 1YITT 3CMET 3DLLA 2KDSA 1GBQA 3M55A 2ED1A 1VQ5A 3SEMA 2P0PA 4R55A 1BBZA 2K79A 2OAUA 3LLRA 5GAN3 1KC8R 2FZCB 2O9VA 2P4RA 2DRKA 4OB0B 1X43A 1M3AA 2K5LA 4N4IA 4LDXA 1WZOA 3JCMg 1Y0MA 1KHIA 3CCJQ 3VU3C 2L3SA 1Q81U 1U3OA 1C0MA 2RJEA 2JW4A 2FB7A 2YRDA 3EH2A 1YCSB 2FRWA 4AFZC 1LJOA 2M16A 2EYYA 3C4SA 2MWPA 3JB9D 3MKDA 4HCCA 4M4ZA 1D09B 4AFSC 1CKBA 4HCZA 3RDVA 5IAYA 3QKJA 3I56Q 4M7AF 4YTLA 1NEBA 1UDLA 1K8AC 4NS5A 4J7FA 4B6MA 4J9DA 5LJ3f 1G5VA 1X69A 2KXCA 2K2VA 3LYIA 4PFZA 5GAOn 2M51A 3Q1JA 3S3OA 2CP6A 1K73R 2LCLA 4C0GA 3TREA 4LUEA 1OV3A 3OYLA 5IT9E 2OTJT 1NE8A 1AZGB 1Y96B 2DNUA 3CCMA 4LN2A 2RQUA 4Y91A 4IUVA 4JJCA 1EIFA 3EFSA 4E7ZA 1U1SA 4RUGA 3H0IA 2DEUA 2DETA 1YJNT 1WXUA 1MGQA 5KYUB 2C06A 2SEMA 1ZHIA 4BDYA 3MPUB 1AT1B 3OW2A 3OYEA 2CREA 2EPDA 1SRLA 4M75G 3CXCA 1ABOA 4PJNA 2XIDA 1QMCA 1WX6A 2DE0X 4BY6C 2PTKA 4E7JA 1N27A 1XNIA 1SEMA 1QVGS 2XD0A 1BI3A 2KRNA 3OBYA 2COYA 1PKSA 2EFIA 2JOYA 1ZA1B 1RAHB 1X6OA 2YWWA 2PVOB 2JTEA 2YUQA 4KH1B 4NOYA 4N4GA 2CKKA 5J3BA 5CK9A 1W2BS 2HBWA 3THKA 3E9GA 4KT0E 4B9XA 1Q7YR 1Q7YC 3L2ZA 1KQSP 4EPCA 1ZSGA 5GAN8 3OB9A 3RESA 2I0NA 1GFDA 2EKOA 1WHKA 5FRMA 2JS2A 3HL8A 4MDWA 1B34B 3TSZA 2GQIA 1N8RU 5KYUA 4FIBA 4B9WA 4M7DC 4QVZA 5LJ5f 4F7UG 4JRQA 3G6ET 2LQ8A 3H0FA 2GBQA 1Q86R 1GBRA 1S1NA 2XK0A 1K8AR 3G4ST 2FPEA 5CVIA 4QKUA 4WCIA 2X35A 3QSUA 1VIEA 3E2UA 1E6HA 4BI8B 3JB9I 1AWOA 2EKHA 2A3LA 5HKCA 2QXFA 2XKOC 1UG1A 4J9EA 3PMTA 5I22A 1S72A 4D8KA 2EQUA 1JJ2A 2JTMA 4M7AA 1OX8A 2NWMA 1Q86U 5FWCA 2FL7A 2QQAA 3QIIA 4BACA 8AT1B 3MP6A 1D3BB 2D8JA 2LJ0A 5DLOA 3OYIA 1D0XA 5GAOl 2BZ8A 3FEOA 2QA4Q 3C95A 1N6AA 2M1HA 1F1BB 2HEQA 3P8BB 1G3SA 1FXXA 2DYBA 4CRIA 4OMFB 3KUFA 3META 4EMKC 3G4SQ 3CCLA 2BE7D 4XU3A 3PTAA 3CCMQ 4OGEA 4C0FA 5GMKi 2CH4A 2DKGA 3UA6A 3G6EQ 3RERA 3EAEA 2RHXA 2LVMA 4RTUA 4C92C 2RO0A 2KROA 4FT4A 3OS5A 1UJYA 2GNCA 3LW5E 2EYQA 3HFOA 4PJOF 3CCSQ 4LNPA 1JBMA 2VUBA 1W4SA 4FU6A 2DXUA 2GGRA 1NJIC 9ATCB 4IUUA 4UC4A 3UF4A 1KD1U 2ZPBB 3H8ZA 1QVFS 1Z9QA 1AD5A 4XU0A 3EGDA 2L89A 4C8QB 4J9BA 1NPPA 1VQLA 1KC8U 3LH5A 4BDZA 3V7RA 3QBYA 3A8MB 3WXMB 1K4US 5GMKm 3H6ZA 2R5MA 1WHJA 2HQEA 2OTLQ 2NUTA 4J6XA 3GP8A 1AWJA 3RR6A 2CT4A 3QG1A 1RAAB 4CI0C 1YWPA 4XU2A 1MV3A 1VYVA 3CCJA 2DAQA 3RMQA 5GMKl 3OYKA 1I81A 2P4TA 3CCUT 1I07A 3M57A 2YUNA 4NL3A 1NLOC 1JJ2S 2DILA 3CCUA 2JNGA 3CBMA 2Y90A 1GCQA 2QEXA 3CMAA 1CKAA 3OYBA 1PRMC 1PSFA 4M75C 1WYXA 4C8QG 3X26B 2XDDA 1RAIB 1M30A 1PD1A 2EIFA 3FDRA 4C0DC 2DD4A 3JB9G 1NYFA 3JV3A 1MMAA 5GAMg 5GAOm 3I56A 1QP2A 1YHQA 3NMZC 5CCAA 3FJ5A 2KBTA 2KEAA 4D6WA 5GMKj 2E1HA 1M8MA 3I56T 2SRCA 2F2WA 4AFQC 2KXDA 2HCKA 3GNFB 4HT8A 4K11A 1AZEA 3OYHA 4C5IA 3CCLQ 3JCMd 4IIOA 1WQWA 4FSSA 4E7LA 1JRIA 4A4HA 5LJ5d 1YJWT 3OYGA 3JCMh 1LCKA 2IIMA 2X51A 5KYNA 5IXBA 2C0IA 3LX7A 2R5AA 3M5AA 1VQMA 2YLCA 2RK1A 3GOXA 4C5EA 2JJ9A 5GAOq 5LJ3e 4OMQA 1NJIR 4JUVA 1RABB 4DBQA 1YJ9Q 1QCOA 3CCJT 2F2VA 2H8HA 3D7SB 1QKWA 3UWNA 2D6FA 2DTIA 2FG0A 1UHFA 2LP5A 1QCFA 5DM7R 1U5SA 4A4FA 2RNAA 1GL5A 2D8HA 6AT1B 2PVDB 2HKQB 1WDXA 4ESRA 2FRYA 2DPPB 4JRPA 2EQJA 1Q7YU 3CC2T 4ZTFA 1M90R 3CCEA 2E5QA 1NJIU 1N9SA 2D9TA 2HD0A 2I2LA 3HTRA 1UHCA 4F16A 4DEXA 5CKEA 1LOJA 2E3HA 3BW1A 4J8OA 4R0KA 3HKSA 4AFUC 1ZLMA 3CCMT 2X4XA 1WA7A 2LT4A 2WSEE 3EG3A 1P92A 5FU7B 4LD6A 3SWNA 4RMOA 1WHLA 2ZPHB 5FWBA 2O9SA 3M53A 3OYFA 1D1BA 3CBPA 2BZYA 2E6ZA 1M1FA 3JCMc 5IHIA 4OMOA 1M27C 1OYXA 4Z02A 5GAN5 4IUPA 1A0NB 4FL6A 3JAME 4JJBA 5KE3A 3CCVT 5L23A 1O9SA 2VXFA 2DJQA 2K4YA 1RI9A 1TSFA 3TCJA 3VS4A 4HT9A 4M78C 3UA7A 4OMLA 2LQKA 4XTVA 2RQRA 3WVEB 4M7DA 1PKTA 2EQIA 3BDLA 3QO3A 5CKDA 1YIJQ 2KGTA 2XI9A 2ATCB 1Q81C 1K73U 4C92G 3S3NA 2A37A 2J6FA 2V26A 4XTUA 1U8RA 3CCET 3P8DA 4J9HA 4KUIA 3TU4K 5GAN4 2K6DA 3JB9H 1K9AA 3JCMJ 1WJQA 2DD5A 4RKUE 3VS1A 2JT4A 1KK7A 2M0OA 4OMNA 4KULA 3ZL7C 1IHWA 3G6EA 4FW2A 1AWWA 1VQNT 3HHTB 4XK8E 2CP5A 2MYSA 2OX7A 4IIMA 3QJYA 1IGUA 2E41A 1UB4A 2NUZA 4HCBA 4ZTJA 2PVGB 2QQSA 5A2QE 3CEYA 1YWOA 3GNGA 1KIKA 3WVDB 3OYNA 4KGXB 5CIUA 1NM7A 5D7UA 2XMFA 2HSEB 4F7UF 3M0PA 3OMGA 1JEGA 1KC8C 1PRLC 3JB9F 4A53A 5A0DA 2GTJA 1R8OB 3RKXA 1WXBA 4LD9K 3O8VA 4C8QD 2HZYA 2QQBA 3NPFA 4DBFA 1QWFA 1YJNQ 3NTHA 2BIVA 4M7DB 1XTDA 4VUBA 2OI3A 1AOJA 2HL3A 3H9NA 2PU9B 3EFRA 4PL6A 1VQ7Q 2J06A 5FU6B 3L42A 1K0XA 2W10A 2CSQA 3I55Q 1Q86C 2RJDA 2XU8A 3TQ7P 1JXMA 5KYXB 2K2MA 2F5KA 1X01A 4M78B 4CC4B 4LDUA 4C92D 2BKDN 2DZ9A 2R57A 2LC4A 2RJCA 1OPLA 1VQOT 1OZ2A 1TU0B 4PJOB 4DOVA 4X34A 2CH4W 2CZ6B 2FYKA 3S6WA 1S72Q 1OOTA 1M8VA 4M7AG 4QW2A 4M75A 3OYDA 1WFWA 2RN8A 2A08A 5D6XA 2NYSA 1VQ9T 4RTVA 1G2BA 3CD6T 2FPDA 3L1AA 7AT1B 3A5ZB 2XHCA 1BI2A 1YFNA 1W2BA 3EG2A 2E12A 4DA4A 1ZUKA 3MEVA 2HNIA 2JZ2A 5GMKe 2L2PA 2DIQA 4PFOA 4C8QC 2RQVA 1WHGA 1WGSA 1LVKA 1GCPA 3CQTA 1UE9A 1VQ8T 2HQHA 4OMPA 4FCYA 5KH6A 4JPBW 1IB8A 2XG8D 3NTKA 2GCXA 2KK4A 2GTOA 3QZ9B 5IN1A 3RMSA 4QT7A 4Q5WA 4PJOA 3A8LB 5A0LA 4FYYB 3FC3A 3ZFJA 1YHQQ 2VC8A 2CUBA 5AYFA 3PVQA 4RCBA 5GAMj 3JCMW 4CC2A 1D0YA 1JJ2P 1X27A 2EW3A 2KT1A 3CC7A 4WF2A 1SSFA 3U23A 2YDLA 2ZPEB 1ZX6A 2KNBB 3DKMA 1G3TA 3CC7T 5CAIA 3ME9A 1VQMT 1EFNA 4ELZC 2QGGA 3L2WA 3X24B 1OQKA 4M78G 3OW2S 2EYWA 2DBKA 1VQ4A 3VS7A 4M75B 1QW1A 1I0CA 5GANd 3OYCA 2Z0WA 1UFFA 2QTVA 2YHTA 1VQ4T 3DB4A 1PCXA 2RHYA 2YT6A 3SFMA 1PG5B 2LQWA 2C0TA 1IO6A 4KBMB 1CSKA 5CKFA 2QASA 5GAN7 2YXYA 3M0SA 2HKNA 2DXCA 1RL2A 3J7AF 3H0HA 2LRQA 1UTIA 3OBWA 4AT1B 3CC2A 5GAN6 4FYWB 2A36A 1M1GA 2QGFB 1VQ7T 1W70A 3CC7Q 1N5ZA 4N0AC 4E47A 2DL5A 3MEAA 1ZSZB 1KFZA 2KI7A 3PMIA 5CR2A 4MZPA 1TG0A 2COWA 3PT9A 1KQ1A 5HCKA 3JB9J 3P8HA 2RQTA 4BI4A 2MOXA 1PM3A 4KRTA 4M75E 1HJDA 2P0QA 3VRZA 4M77C 2DTHA 2FZGB 3CC4A 1YHQT 2AZSA 1T3SA 1Q82C 4Y28E 3QUIA 1LNXA 3CC4T 1Q81R 5GAN2 2JMAA 4O5VA
chains in the Genus database with same CATH topology
4J6YA 1KHCA 2ZPIB 1YJWT 2QDYB 1KQSS 3OYGA 4QQGA 3PNWC 1Y07A 1KQSA 3OYJA 2E70A 2Y4YA 4J5YA 5FU6C 3JCMh 2QA4A 2RM4A 2JN0A 3JCMe 2HBPA 3FB9A 1YCYA 4PJOE 3LX7A 2R5AA 4FM4B 3M5AA 1YJWA 2X4WA 2YLCA 2RK1A 3GOXA 2JVVA 1VQMA 2DZCA 3CBOA 4OB1B 2ZPFB 4C5EA 2QA4T 4M77E 1UGQB 4OB2B 2ZCFB 1K73C 4M78A 5GAOq 4LDVA 4C92B 5LJ3e 1K9MU 2DK3A 2L8DA 2K3YA 3MHXA 1IREB 4JUVA 5LJ3h 3V8LA 5LJ3g 1OZ3A 2VV5A 3OYAA 2RD1A 2V8JA 2G3RA 1UGRB 3CCJT 5KE2A 3UWNA 3QJ6A 2D6FA 3JCMV 1VQPA 2DTIA 4EMHA 1VQ6A 2X4JA 2KY9A 4F7UE 2MWOA 2VYTA 1KG1A 4X9CA 5LJ3d 1KQ2A 2K3XA 5DLQE 5DM7R 2V8KA 4M75D 3DLMA 4A4FA 4BUGA 2DTOA 4L5GA 1NZ9A 4BE2A 5FLXE 1VQ6T 3UT1A 2PVDB 4BI3A 4JLIA 3M4YA 3R6OA 4M78D 2EWNA 4RG2A 2O4XB 5GANf 3E1SA 4JRPA 2DPPB 2RHUA 2EQJA 1Q7YU 3CC2T 3LWHA 2F69A 2FHDA 2CZ7B 4ZTFA 1UEBA 2KVQG 2MAMA 3JCMb 1VQ7A 3CCEA 2EJFA 1VIFA 2JTFA 4L6V5 3CCRT 4BE1A 2XDBA 2E5QA 2KQWA 2YLBA 4E7HA 3E9FA 1NJIU 3GPLA 1N9SA 1N9RA 2D9TA 2HD0A 2I2LA 2JUFA 3HFNA 3LH0A 4M77G 4XTZA 4MZMA 3QDRB 5EG2A 5CKEA 1WQ7A 1LOJA 3M56A 2WACA 3BW1A 1H641 3KBGA 4J8OA 3HKSA 2HQXA 4JJNK 2LNVA 2EJ9A 3OYYA 3CCMT 2X4YA 3RIRA 2D0QB 2X4XA 3GF5A 2LT4A 1M5Q1 2WSEE 3M59A 1ZQ1A 3JCMP 4A4EA 1TH7A 4MMLA 4ZGJB 1UGSB 4M77D 1P92A 2GQVA 5CQXA 4F7UB 4XAXB 5KCHA 2IVWA 5FU7B 2WSFE 4ZGDB 4JS4A 5HY6A 1YITA 1QVFA 3QYHB 4C8QF 4LD6A 3SDZA 3CCQA 3SWNA 4RMOA 1M90U 3OSSC 3A8GB 1G3WA 4R56A 1M4ZA 4DOWA 2ZPHB 4QQ6A 3QYGB 1YITT 3CMET 3DLLA 4KUDK 2KDSA 3M53A 2LDMA 3M55A 3OYFA 3CCQT 1VQ5A 4M7AD 2P0KA 2P0PA 3HP9A 4R55A 3CBPA 4C0ZA 2OAUA 2QQRA 3LLRA 5GAN3 2E6ZA 2IG0A 1M1FA 3JCMc 3X25B 3CCVA 1I5LA 2V8IA 4OB0B 3VV0A 2K5LA 1B34A 1OYXA 4N4IA 4Z02A 4IUPA 4XTXA 4FL6A 5GAN5 3JAME 4LDXA 3JCMg 5KE3A 2MMPA 1KHIA 3CCVT 2RJFA 3VU3C 4C92E 1O9SA 3CPWA 2VXFA 4ELYC 2DVEA 3HRTA 2K4YA 1Q81U 1AHJB 3QHSA 2RJEA 4OGCA 4MMKA 3LGFA 2FB7A 5CKHA 3TCJA 1VQPT 3SB2A 4HT9A 3SWNC 4M78C 1LJOA 1KD1C 2M16A 3SD4A 5LJ5e 2LQKA 4XTVA 1RI0A 3C4SA 2MWPA 5GAOp 3JB9D 3WVEB 4M7DA 4M7DE 3QO3A 3BDLA 3LWIA 4HCCA 5CKDA 5A0GA 2R58A 2XI9A 4HCZA 5C0MA 1Q81C 5IAYA 3QKJA 5CO7A 5FU7C 4C92G 4QVCA 3S3NA 1K73U 4M7AF 4YTLA 1YI2A 2DIGA 4XQ3A 3RKYA 4NS5A 4XTUA 4J7FA 1K8AC 2EQKA 1HXDA 1X75C 3NFCA 1U8RA 3FLGA 3CCET 3P8DA 1WJSA 5LJ3f 3CCRA 4IKFA 4KUIA 1G5VA 3TU4K 3MEUA 5GAN4 5FRNA 5D6YA 3VKIA 3JB9H 3G7ZA 2K2VA 2VGMA 3JCMJ 3LYIA 1WJQA 2DD5A 4RKUE 5GAOn 5GANj 1YIJA 3Q1JA 3S3OA 1Y7XA 4M75F 1QP3A 1Y96A 3S3MA 2CS7A 2M0OA 3G71T 2LCLA 4KULA 3C94A 3TREA 4C0GA 2XDPA 1YIJT 3A8OB 3G6EA 3OYLA 5IT9E 2OTJT 2DJZA 1NE8A 1Y96B 3CCMA 4FT2A 4IURA 4PJOG 4PLIA 1VQNT 3G71A 3HHTB 5L8RE 1IZ6A 4Y91A 3G4SA 4XK8E 3ZEHA 1BYMA 1VQOA 4IUVA 5CKBA 2ZPGB 3QJYA 1EIFA 2E41A 3EFSA 1UB4A 2K5FA 1U1SA 4FSXA 3OSVA 1YJNT 4HCBA 1UGPB 2KMTA 4ZTJA 2PVGB 2QQSA 5A2QE 3CMEA 3CEYA 3GNGA 4LDYA 4ZGEB 1VQ5T 2EQMA 1MGQA 3GLXA 4C5HA 2C06A 2RHIA 2KSSA 3WVDB 3UDCA 1ZHIA 3OYNA 1PSEA 3V8JA 4BDYA 5CIUA 4EMKB 1XOVA 1S72T 3OW2A 3OYEA 2F5TX 2L3RA 4GLKA 3TEEA 3VYHB 4JDSA 4PKCC 5I2SA 1VQ9A 1WPYA 4F7UF 3OMGA 4M75G 4RG8A 3CPFA 3CXCA 1KC8C 1GXIE 2XIDA 4J6WA 2RA2A 3JB9F 5M9OA 2HAXA 4BY6C 4E7JA 5CQYA 3A8HB 4A53A 1N27A 1XNIA 2XICA 3RKWA 5A0DA 5J39A 3L2VA 1QVGS 2XD0A 1BI3A 1R8OB 3OBYA 3RKXA 4II1A 2BUDA 2CGHA 4LD9K 4PJOC 2EFIA 3O8VA 5LL6S 2JOYA 4C8QD 4ME7A 2CZ1B 2QQBA 1BKBA 1X6OA 3NTHA 2RHZA 2BIVA 2RI2A 2PVOB 4M7DB 1XTDA 3MP8A 2E64A 3V7CA 4VUBA 2DXTA 4GY5A 2PU9B 1XQHA 3EFRA 4NOYA 3ASKA 4N4GA 2GF7A 3MP1A 2CKKA 5J3BA 3JCMQ 5CK9A 1YI2T 1W2BS 4C92A 4DQ2A 4PL6A 1Y71A 3ZBDA 4OF1A 3E9GA 4KT0E 4B9XA 5FU6B 3HPWA 3C12A 3JSCA 3L2ZA 3L42A 1Q7YC 3AHUA 1WJRA 1Q86C 2RJDA 4XU1A 4V2SA 4JRKA 4EPCA 1WNLA 4HKEA 2XU8A 4QQDA 4BD3A 3OB9A 5GAN8 3RESA 3I55T 2EKOA 2PUOB 1G3YA 5FRMA 4OP0A 5HK3A 3HL8A 4MDWA 1B34B 2F5KA 3FJPA 1N8RU 1VQKT 4M7DC 4FIBA 4B9WA 1X01A 2QI2A 4M78B 3I55A 4QVZA 3JRZA 4ZN1A 5GAOr 5LJ5f 5LJ5h 5LJ3j 4LDUA 4F7UG 4M7AC 4JRQA 3G6ET 2LQ8A 2FVUA 2OTJA 2KAFA 1H3ZA 3DB3A 3QZ5B 3J81E 4C92D 2BKDN 2DZ9A 2R57A 1VQNA 2LC4A 2RJCA 2XK0A 5GAMd 3G4ST 5CVIA 3PIPA 2A7YA 1VQOT 3QSUA 2X35A 1QVPA 1YJ9A 1OZ2A 3HRSA 4TVRA 4J83A 4L59A 1VIEA 3VUBA 3OYMA 3F70A 3M58A 3BFMA 4N4HA 4BI8B 1YJNA 4PJOB 4M78F 4DOVA 3NTIA 4X34A 2OTLT 3JB9I 2CZ6B 1YJ9T 1YBYA 2FYKA 1M90C 3MEWA 2A3LA 3S6WA 1K9MC 5HKCA 1M8VA 1FWZA 4M7AG 2O4XA 2QXFA 3FRNA 4QW2A 2XKOC 4M75A 3OYDA 4C0DB 5I21A 3PMTA 1S72A 4IUTA 2EQUA 5D6XA 4BB7A 1JJ2A 3V8KA 1D3BA 2JTMA 4MZTA 1VQ9T 1I4K1 4M7AA 2QTXA 4C8QE 3CD6T 3L1AA 2DO3A 1Q86U 5KCOA 1BI2A 2XHCA 3A5ZB 1W2BA 2FL7A 3ER0A 2QQAA 3QIIA 1K8AU 4BACA 1M1KC 3OS0A 4M7AB 2GFAA 1VQKA 2H3JA 1D3BB 3MP6A 4JS5A 2E12A 4DA4A 4EDUA 3CD6A 5DLOA 3OYIA 3M9QA 4HA8A 2EAYA 3MEVA 3PFSA 5D6WA 2HNIA 5GAOl 2QEXT 2JZ2A 3FIFA 3CMAT 4PJOD 5GMKe 3J80E 3FEOA 2DIQA 3OA6A 4C8QC 3C95A 4E7IA 1N6AA 2M1HA 2RK2A 1WGSA 2Y4XA 3P8BB 4F7UA 1G3SA 1ZBXA 1FXXA 4CRIA 2M9UA 4OVAA 4OMFB 3KUFA 4XTWA 3X20B 1U1TA 3META 4P5NA 3X28B 1VQ8T 1QVGA 4EMKC 4A54A 3CCLA 4XU3A 5KH6A 2XG8D 3PTAA 3NTKA 2GCXA 5DY9A 2KK4A 4XTYA 5GANh 4OGEA 4C0FA 5GMKi 2EJGA 4M78E 4M7DG 2DKGA 3RERA 3QZ9B 4M77A 5IN1A 3RMSA 3EAEA 2DEQA 2PQWA 4M7DD 3CCLT 4EMGA 2RHXA 1I8FA 4Q5WA 4QVDA 2CZ0B 3OS1A 4PJOA 5I2MA 3A8LB 3T9NA 3GIBA 3MCAB 5A0LA 2LVMA 3FC3A 3ZFJA 4M77F 4C92C 2RO0A 3M54A 2VC8A 4FT4A 3VUZA 3QXEB 3OS5A 5GAMh 3PGGA 3LW5E 2EYQA 3HFOA 5AYFA 4PJOF 2YRVA 2NLUA 1JBMA 2VUBA 1W4SA 4FU6A 2DXUA 2K5IA 4RCBA 5GAMj 3JCMW 1NJIC 4IUUA 4UC4A 1KD1U 4X9DA 3SWNB 2K57A 1M1KU 2ZPBB 3H8ZA 1QVFS 4XU0A 5J26A 2L89A 3V7SA 4C8QB 3M4GA 1NPPA 1VQLA 2WSCE 3CC7A 4BDZA 1KC8U 3INZA 3V7RA 4WF2A 2RH2A 2MF2A 4O6JA 1SSFA 3QBYA 2ZPEB 5LJ5j 3OY9A 3A8MB 3WXMB 5GMKm 3H6ZA 3JCMX 4A4GA 5GANe 2MI6A 2R5MA 3DKMA 1VQLT 1G3TA 3OMCA 2OTLA 5CAIA 3CC7T 5GANg 3ME9A 3KXTA 3MO8A 1VQMT 4ELZC 2HQEA 3L2WA 3X24B 4LDWA 4M78G 1HK9A 3OW2S 4J6XA 2CYZB 3GP8A 1V29B 1VQ4A 4E7KA 4M75B 3QG1A 1QW1A 4CI0C 3CXCS 2LCCA 4BE0A 4XU2A 5GANd 3OYCA 5C6SA 3URGA 4ATOA 3L2UA 3CCJA 2YHTA 1BIAA 5GMKh 1DJ7B 2B8AA 3QPHA 2DAQA 3RMQA 3UPUA 3DB4A 5GMKl 1VQ4T 4ZN3A 3OYKA 2RHYA 1I81A 2P4TA 3BY7A 3SFMA 5GAMe 3CCUT 3M57A 4KBMB 5CKFA 4M77B 4NL3A 2LX9A 4IUQA 5GAN7 1VUBA 3LGLA 2E65A 1BI1A 2ZGWA 4JRIA 4NL2A 4C92F 1JJ2S 3L2RA 1OI1A 3CCUA 2DXCA 1RL2A 2JNGA 3CPWS 3J7AF 3CBMA 2Y90A 2LRQA 2QEXA 3E19A 3CMAA 2DXBA 4OB3B 3VJPA 3OBWA 4C5GA 3OYBA 1PSFA 4M75C 3CC2A 2E10A 5GAN6 4C8QG 3L2QA 1M1GA 2ZZDA 3X26B 4BY6B 1VQ7T 3N5BB 4N0AC 4RCCA 4E47A 3OQ5A 2XDDA 4PNOA 5GAMf 1VQ8A 2EIFA 1NPRA 3FDRA 3MEAA 4C0DC 2E6NA 2L5QA 2VGNA 1Q82U 4C8QA 1FX7A 2QQ9A 2DD4A 3PMIA 4JLGA 2VXEA 5CR2A 3JB9G 4MZPA 4M7AE 2GFUA 4M7DF 2RI3A 2LT1A 3PT9A 2RI5A 1O75A 1KQ1A 5FROA 3CCSA 3JB9J 3P8HA 4MDXA 4BI4A 3BDUA 3VYGA 1M9SA 5GAMg 5GAOm 4EMKA 3I56A 4J7IA 4M75E 4A4KA 1QP2A 1YHQA 5CCAA 3PIOA 3HRUA 3RUXA 3CCST 2P0QA 4D6WA 3JCMf 2O01E 5GMKj 2E1HA 4M77C 2DTHA 2AHJB 3I56T 3CC4A 3OS2A 1BIBA 1YHQT 2PUKB 1Q82C 4Y28E 5HK0A 1JB0E 1MHNA 1BI0A 3GNFB 5LJ5g 3QUIA 1N8RC 4HT8A 2LTOA 1LNXA 2RB6A 3OYHA 3CC4T 4C5IA 4N0AA 3JCMd 1WQWA 3HSBA 5GAN2 4O5VA 4E7LA 4PLLA 1JRIA 4A4HA 5LJ5d
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KHC A;  2RO0 A;  4GY5 A;  3OYG A;  4QQG A;  3ASK A;  3PNW C;  4N4G A;  2GF7 A;  2RJE A;  3MP1 A;  2CKK A;  3OYJ A;  2YRV A;  3LGF A;  2NLU A;  4FU6 A;  4PL6 A;  3LX7 A;  2R5A A;  3E9G A;  4B9X A;  2X4W A;  4IUU A;  3GOX A;  2M16 A;  3L42 A;  4UC4 A;  3SD4 A;  4C5E A;  1WJR A;  1RI0 A;  3C4S A;  2MWP A;  2RJD A;  3H8Z A;  4QQD A;  4BD3 A;  3OB9 A;  3BDL A;  2L8D A;  2L89 A;  2K3Y A;  5J26 A;  2EKO A;  1OZ3 A;  3OYA A;  5FRM A;  4BDZ A;  2R58 A;  4HCZ A;  5C0M A;  1SSF A;  2F5K A;  2G3R A;  3QBY A;  5IAY A;  3QKJ A;  3OY9 A;  4B9W A;  3UWN A;  3QJ6 A;  5KE2 A;  3S3N A;  4QVZ A;  3H6Z A;  2DIG A;  4A4G A;  2R5M A;  4NS5 A;  2MWO A;  2VYT A;  2EQK A;  3OMC A;  2K3X A;  3FLG A;  3ME9 A;  3MO8 A;  3P8D A;  1WJS A;  2HQE A;  3DLM A;  4A4F A;  3L2W A;  3DB3 A;  4IKF A;  1G5V A;  1H3Z A;  2BKD N;  3MEU A;  4BE2 A;  5FRN A;  2R57 A;  5D6Y A;  2RJC A;  2XK0 A;  3UT1 A;  4E7K A;  3LYI A;  1WJQ A;  2LCC A;  4BE0 A;  2X35 A;  3Q1J A;  3S3O A;  3OYC A;  1OZ2 A;  5C6S A;  4L59 A;  4RG2 A;  2O4X B;  3L2U A;  3OYM A;  3S3M A;  3F70 A;  2M0O A;  2RHU A;  2B8A A;  2DAQ A;  2EQJ A;  4N4H A;  3DB4 A;  3OYK A;  2RHY A;  2FHD A;  3NTI A;  4X34 A;  2XDP A;  3FC3 A;  4ZTF A;  3OYL A;  3MEW A;  3S6W A;  2JTF A;  4BE1 A;  4IUQ A;  4IUR A;  2E5Q A;  4PLI A;  4E7H A;  3E9F A;  2O4X A;  3LGL A;  4QW2 A;  3L2R A;  1OI1 A;  2D9T A;  3ZEH A;  3OYD A;  3LH0 A;  4IUV A;  3PMT A;  4IUT A;  2EQU A;  2LRQ A;  5D6X A;  3OYB A;  4C5G A;  2WAC A;  3L2Q A;  4ZTJ A;  2HQX A;  2QQS A;  3CEY A;  2X4Y A;  3OQ5 A;  2EQM A;  2X4X A;  3QII A;  4BAC A;  4C5H A;  3OS0 A;  3FDR A;  3MEA A;  2GFA A;  2E6N A;  2RHI A;  3MP6 A;  4A4E A;  3OYN A;  4BDY A;  4EDU A;  5CIU A;  5KCO A;  5KCH A;  3OYI A;  3PMI A;  3M9Q A;  3MEV A;  2GFU A;  3PFS A;  5D6W A;  3OYE A;  2RI3 A;  2L3R A;  2JZ2 A;  4LD6 A;  2RI5 A;  5FRO A;  3FEO A;  2DIQ A;  3P8H A;  3OA6 A;  3OMG A;  4E7I A;  2M1H A;  4QQ6 A;  1WGS A;  3OYF A;  2LDM A;  4CRI A;  5M9O A;  4OVA A;  3KUF A;  4E7J A;  3MET A;  2P0K A;  1N27 A;  1XNI A;  5J39 A;  3L2V A;  2QQR A;  3LLR A;  5KH6 A;  2IG0 A;  3OS2 A;  3NTK A;  4II1 A;  2BUD A;  2EFI A;  3O8V A;  1MHN A;  5IN1 A;  2LTO A;  1OYX A;  3EAE A;  2PQW A;  4IUP A;  4N4I A;  4FL6 A;  4Z02 A;  3OYH A;  2RHX A;  4C5I A;  4Q5W A;  3NTH A;  5KE3 A;  3OS1 A;  2RHZ A;  2BIV A;  2RI2 A;  2RJF A;  4E7L A;  4PLL A;  3MP8 A;  2LVM A;  4A4H A; 
#chains in the Genus database with same CATH topology
 1KHC A;  4PJM A;  2QDY B;  3I35 A;  3EGX B;  2ENM A;  1T0J A;  2E70 A;  4J5Y A;  2JN0 A;  3FB9 A;  1YCY A;  4A63 B;  2CP2 A;  4FM4 B;  1YJW A;  2JVV A;  2DZC A;  3CBO A;  1ZA2 B;  2ZPF B;  4OB1 B;  4M77 E;  2FEI A;  2ZCF B;  1VQK Q;  1K9M U;  4LDV A;  4C92 B;  3MHX A;  5LJ3 h;  3V8L A;  5LJ3 g;  3CPW P;  1OZ3 A;  2J7I A;  4Z88 A;  2G3R A;  3I5S A;  4ORZ A;  5KE2 A;  3QJ6 A;  3JCM V;  1VQP A;  1VQN Q;  4F7U E;  1ACM B;  3REA B;  1KQ2 A;  1OU8 A;  4BUG A;  3DLM A;  2DTO A;  4PJJ A;  3EG1 A;  1VQ6 T;  2F1L A;  1UEC A;  4JLI A;  1NBE B;  4M78 D;  4RG2 A;  2AKL A;  2RHU A;  2DF6 A;  1QKX A;  4J9G A;  1VQ7 A;  3NHN A;  2JTF A;  4L6V 5;  4BE1 A;  1WHM A;  8ATC B;  2YLB A;  4E7H A;  1TWB A;  1OX9 A;  3LH0 A;  2DM1 A;  3QDR B;  5EG2 A;  2LNH B;  3M56 A;  1Q95 G;  2X4Y A;  2D0Q B;  3RIR A;  2EYZ A;  1TUD A;  1VA7 A;  1M5Q 1;  1ZQ1 A;  4ZGJ B;  1UGS B;  4M77 D;  5CQX A;  2GQV A;  4XAX B;  2CP7 A;  4JS4 A;  1QVF A;  2WSF E;  3RNJ A;  5HY6 A;  3QYH B;  4C8Q F;  3SDZ A;  3CCQ A;  4E6R A;  3BE3 A;  2F2X A;  4KUD K;  4M7A D;  2JMC A;  3CCQ T;  2P0K A;  2QYZ A;  2QQR A;  2IG0 A;  2DL4 A;  2K3B A;  1X2K A;  1I5L A;  3VV0 A;  1B34 A;  1KJW A;  4XTX A;  2VVK A;  2MMP A;  1HYO A;  1R0B G;  2RJF A;  3CPW A;  2DVE A;  1AHJ B;  1QVF P;  2IPO B;  2CSI A;  4OGC A;  4MMK A;  3G71 Q;  5CKH A;  3SWN C;  3SD4 A;  5GAO p;  4M7D E;  3LWI A;  5C0M A;  2LQN A;  4QVC A;  5CO7 A;  1V76 A;  3VS5 A;  1HXD A;  1WJS A;  5FRN A;  5D6Y A;  3VKI A;  2VGM A;  5GAN j;  3A98 A;  4M75 F;  1QP3 A;  1JQQ A;  1Y96 A;  3REB B;  3A8O B;  3EGX A;  4FT2 A;  4IUR A;  3GBQ A;  4PJO G;  1YP5 A;  3G71 A;  5L8R E;  1BYM A;  1VQO A;  1FMV A;  5IH2 A;  2ZPG B;  2D1X A;  2K5F A;  2E3I A;  3OSV A;  1UGP B;  2DYI A;  2KMT A;  2J6O A;  2EQM A;  2ABL A;  2YRC A;  3GLX A;  2COZ A;  4Y92 A;  4C5H A;  2RHI A;  2KSS A;  1PSE A;  2LX7 A;  4FYV B;  1XOV A;  1S72 T;  2L3R A;  4GLK A;  2QG9 B;  3TEE A;  1RAD B;  4JDS A;  4PKC C;  5I2S A;  4GBQ A;  4RG8 A;  3CPF A;  3NGP A;  4X1V A;  3CCQ Q;  4J6W A;  5M9O A;  2HAX A;  5CQY A;  3A8H B;  1X2Q A;  2XIC A;  5J39 A;  3L2V A;  1M2V B;  2DMO A;  2BZX A;  1SHG A;  2BUD A;  2CGH A;  4II1 A;  1QVG P;  1N8R R;  4PJO C;  5LL6 S;  1E7O A;  4ME7 A;  2CZ1 B;  1BKB A;  1HSQ A;  5KYY A;  2ROT A;  2RI2 A;  2L0A A;  1YN8 A;  2E64 A;  3V7C A;  1TOV A;  2DL8 A;  1VQ5 Q;  4OMM A;  1XQH A;  2P84 A;  4KGV B;  2HMA A;  3QWY A;  4C92 A;  1GFC A;  4OF1 A;  1MNE A;  2LZ6 B;  3HPW A;  3JSC A;  3AHU A;  1MMG A;  1WJR A;  4JRK A;  3I55 T;  4HKE A;  4QQD A;  5HK3 A;  2MCN A;  4RTT A;  5KYW A;  3JRZ A;  5GAO r;  2KYB A;  1JXO A;  1ZUY A;  5LJ3 j;  2OTJ A;  3EFO A;  2KAF A;  3DB3 A;  1IHV A;  1VQ6 Q;  1VQN A;  2DRM A;  1RAC B;  2PZ1 A;  1I5O B;  3SHW A;  3HRS A;  4TVR A;  4J83 A;  2L3P A;  3OYM A;  3F70 A;  3BFM A;  1D0Z A;  4N4H A;  3TVT A;  3NTI A;  2OTL T;  1YBY A;  1V1C A;  3MEW A;  1K9M C;  1K9M R;  4F17 A;  4HVW A;  1AEY A;  2J05 A;  1ZBJ A;  1D3B A;  3C0C A;  2V1R A;  1VQP Q;  4MZT A;  1I4K 1;  1AVZ C;  2QTX A;  2DO3 A;  1TXQ A;  4DBH A;  3OW2 P;  1B07 A;  2DA9 A;  1K8A U;  3OS0 A;  4M7A B;  1VQK A;  2H3J A;  2AIR B;  3CC4 Q;  4JS5 A;  3CD6 A;  4EDU A;  5IHN A;  5IHK A;  3VS2 A;  4AG2 C;  4PJO D;  3OA6 A;  5ECA A;  2Y4X A;  4OVA A;  2M9U A;  3X20 B;  1WI7 A;  4JZ3 A;  4P5N A;  1ZUU A;  1K1Z A;  1MV0 B;  1R77 A;  5DY9 A;  4XTY A;  5GAN h;  2YUO A;  4M78 E;  2X9H A;  2PQW A;  3CCL T;  4EMG A;  1W1F A;  4RTY A;  3IQL A;  2CZ0 B;  4QVD A;  3OS1 A;  3GIB A;  3MCA B;  4M77 F;  3M54 A;  2X3X D;  3PGG A;  5FW9 A;  2YRV A;  2ESW A;  2K5I A;  1WXT A;  4X9D A;  1ZSZ A;  5J26 A;  3V7S A;  3M4G A;  2WSC E;  3INZ A;  2RH2 A;  2MF2 A;  3JCM X;  4A4G A;  5GAN e;  2MI6 A;  2QEX Q;  3CMA Q;  1PWT A;  3OMC A;  3MO8 A;  4LDW A;  4KH0 B;  1RAF B;  1PHT A;  3CXC S;  4LE9 A;  4ATO A;  5GMK h;  2B8A A;  5KYY B;  2EBP A;  4EIK A;  4RTW A;  3BY7 A;  5GAM e;  4LUD A;  4M77 B;  2LX9 A;  1OUL A;  1VUB A;  1BI1 A;  2ZGW A;  4JRI A;  4NL2 A;  3L2R A;  1OI1 A;  3M0T A;  2A0F B;  1BK2 A;  2DXB A;  4OB3 B;  3VJP A;  4C5G A;  2E10 A;  2VB6 A;  4HVU A;  3ULR B;  3M0R A;  2PNI A;  4BY6 B;  1BCM A;  2AK5 A;  3TSW A;  1NEG A;  1YIT Q;  1VYU A;  5GAM f;  1NPR A;  1FMK A;  2E6N A;  2VGN A;  1FX7 A;  4PJL A;  2VXE A;  4M7A E;  2RI3 A;  2LT1 A;  2RMO A;  2RI5 A;  3CCS A;  2DER A;  5FRO A;  3VYG A;  1SHF A;  1M9S A;  1YNZ A;  4EMK A;  2HSP A;  2E5K A;  4A4K A;  3HRU A;  3RUX A;  3CCS T;  1SG5 A;  3UAT A;  2O01 E;  4D8D A;  2NUP B;  2AHJ B;  3OS2 A;  1BIB A;  3PE0 A;  1JB0 E;  5LJ5 g;  2LTO A;  1X6G A;  4N0A A;  1MUZ A;  3HSB A;  3VS3 A;  4J6Y A;  1JU5 C;  1Y07 A;  1KQS A;  5FU6 C;  2RM4 A;  1H92 A;  2D0N A;  1NG2 A;  2L3Q A;  2QA4 T;  1UGQ B;  4OB2 B;  3R6N A;  2G6F X;  4M78 A;  2YUP A;  4KGZ B;  1WIE A;  2M02 A;  1IRE B;  4Z89 A;  3OYA A;  2RD1 A;  2V8J A;  2DVJ A;  4EMH A;  1VQ6 A;  2KE9 A;  2KY9 A;  2MWO A;  2VYT A;  1YJW Q;  1VYT A;  2K3X A;  2V8K A;  1KSW A;  5GJV B;  4LXC A;  2MPX C;  4L5G A;  1NZ9 A;  1SRM A;  5FLX E;  1MMN A;  4BI3 A;  1QCN A;  3M4Y A;  3R6O A;  5I11 A;  3EGU A;  2OJ2 A;  2CP0 A;  2KVQ G;  3JCM b;  2EJF A;  2KQW A;  1BCO A;  3E9F A;  3GPL A;  1N9R A;  3HFN A;  2JUF A;  4M77 G;  1XJW B;  1WLP B;  1SPK A;  1W6X A;  1WQ7 A;  2WAC A;  1H64 1;  2HQX A;  1B7T A;  2LNV A;  1MND A;  2EJ9 A;  1TUC A;  3OYY A;  3H41 A;  3JCM P;  2DBM A;  4A4E A;  4MML A;  5KCO A;  2IVW A;  4ZGD B;  1YIT A;  1M90 U;  3A8G B;  4R56 A;  1M4Z A;  4DOW A;  2FO0 A;  3QYG B;  3G1J A;  2LDM A;  1NLP C;  3EH1 A;  4ZNX A;  1ZSZ C;  3HP9 A;  1H3H A;  4C0Z A;  2X3W D;  1IGQ A;  3X25 B;  3CCV A;  1C6V X;  2V8I A;  1OU9 A;  1SF9 A;  3CME Q;  1U06 A;  2KT8 A;  2LMJ A;  1KD1 R;  1QLY A;  1UGV A;  4C92 E;  4ELY C;  3HRT A;  3QHS A;  1B3Q A;  3LGF A;  1VQP T;  3SB2 A;  1I1J A;  2FPF A;  1KD1 C;  5LJ5 e;  1RI0 A;  5A0G A;  2R58 A;  4AG1 C;  5FU7 C;  1YI2 A;  1FYN A;  2DIG A;  4XQ3 A;  3RKY A;  2EQK A;  1X75 C;  3NFC A;  3FLG A;  2JM9 A;  3RBB B;  3CCR A;  3QDF A;  1JO8 A;  4IKF A;  1K76 A;  3MEU A;  1YI2 Q;  4ANJ A;  3G7Z A;  4E2F B;  1YIJ A;  1Y7X A;  5IXF A;  2ECZ A;  4CC7 A;  3S3M A;  1G83 A;  2CS7 A;  4J9F A;  3G71 T;  3C94 A;  2XDP A;  1YIJ T;  1RLP C;  2O88 A;  2DJZ A;  3M0U A;  4RTX A;  4F04 B;  4PLI A;  1M2O A;  1IZ6 A;  3G4S A;  2K7A A;  3ZEH A;  5CKB A;  1ARK A;  1M1K R;  4FSX A;  2KR3 A;  3CME A;  1BU1 A;  4LDY A;  4ZGE B;  1VQ5 T;  1VQ4 Q;  3UDC A;  3V8J A;  4EMK B;  1H8K A;  2F5T X;  2RF0 A;  3VYH B;  1VQ9 A;  1WPY A;  1PC0 A;  2MIO A;  1J3T A;  1GXI E;  2RPN A;  2RA2 A;  1QVG A;  3RKW A;  3CXC P;  1Q82 R;  1T0H A;  1M3B A;  2RHZ A;  3MP8 A;  2DXT A;  3VRY A;  1FMW A;  4GY5 A;  2EYX A;  1OPK A;  3ASK A;  2GF7 A;  3MP1 A;  3JCM Q;  1YI2 T;  4HXJ A;  3O5Z A;  4DQ2 A;  1NYG A;  5EC7 A;  1Y71 A;  3ZBD A;  3C12 A;  4XU1 A;  4V2S A;  3VS6 A;  1WNL A;  4BD3 A;  1X6B A;  2V1Q A;  2PUO B;  1G3Y A;  4OP0 A;  4HCK A;  3FJP A;  4HVV A;  2QI2 A;  3I55 A;  4ZN1 A;  2AZV A;  5LJ5 h;  3EG0 A;  4FW1 A;  4M7A C;  2FVU A;  1H3Z A;  3QZ5 B;  3J81 E;  1RUW A;  2DX1 A;  3AT1 B;  5GAM d;  3PIP A;  2A7Y A;  2QDL A;  1W2B P;  1QVP A;  2DL7 A;  1YJ9 A;  2KRS A;  1D1C A;  4L59 A;  3VUB A;  3M58 A;  1YJN A;  2O2O A;  3EG9 B;  4M78 F;  3EHQ A;  1YJ9 T;  1AWX A;  1TS9 A;  1M90 C;  2ROL A;  1LPL A;  1FWZ A;  2O4X A;  3FRN A;  4C0D B;  5I21 A;  2DLP A;  4IUT A;  1R0C B;  4BB7 A;  3V8K A;  1VQ9 Q;  2DFU A;  4C8Q E;  1EX4 A;  1TTH B;  1G8X A;  1M1K C;  2H3E B;  3ER0 A;  1BB9 A;  1PNJ A;  2GFA A;  3M9Q A;  4HA8 A;  2OTJ Q;  2EVR A;  2EAY A;  3PFS A;  5D6W A;  2QEX T;  3CMA T;  3FIF A;  3J80 E;  4E7I A;  4RTZ A;  2RK2 A;  5KYW B;  4F7U A;  1ZBX A;  2DL3 A;  2LJ1 A;  2BE9 B;  2CT3 A;  4XTW A;  1OEB A;  2HDA A;  1U1T A;  1VQO Q;  3X28 B;  3M0Q A;  1Y57 A;  4A54 A;  1MMD A;  2ZAE A;  1K0S A;  2ED0 A;  2EJG A;  2A28 A;  4M7D G;  2OAW A;  4M77 A;  4M7D D;  2DEQ A;  1RAE B;  1I8F A;  2AT1 B;  5I2M A;  3T9N A;  3VUZ A;  3QXE B;  1QWE A;  5GAM h;  2EGA A;  3KFV A;  2NLU A;  1QQJ A;  4WTO B;  3MJX A;  5AT1 B;  3SWN B;  2NUP A;  2K57 A;  1M1K U;  1EZZ B;  2JXB A;  2J6K A;  4E7S A;  1UUE A;  4O6J A;  2NUT B;  5LJ5 j;  4J9C A;  3OY9 A;  1D1A A;  2OTL A;  1VQL T;  4PK4 A;  2W0Z A;  5GAN g;  3KXT A;  1IXD A;  1HK9 A;  3CCU Q;  2CYZ B;  1V29 B;  2YSQ A;  4E7K A;  2LCC A;  4BE0 A;  1RLQ C;  5C6S A;  3URG A;  1RAG B;  1E6G A;  2E4H A;  3L2U A;  1BIA A;  1C1A A;  1DJ7 B;  1SSH A;  3QPH A;  2CP3 A;  3UPU A;  4ZN3 A;  2QAZ A;  3EFO B;  4IUQ A;  3LGL A;  2E65 A;  4C92 F;  1VQK T;  2VKN A;  3CPW S;  1HD3 A;  5GJW B;  3E19 A;  3PVL A;  3L2Q A;  3A1P A;  2ZZD A;  3N5B B;  1VQL Q;  4RCC A;  3OQ5 A;  4PNO A;  1VQ8 A;  2M0Y A;  2O31 A;  4CC3 A;  2L5Q A;  4DEY A;  1Q82 U;  4C8Q A;  2BTT A;  2QQ9 A;  3CCR Q;  4JLG A;  2GFU A;  4M7D F;  1O75 A;  4MDX A;  1TUG B;  3BDU A;  1M2V A;  4J7I A;  2RQW A;  1IRX A;  3PIO A;  1T3L A;  4AMC A;  2EGC A;  3JCM f;  3VS0 A;  3CD6 Q;  2K9G A;  2PUK B;  5HK0 A;  3CCE Q;  1MHN A;  1BI0 A;  4GLM A;  1N8R C;  2FZK B;  2RB6 A;  4J9I A;  2CUD A;  4PLL A;  2ZPI B;  1KQS S;  4QQG A;  3PNW C;  3OYJ A;  2Y4Y A;  2QA4 A;  3JCM e;  2HBP A;  4PJO E;  1ABQ A;  2VWF A;  2X4W A;  1SKU B;  3CCV Q;  2MK5 A;  2JS0 A;  1K73 C;  1PD0 A;  2DK3 A;  2L8D A;  2K3Y A;  2HL5 C;  3EHR A;  2VV5 A;  1Z9Z A;  2AKK A;  2VAS A;  2QK0 A;  1UGR B;  2LCS A;  2X4J A;  1VQM Q;  1KG1 A;  4X9C A;  5LJ3 d;  5DLQ E;  4DBR A;  4M75 D;  3QWX X;  4PFP A;  4BE2 A;  3UT1 A;  3EG9 A;  1UJ0 A;  2EGE A;  2EWN A;  2O4X B;  5GAN f;  1GRI A;  3E1S A;  4FYX B;  3LWH A;  2F69 A;  2FHD A;  2CZ7 B;  1UEB A;  2MAM A;  3EGD B;  1VIF A;  3CCR T;  2JM8 A;  2XDB A;  1WHH A;  4JZ4 A;  1M3C A;  4XTZ A;  4MZM A;  5KYX A;  2LJ3 A;  3KBG A;  4JJD A;  3I9Q A;  4JJN K;  1GCQ C;  3GF5 A;  2CDT A;  2C0O A;  1VOM A;  3M59 A;  1TH7 A;  1VQ8 Q;  4F7U B;  2KRM A;  5KCH A;  4Z8A A;  2KYM A;  3I5R A;  3OSS C;  4F14 A;  1G3W A;  2B86 A;  3CC2 Q;  4QQ6 A;  1YIT T;  3CME T;  3DLL A;  2KDS A;  1GBQ A;  3M55 A;  2ED1 A;  1VQ5 A;  3SEM A;  2P0P A;  4R55 A;  1BBZ A;  2K79 A;  2OAU A;  3LLR A;  5GAN 3;  1KC8 R;  2FZC B;  2O9V A;  2P4R A;  2DRK A;  4OB0 B;  1X43 A;  1M3A A;  2K5L A;  4N4I A;  4LDX A;  1WZO A;  3JCM g;  1Y0M A;  1KHI A;  3CCJ Q;  3VU3 C;  2L3S A;  1Q81 U;  1U3O A;  1C0M A;  2RJE A;  2JW4 A;  2FB7 A;  2YRD A;  3EH2 A;  1YCS B;  2FRW A;  4AFZ C;  1LJO A;  2M16 A;  2EYY A;  3C4S A;  2MWP A;  3JB9 D;  3MKD A;  4HCC A;  4M4Z A;  1D09 B;  4AFS C;  1CKB A;  4HCZ A;  3RDV A;  5IAY A;  3QKJ A;  3I56 Q;  4M7A F;  4YTL A;  1NEB A;  1UDL A;  1K8A C;  4NS5 A;  4J7F A;  4B6M A;  4J9D A;  5LJ3 f;  1G5V A;  1X69 A;  2KXC A;  2K2V A;  3LYI A;  4PFZ A;  5GAO n;  2M51 A;  3Q1J A;  3S3O A;  2CP6 A;  1K73 R;  2LCL A;  4C0G A;  3TRE A;  4LUE A;  1OV3 A;  3OYL A;  5IT9 E;  2OTJ T;  1NE8 A;  1AZG B;  1Y96 B;  2DNU A;  3CCM A;  4LN2 A;  2RQU A;  4Y91 A;  4IUV A;  4JJC A;  1EIF A;  3EFS A;  4E7Z A;  1U1S A;  4RUG A;  3H0I A;  2DEU A;  2DET A;  1YJN T;  1WXU A;  1MGQ A;  5KYU B;  2C06 A;  2SEM A;  1ZHI A;  4BDY A;  3MPU B;  1AT1 B;  3OW2 A;  3OYE A;  2CRE A;  2EPD A;  1SRL A;  4M75 G;  3CXC A;  1ABO A;  4PJN A;  2XID A;  1QMC A;  1WX6 A;  2DE0 X;  4BY6 C;  2PTK A;  4E7J A;  1N27 A;  1XNI A;  1SEM A;  1QVG S;  2XD0 A;  1BI3 A;  2KRN A;  3OBY A;  2COY A;  1PKS A;  2EFI A;  2JOY A;  1ZA1 B;  1RAH B;  1X6O A;  2YWW A;  2PVO B;  2JTE A;  2YUQ A;  4KH1 B;  4NOY A;  4N4G A;  2CKK A;  5J3B A;  5CK9 A;  1W2B S;  2HBW A;  3THK A;  3E9G A;  4KT0 E;  4B9X A;  1Q7Y R;  1Q7Y C;  3L2Z A;  1KQS P;  4EPC A;  1ZSG A;  5GAN 8;  3OB9 A;  3RES A;  2I0N A;  1GFD A;  2EKO A;  1WHK A;  5FRM A;  2JS2 A;  3HL8 A;  4MDW A;  1B34 B;  3TSZ A;  2GQI A;  1N8R U;  5KYU A;  4FIB A;  4B9W A;  4M7D C;  4QVZ A;  5LJ5 f;  4F7U G;  4JRQ A;  3G6E T;  2LQ8 A;  3H0F A;  2GBQ A;  1Q86 R;  1GBR A;  1S1N A;  2XK0 A;  1K8A R;  3G4S T;  2FPE A;  5CVI A;  4QKU A;  4WCI A;  2X35 A;  3QSU A;  1VIE A;  3E2U A;  1E6H A;  4BI8 B;  3JB9 I;  1AWO A;  2EKH A;  2A3L A;  5HKC A;  2QXF A;  2XKO C;  1UG1 A;  4J9E A;  3PMT A;  5I22 A;  1S72 A;  4D8K A;  2EQU A;  1JJ2 A;  2JTM A;  4M7A A;  1OX8 A;  2NWM A;  1Q86 U;  5FWC A;  2FL7 A;  2QQA A;  3QII A;  4BAC A;  8AT1 B;  3MP6 A;  1D3B B;  2D8J A;  2LJ0 A;  5DLO A;  3OYI A;  1D0X A;  5GAO l;  2BZ8 A;  3FEO A;  2QA4 Q;  3C95 A;  1N6A A;  2M1H A;  1F1B B;  2HEQ A;  3P8B B;  1G3S A;  1FXX A;  2DYB A;  4CRI A;  4OMF B;  3KUF A;  3MET A;  4EMK C;  3G4S Q;  3CCL A;  2BE7 D;  4XU3 A;  3PTA A;  3CCM Q;  4OGE A;  4C0F A;  5GMK i;  2CH4 A;  2DKG A;  3UA6 A;  3G6E Q;  3RER A;  3EAE A;  2RHX A;  2LVM A;  4RTU A;  4C92 C;  2RO0 A;  2KRO A;  4FT4 A;  3OS5 A;  1UJY A;  2GNC A;  3LW5 E;  2EYQ A;  3HFO A;  4PJO F;  3CCS Q;  4LNP A;  1JBM A;  2VUB A;  1W4S A;  4FU6 A;  2DXU A;  2GGR A;  1NJI C;  9ATC B;  4IUU A;  4UC4 A;  3UF4 A;  1KD1 U;  2ZPB B;  3H8Z A;  1QVF S;  1Z9Q A;  1AD5 A;  4XU0 A;  3EGD A;  2L89 A;  4C8Q B;  4J9B A;  1NPP A;  1VQL A;  1KC8 U;  3LH5 A;  4BDZ A;  3V7R A;  3QBY A;  3A8M B;  3WXM B;  1K4U S;  5GMK m;  3H6Z A;  2R5M A;  1WHJ A;  2HQE A;  2OTL Q;  2NUT A;  4J6X A;  3GP8 A;  1AWJ A;  3RR6 A;  2CT4 A;  3QG1 A;  1RAA B;  4CI0 C;  1YWP A;  4XU2 A;  1MV3 A;  1VYV A;  3CCJ A;  2DAQ A;  3RMQ A;  5GMK l;  3OYK A;  1I81 A;  2P4T A;  3CCU T;  1I07 A;  3M57 A;  2YUN A;  4NL3 A;  1NLO C;  1JJ2 S;  2DIL A;  3CCU A;  2JNG A;  3CBM A;  2Y90 A;  1GCQ A;  2QEX A;  3CMA A;  1CKA A;  3OYB A;  1PRM C;  1PSF A;  4M75 C;  1WYX A;  4C8Q G;  3X26 B;  2XDD A;  1RAI B;  1M30 A;  1PD1 A;  2EIF A;  3FDR A;  4C0D C;  2DD4 A;  3JB9 G;  1NYF A;  3JV3 A;  1MMA A;  5GAM g;  5GAO m;  3I56 A;  1QP2 A;  1YHQ A;  3NMZ C;  5CCA A;  3FJ5 A;  2KBT A;  2KEA A;  4D6W A;  5GMK j;  2E1H A;  1M8M A;  3I56 T;  2SRC A;  2F2W A;  4AFQ C;  2KXD A;  2HCK A;  3GNF B;  4HT8 A;  4K11 A;  1AZE A;  3OYH A;  4C5I A;  3CCL Q;  3JCM d;  4IIO A;  1WQW A;  4FSS A;  4E7L A;  1JRI A;  4A4H A;  5LJ5 d;  1YJW T;  3OYG A;  3JCM h;  1LCK A;  2IIM A;  2X51 A;  5KYN A;  5IXB A;  2C0I A;  3LX7 A;  2R5A A;  3M5A A;  1VQM A;  2YLC A;  2RK1 A;  3GOX A;  4C5E A;  2JJ9 A;  5GAO q;  5LJ3 e;  4OMQ A;  1NJI R;  4JUV A;  1RAB B;  4DBQ A;  1YJ9 Q;  1QCO A;  3CCJ T;  2F2V A;  2H8H A;  3D7S B;  1QKW A;  3UWN A;  2D6F A;  2DTI A;  2FG0 A;  1UHF A;  2LP5 A;  1QCF A;  5DM7 R;  1U5S A;  4A4F A;  2RNA A;  1GL5 A;  2D8H A;  6AT1 B;  2PVD B;  2HKQ B;  1WDX A;  4ESR A;  2FRY A;  2DPP B;  4JRP A;  2EQJ A;  1Q7Y U;  3CC2 T;  4ZTF A;  1M90 R;  3CCE A;  2E5Q A;  1NJI U;  1N9S A;  2D9T A;  2HD0 A;  2I2L A;  3HTR A;  1UHC A;  4F16 A;  4DEX A;  5CKE A;  1LOJ A;  2E3H A;  3BW1 A;  4J8O A;  4R0K A;  3HKS A;  4AFU C;  1ZLM A;  3CCM T;  2X4X A;  1WA7 A;  2LT4 A;  2WSE E;  3EG3 A;  1P92 A;  5FU7 B;  4LD6 A;  3SWN A;  4RMO A;  1WHL A;  2ZPH B;  5FWB A;  2O9S A;  3M53 A;  3OYF A;  1D1B A;  3CBP A;  2BZY A;  2E6Z A;  1M1F A;  3JCM c;  5IHI A;  4OMO A;  1M27 C;  1OYX A;  4Z02 A;  5GAN 5;  4IUP A;  1A0N B;  4FL6 A;  3JAM E;  4JJB A;  5KE3 A;  3CCV T;  5L23 A;  1O9S A;  2VXF A;  2DJQ A;  2K4Y A;  1RI9 A;  1TSF A;  3TCJ A;  3VS4 A;  4HT9 A;  4M78 C;  3UA7 A;  4OML A;  2LQK A;  4XTV A;  2RQR A;  3WVE B;  4M7D A;  1PKT A;  2EQI A;  3BDL A;  3QO3 A;  5CKD A;  1YIJ Q;  2KGT A;  2XI9 A;  2ATC B;  1Q81 C;  1K73 U;  4C92 G;  3S3N A;  2A37 A;  2J6F A;  2V26 A;  4XTU A;  1U8R A;  3CCE T;  3P8D A;  4J9H A;  4KUI A;  3TU4 K;  5GAN 4;  2K6D A;  3JB9 H;  1K9A A;  3JCM J;  1WJQ A;  2DD5 A;  4RKU E;  3VS1 A;  2JT4 A;  1KK7 A;  2M0O A;  4OMN A;  4KUL A;  3ZL7 C;  1IHW A;  3G6E A;  4FW2 A;  1AWW A;  1VQN T;  3HHT B;  4XK8 E;  2CP5 A;  2MYS A;  2OX7 A;  4IIM A;  3QJY A;  1IGU A;  2E41 A;  1UB4 A;  2NUZ A;  4HCB A;  4ZTJ A;  2PVG B;  2QQS A;  5A2Q E;  3CEY A;  1YWO A;  3GNG A;  1KIK A;  3WVD B;  3OYN A;  4KGX B;  5CIU A;  1NM7 A;  5D7U A;  2XMF A;  2HSE B;  4F7U F;  3M0P A;  3OMG A;  1JEG A;  1KC8 C;  1PRL C;  3JB9 F;  4A53 A;  5A0D A;  2GTJ A;  1R8O B;  3RKX A;  1WXB A;  4LD9 K;  3O8V A;  4C8Q D;  2HZY A;  2QQB A;  3NPF A;  4DBF A;  1QWF A;  1YJN Q;  3NTH A;  2BIV A;  4M7D B;  1XTD A;  4VUB A;  2OI3 A;  1AOJ A;  2HL3 A;  3H9N A;  2PU9 B;  3EFR A;  4PL6 A;  1VQ7 Q;  2J06 A;  5FU6 B;  3L42 A;  1K0X A;  2W10 A;  2CSQ A;  3I55 Q;  1Q86 C;  2RJD A;  2XU8 A;  3TQ7 P;  1JXM A;  5KYX B;  2K2M A;  2F5K A;  1X01 A;  4M78 B;  4CC4 B;  4LDU A;  4C92 D;  2BKD N;  2DZ9 A;  2R57 A;  2LC4 A;  2RJC A;  1OPL A;  1VQO T;  1OZ2 A;  1TU0 B;  4PJO B;  4DOV A;  4X34 A;  2CH4 W;  2CZ6 B;  2FYK A;  3S6W A;  1S72 Q;  1OOT A;  1M8V A;  4M7A G;  4QW2 A;  4M75 A;  3OYD A;  1WFW A;  2RN8 A;  2A08 A;  5D6X A;  2NYS A;  1VQ9 T;  4RTV A;  1G2B A;  3CD6 T;  2FPD A;  3L1A A;  7AT1 B;  3A5Z B;  2XHC A;  1BI2 A;  1YFN A;  1W2B A;  3EG2 A;  2E12 A;  4DA4 A;  1ZUK A;  3MEV A;  2HNI A;  2JZ2 A;  5GMK e;  2L2P A;  2DIQ A;  4PFO A;  4C8Q C;  2RQV A;  1WHG A;  1WGS A;  1LVK A;  1GCP A;  3CQT A;  1UE9 A;  1VQ8 T;  2HQH A;  4OMP A;  4FCY A;  5KH6 A;  4JPB W;  1IB8 A;  2XG8 D;  3NTK A;  2GCX A;  2KK4 A;  2GTO A;  3QZ9 B;  5IN1 A;  3RMS A;  4QT7 A;  4Q5W A;  4PJO A;  3A8L B;  5A0L A;  4FYY B;  3FC3 A;  3ZFJ A;  1YHQ Q;  2VC8 A;  2CUB A;  5AYF A;  3PVQ A;  4RCB A;  5GAM j;  3JCM W;  4CC2 A;  1D0Y A;  1JJ2 P;  1X27 A;  2EW3 A;  2KT1 A;  3CC7 A;  4WF2 A;  1SSF A;  3U23 A;  2YDL A;  2ZPE B;  1ZX6 A;  2KNB B;  3DKM A;  1G3T A;  3CC7 T;  5CAI A;  3ME9 A;  1VQM T;  1EFN A;  4ELZ C;  2QGG A;  3L2W A;  3X24 B;  1OQK A;  4M78 G;  3OW2 S;  2EYW A;  2DBK A;  1VQ4 A;  3VS7 A;  4M75 B;  1QW1 A;  1I0C A;  5GAN d;  3OYC A;  2Z0W A;  1UFF A;  2QTV A;  2YHT A;  1VQ4 T;  3DB4 A;  1PCX A;  2RHY A;  2YT6 A;  3SFM A;  1PG5 B;  2LQW A;  2C0T A;  1IO6 A;  4KBM B;  1CSK A;  5CKF A;  2QAS A;  5GAN 7;  2YXY A;  3M0S A;  2HKN A;  2DXC A;  1RL2 A;  3J7A F;  3H0H A;  2LRQ A;  1UTI A;  3OBW A;  4AT1 B;  3CC2 A;  5GAN 6;  4FYW B;  2A36 A;  1M1G A;  2QGF B;  1VQ7 T;  1W70 A;  3CC7 Q;  1N5Z A;  4N0A C;  4E47 A;  2DL5 A;  3MEA A;  1ZSZ B;  1KFZ A;  2KI7 A;  3PMI A;  5CR2 A;  4MZP A;  1TG0 A;  2COW A;  3PT9 A;  1KQ1 A;  5HCK A;  3JB9 J;  3P8H A;  2RQT A;  4BI4 A;  2MOX A;  1PM3 A;  4KRT A;  4M75 E;  1HJD A;  2P0Q A;  3VRZ A;  4M77 C;  2DTH A;  2FZG B;  3CC4 A;  1YHQ T;  2AZS A;  1T3S A;  1Q82 C;  4Y28 E;  3QUI A;  1LNX A;  3CC4 T;  1Q81 R;  5GAN 2;  2JMA A;  4O5V A; 
#chains in the Genus database with same CATH homology
 4J6Y A;  1KHC A;  2ZPI B;  1YJW T;  2QDY B;  1KQS S;  3OYG A;  4QQG A;  3PNW C;  1Y07 A;  1KQS A;  3OYJ A;  2E70 A;  2Y4Y A;  4J5Y A;  5FU6 C;  3JCM h;  2QA4 A;  2RM4 A;  2JN0 A;  3JCM e;  2HBP A;  3FB9 A;  1YCY A;  4PJO E;  3LX7 A;  2R5A A;  4FM4 B;  3M5A A;  1YJW A;  2X4W A;  2YLC A;  2RK1 A;  3GOX A;  2JVV A;  1VQM A;  2DZC A;  3CBO A;  4OB1 B;  2ZPF B;  4C5E A;  2QA4 T;  4M77 E;  1UGQ B;  4OB2 B;  2ZCF B;  1K73 C;  4M78 A;  5GAO q;  4LDV A;  4C92 B;  5LJ3 e;  1K9M U;  2DK3 A;  2L8D A;  2K3Y A;  3MHX A;  1IRE B;  4JUV A;  5LJ3 h;  3V8L A;  5LJ3 g;  1OZ3 A;  2VV5 A;  3OYA A;  2RD1 A;  2V8J A;  2G3R A;  1UGR B;  3CCJ T;  5KE2 A;  3UWN A;  3QJ6 A;  2D6F A;  3JCM V;  1VQP A;  2DTI A;  4EMH A;  1VQ6 A;  2X4J A;  2KY9 A;  4F7U E;  2MWO A;  2VYT A;  1KG1 A;  4X9C A;  5LJ3 d;  1KQ2 A;  2K3X A;  5DLQ E;  5DM7 R;  2V8K A;  4M75 D;  3DLM A;  4A4F A;  4BUG A;  2DTO A;  4L5G A;  1NZ9 A;  4BE2 A;  5FLX E;  1VQ6 T;  3UT1 A;  2PVD B;  4BI3 A;  4JLI A;  3M4Y A;  3R6O A;  4M78 D;  2EWN A;  4RG2 A;  2O4X B;  5GAN f;  3E1S A;  4JRP A;  2DPP B;  2RHU A;  2EQJ A;  1Q7Y U;  3CC2 T;  3LWH A;  2F69 A;  2FHD A;  2CZ7 B;  4ZTF A;  1UEB A;  2KVQ G;  2MAM A;  3JCM b;  1VQ7 A;  3CCE A;  2EJF A;  1VIF A;  2JTF A;  4L6V 5;  3CCR T;  4BE1 A;  2XDB A;  2E5Q A;  2KQW A;  2YLB A;  4E7H A;  3E9F A;  1NJI U;  3GPL A;  1N9S A;  1N9R A;  2D9T A;  2HD0 A;  2I2L A;  2JUF A;  3HFN A;  3LH0 A;  4M77 G;  4XTZ A;  4MZM A;  3QDR B;  5EG2 A;  5CKE A;  1WQ7 A;  1LOJ A;  3M56 A;  2WAC A;  3BW1 A;  1H64 1;  3KBG A;  4J8O A;  3HKS A;  2HQX A;  4JJN K;  2LNV A;  2EJ9 A;  3OYY A;  3CCM T;  2X4Y A;  3RIR A;  2D0Q B;  2X4X A;  3GF5 A;  2LT4 A;  1M5Q 1;  2WSE E;  3M59 A;  1ZQ1 A;  3JCM P;  4A4E A;  1TH7 A;  4MML A;  4ZGJ B;  1UGS B;  4M77 D;  1P92 A;  2GQV A;  5CQX A;  4F7U B;  4XAX B;  5KCH A;  2IVW A;  5FU7 B;  2WSF E;  4ZGD B;  4JS4 A;  5HY6 A;  1YIT A;  1QVF A;  3QYH B;  4C8Q F;  4LD6 A;  3SDZ A;  3CCQ A;  3SWN A;  4RMO A;  1M90 U;  3OSS C;  3A8G B;  1G3W A;  4R56 A;  1M4Z A;  4DOW A;  2ZPH B;  4QQ6 A;  3QYG B;  1YIT T;  3CME T;  3DLL A;  4KUD K;  2KDS A;  3M53 A;  2LDM A;  3M55 A;  3OYF A;  3CCQ T;  1VQ5 A;  4M7A D;  2P0K A;  2P0P A;  3HP9 A;  4R55 A;  3CBP A;  4C0Z A;  2OAU A;  2QQR A;  3LLR A;  5GAN 3;  2E6Z A;  2IG0 A;  1M1F A;  3JCM c;  3X25 B;  3CCV A;  1I5L A;  2V8I A;  4OB0 B;  3VV0 A;  2K5L A;  1B34 A;  1OYX A;  4N4I A;  4Z02 A;  4IUP A;  4XTX A;  4FL6 A;  5GAN 5;  3JAM E;  4LDX A;  3JCM g;  5KE3 A;  2MMP A;  1KHI A;  3CCV T;  2RJF A;  3VU3 C;  4C92 E;  1O9S A;  3CPW A;  2VXF A;  4ELY C;  2DVE A;  3HRT A;  2K4Y A;  1Q81 U;  1AHJ B;  3QHS A;  2RJE A;  4OGC A;  4MMK A;  3LGF A;  2FB7 A;  5CKH A;  3TCJ A;  1VQP T;  3SB2 A;  4HT9 A;  3SWN C;  4M78 C;  1LJO A;  1KD1 C;  2M16 A;  3SD4 A;  5LJ5 e;  2LQK A;  4XTV A;  1RI0 A;  3C4S A;  2MWP A;  5GAO p;  3JB9 D;  3WVE B;  4M7D A;  4M7D E;  3QO3 A;  3BDL A;  3LWI A;  4HCC A;  5CKD A;  5A0G A;  2R58 A;  2XI9 A;  4HCZ A;  5C0M A;  1Q81 C;  5IAY A;  3QKJ A;  5CO7 A;  5FU7 C;  4C92 G;  4QVC A;  3S3N A;  1K73 U;  4M7A F;  4YTL A;  1YI2 A;  2DIG A;  4XQ3 A;  3RKY A;  4NS5 A;  4XTU A;  4J7F A;  1K8A C;  2EQK A;  1HXD A;  1X75 C;  3NFC A;  1U8R A;  3FLG A;  3CCE T;  3P8D A;  1WJS A;  5LJ3 f;  3CCR A;  4IKF A;  4KUI A;  1G5V A;  3TU4 K;  3MEU A;  5GAN 4;  5FRN A;  5D6Y A;  3VKI A;  3JB9 H;  3G7Z A;  2K2V A;  2VGM A;  3JCM J;  3LYI A;  1WJQ A;  2DD5 A;  4RKU E;  5GAO n;  5GAN j;  1YIJ A;  3Q1J A;  3S3O A;  1Y7X A;  4M75 F;  1QP3 A;  1Y96 A;  3S3M A;  2CS7 A;  2M0O A;  3G71 T;  2LCL A;  4KUL A;  3C94 A;  3TRE A;  4C0G A;  2XDP A;  1YIJ T;  3A8O B;  3G6E A;  3OYL A;  5IT9 E;  2OTJ T;  2DJZ A;  1NE8 A;  1Y96 B;  3CCM A;  4FT2 A;  4IUR A;  4PJO G;  4PLI A;  1VQN T;  3G71 A;  3HHT B;  5L8R E;  1IZ6 A;  4Y91 A;  3G4S A;  4XK8 E;  3ZEH A;  1BYM A;  1VQO A;  4IUV A;  5CKB A;  2ZPG B;  3QJY A;  1EIF A;  2E41 A;  3EFS A;  1UB4 A;  2K5F A;  1U1S A;  4FSX A;  3OSV A;  1YJN T;  4HCB A;  1UGP B;  2KMT A;  4ZTJ A;  2PVG B;  2QQS A;  5A2Q E;  3CME A;  3CEY A;  3GNG A;  4LDY A;  4ZGE B;  1VQ5 T;  2EQM A;  1MGQ A;  3GLX A;  4C5H A;  2C06 A;  2RHI A;  2KSS A;  3WVD B;  3UDC A;  1ZHI A;  3OYN A;  1PSE A;  3V8J A;  4BDY A;  5CIU A;  4EMK B;  1XOV A;  1S72 T;  3OW2 A;  3OYE A;  2F5T X;  2L3R A;  4GLK A;  3TEE A;  3VYH B;  4JDS A;  4PKC C;  5I2S A;  1VQ9 A;  1WPY A;  4F7U F;  3OMG A;  4M75 G;  4RG8 A;  3CPF A;  3CXC A;  1KC8 C;  1GXI E;  2XID A;  4J6W A;  2RA2 A;  3JB9 F;  5M9O A;  2HAX A;  4BY6 C;  4E7J A;  5CQY A;  3A8H B;  4A53 A;  1N27 A;  1XNI A;  2XIC A;  3RKW A;  5A0D A;  5J39 A;  3L2V A;  1QVG S;  2XD0 A;  1BI3 A;  1R8O B;  3OBY A;  3RKX A;  4II1 A;  2BUD A;  2CGH A;  4LD9 K;  4PJO C;  2EFI A;  3O8V A;  5LL6 S;  2JOY A;  4C8Q D;  4ME7 A;  2CZ1 B;  2QQB A;  1BKB A;  1X6O A;  3NTH A;  2RHZ A;  2BIV A;  2RI2 A;  2PVO B;  4M7D B;  1XTD A;  3MP8 A;  2E64 A;  3V7C A;  4VUB A;  2DXT A;  4GY5 A;  2PU9 B;  1XQH A;  3EFR A;  4NOY A;  3ASK A;  4N4G A;  2GF7 A;  3MP1 A;  2CKK A;  5J3B A;  3JCM Q;  5CK9 A;  1YI2 T;  1W2B S;  4C92 A;  4DQ2 A;  4PL6 A;  1Y71 A;  3ZBD A;  4OF1 A;  3E9G A;  4KT0 E;  4B9X A;  5FU6 B;  3HPW A;  3C12 A;  3JSC A;  3L2Z A;  3L42 A;  1Q7Y C;  3AHU A;  1WJR A;  1Q86 C;  2RJD A;  4XU1 A;  4V2S A;  4JRK A;  4EPC A;  1WNL A;  4HKE A;  2XU8 A;  4QQD A;  4BD3 A;  3OB9 A;  5GAN 8;  3RES A;  3I55 T;  2EKO A;  2PUO B;  1G3Y A;  5FRM A;  4OP0 A;  5HK3 A;  3HL8 A;  4MDW A;  1B34 B;  2F5K A;  3FJP A;  1N8R U;  1VQK T;  4M7D C;  4FIB A;  4B9W A;  1X01 A;  2QI2 A;  4M78 B;  3I55 A;  4QVZ A;  3JRZ A;  4ZN1 A;  5GAO r;  5LJ5 f;  5LJ5 h;  5LJ3 j;  4LDU A;  4F7U G;  4M7A C;  4JRQ A;  3G6E T;  2LQ8 A;  2FVU A;  2OTJ A;  2KAF A;  1H3Z A;  3DB3 A;  3QZ5 B;  3J81 E;  4C92 D;  2BKD N;  2DZ9 A;  2R57 A;  1VQN A;  2LC4 A;  2RJC A;  2XK0 A;  5GAM d;  3G4S T;  5CVI A;  3PIP A;  2A7Y A;  1VQO T;  3QSU A;  2X35 A;  1QVP A;  1YJ9 A;  1OZ2 A;  3HRS A;  4TVR A;  4J83 A;  4L59 A;  1VIE A;  3VUB A;  3OYM A;  3F70 A;  3M58 A;  3BFM A;  4N4H A;  4BI8 B;  1YJN A;  4PJO B;  4M78 F;  4DOV A;  3NTI A;  4X34 A;  2OTL T;  3JB9 I;  2CZ6 B;  1YJ9 T;  1YBY A;  2FYK A;  1M90 C;  3MEW A;  2A3L A;  3S6W A;  1K9M C;  5HKC A;  1M8V A;  1FWZ A;  4M7A G;  2O4X A;  2QXF A;  3FRN A;  4QW2 A;  2XKO C;  4M75 A;  3OYD A;  4C0D B;  5I21 A;  3PMT A;  1S72 A;  4IUT A;  2EQU A;  5D6X A;  4BB7 A;  1JJ2 A;  3V8K A;  1D3B A;  2JTM A;  4MZT A;  1VQ9 T;  1I4K 1;  4M7A A;  2QTX A;  4C8Q E;  3CD6 T;  3L1A A;  2DO3 A;  1Q86 U;  5KCO A;  1BI2 A;  2XHC A;  3A5Z B;  1W2B A;  2FL7 A;  3ER0 A;  2QQA A;  3QII A;  1K8A U;  4BAC A;  1M1K C;  3OS0 A;  4M7A B;  2GFA A;  1VQK A;  2H3J A;  1D3B B;  3MP6 A;  4JS5 A;  2E12 A;  4DA4 A;  4EDU A;  3CD6 A;  5DLO A;  3OYI A;  3M9Q A;  4HA8 A;  2EAY A;  3MEV A;  3PFS A;  5D6W A;  2HNI A;  5GAO l;  2QEX T;  2JZ2 A;  3FIF A;  3CMA T;  4PJO D;  5GMK e;  3J80 E;  3FEO A;  2DIQ A;  3OA6 A;  4C8Q C;  3C95 A;  4E7I A;  1N6A A;  2M1H A;  2RK2 A;  1WGS A;  2Y4X A;  3P8B B;  4F7U A;  1G3S A;  1ZBX A;  1FXX A;  4CRI A;  2M9U A;  4OVA A;  4OMF B;  3KUF A;  4XTW A;  3X20 B;  1U1T A;  3MET A;  4P5N A;  3X28 B;  1VQ8 T;  1QVG A;  4EMK C;  4A54 A;  3CCL A;  4XU3 A;  5KH6 A;  2XG8 D;  3PTA A;  3NTK A;  2GCX A;  5DY9 A;  2KK4 A;  4XTY A;  5GAN h;  4OGE A;  4C0F A;  5GMK i;  2EJG A;  4M78 E;  4M7D G;  2DKG A;  3RER A;  3QZ9 B;  4M77 A;  5IN1 A;  3RMS A;  3EAE A;  2DEQ A;  2PQW A;  4M7D D;  3CCL T;  4EMG A;  2RHX A;  1I8F A;  4Q5W A;  4QVD A;  2CZ0 B;  3OS1 A;  4PJO A;  5I2M A;  3A8L B;  3T9N A;  3GIB A;  3MCA B;  5A0L A;  2LVM A;  3FC3 A;  3ZFJ A;  4M77 F;  4C92 C;  2RO0 A;  3M54 A;  2VC8 A;  4FT4 A;  3VUZ A;  3QXE B;  3OS5 A;  5GAM h;  3PGG A;  3LW5 E;  2EYQ A;  3HFO A;  5AYF A;  4PJO F;  2YRV A;  2NLU A;  1JBM A;  2VUB A;  1W4S A;  4FU6 A;  2DXU A;  2K5I A;  4RCB A;  5GAM j;  3JCM W;  1NJI C;  4IUU A;  4UC4 A;  1KD1 U;  4X9D A;  3SWN B;  2K57 A;  1M1K U;  2ZPB B;  3H8Z A;  1QVF S;  4XU0 A;  5J26 A;  2L89 A;  3V7S A;  4C8Q B;  3M4G A;  1NPP A;  1VQL A;  2WSC E;  3CC7 A;  4BDZ A;  1KC8 U;  3INZ A;  3V7R A;  4WF2 A;  2RH2 A;  2MF2 A;  4O6J A;  1SSF A;  3QBY A;  2ZPE B;  5LJ5 j;  3OY9 A;  3A8M B;  3WXM B;  5GMK m;  3H6Z A;  3JCM X;  4A4G A;  5GAN e;  2MI6 A;  2R5M A;  3DKM A;  1VQL T;  1G3T A;  3OMC A;  2OTL A;  5CAI A;  3CC7 T;  5GAN g;  3ME9 A;  3KXT A;  3MO8 A;  1VQM T;  4ELZ C;  2HQE A;  3L2W A;  3X24 B;  4LDW A;  4M78 G;  1HK9 A;  3OW2 S;  4J6X A;  2CYZ B;  3GP8 A;  1V29 B;  1VQ4 A;  4E7K A;  4M75 B;  3QG1 A;  1QW1 A;  4CI0 C;  3CXC S;  2LCC A;  4BE0 A;  4XU2 A;  5GAN d;  3OYC A;  5C6S A;  3URG A;  4ATO A;  3L2U A;  3CCJ A;  2YHT A;  1BIA A;  5GMK h;  1DJ7 B;  2B8A A;  3QPH A;  2DAQ A;  3RMQ A;  3UPU A;  3DB4 A;  5GMK l;  1VQ4 T;  4ZN3 A;  3OYK A;  2RHY A;  1I81 A;  2P4T A;  3BY7 A;  3SFM A;  5GAM e;  3CCU T;  3M57 A;  4KBM B;  5CKF A;  4M77 B;  4NL3 A;  2LX9 A;  4IUQ A;  5GAN 7;  1VUB A;  3LGL A;  2E65 A;  1BI1 A;  2ZGW A;  4JRI A;  4NL2 A;  4C92 F;  1JJ2 S;  3L2R A;  1OI1 A;  3CCU A;  2DXC A;  1RL2 A;  2JNG A;  3CPW S;  3J7A F;  3CBM A;  2Y90 A;  2LRQ A;  2QEX A;  3E19 A;  3CMA A;  2DXB A;  4OB3 B;  3VJP A;  3OBW A;  4C5G A;  3OYB A;  1PSF A;  4M75 C;  3CC2 A;  2E10 A;  5GAN 6;  4C8Q G;  3L2Q A;  1M1G A;  2ZZD A;  3X26 B;  4BY6 B;  1VQ7 T;  3N5B B;  4N0A C;  4RCC A;  4E47 A;  3OQ5 A;  2XDD A;  4PNO A;  5GAM f;  1VQ8 A;  2EIF A;  1NPR A;  3FDR A;  3MEA A;  4C0D C;  2E6N A;  2L5Q A;  2VGN A;  1Q82 U;  4C8Q A;  1FX7 A;  2QQ9 A;  2DD4 A;  3PMI A;  4JLG A;  2VXE A;  5CR2 A;  3JB9 G;  4MZP A;  4M7A E;  2GFU A;  4M7D F;  2RI3 A;  2LT1 A;  3PT9 A;  2RI5 A;  1O75 A;  1KQ1 A;  5FRO A;  3CCS A;  3JB9 J;  3P8H A;  4MDX A;  4BI4 A;  3BDU A;  3VYG A;  1M9S A;  5GAM g;  5GAO m;  4EMK A;  3I56 A;  4J7I A;  4M75 E;  4A4K A;  1QP2 A;  1YHQ A;  5CCA A;  3PIO A;  3HRU A;  3RUX A;  3CCS T;  2P0Q A;  4D6W A;  3JCM f;  2O01 E;  5GMK j;  2E1H A;  4M77 C;  2DTH A;  2AHJ B;  3I56 T;  3CC4 A;  3OS2 A;  1BIB A;  1YHQ T;  2PUK B;  1Q82 C;  4Y28 E;  5HK0 A;  1JB0 E;  1MHN A;  1BI0 A;  3GNF B;  5LJ5 g;  3QUI A;  1N8R C;  4HT8 A;  2LTO A;  1LNX A;  2RB6 A;  3OYH A;  3CC4 T;  4C5I A;  4N0A A;  3JCM d;  1WQW A;  3HSB A;  5GAN 2;  4O5V A;  4E7L A;  4PLL A;  1JRI A;  4A4H A;  5LJ5 d; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...