2PQWA

Crystal structure of l3mbtl1 in complex with h4k20me2 (residues 17-25), trigonal form
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
315
structure length
315
Chain Sequence
WSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein
publication title L3MBTL1 recognition of mono- and dimethylated histones.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 78
structure length 315
sequence length 315
ec nomenclature
pdb deposition date 2007-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2pqwA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2pqwA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2pqwA03
5FROA 3CEYA 3LX7A 4BDZA 3OYAA 2QQSA 2RHIA 4N4GA 1OZ2A 2R5AA 1MHNA 5J39A 2GFUA 3Q1JA 2G3RA 3GOXA 2VYTA 1WJQA 3KUFA 1WGSA 2EFIA 3OYHA 2L8DA 3L2RA 2X35A 4II1A 3ME9A 3NTHA 2M0OA 5C0MA 3OYBA 1KHCA 2RHXA 3QBYA 4E7IA 3NTIA 3S6WA 3L2WA 1OI1A 3BDLA 5D6WA 3OYMA 5D6XA 5J26A 2R58A 2LDMA 2DIQA 2DAQA 4A4GA 4FU6A 3MP6A 2X4YA 4B9XA 2LRQA 4BE2A 2XDPA 4N4HA 3S3OA 3MEWA 5IAYA 4A4HA 3S3NA 3OS1A 3LGFA 4PLIA 4PLLA 4QQDA 4E7LA 4FL6A 1N27A 1H3ZA 2DIGA 2RHZA 2HQEA 2RI2A 3LH0A 3NTKA 3QKJA 4QVZA 2M1HA 2BKDN 4QQ6A 4RG2A 3OYEA 3OYLA 4E7JA 2RI5A 3L2UA 2RI3A 4IUVA 5KCHA 5KCOA 4E7HA 2CKKA 2GFAA 2RHUA 3DLMA 4LD6A 3P8DA 3LGLA 2LCCA 2RO0A 3MEVA 1RI0A 2MWOA 4IUPA 3OB9A 1WJRA 4N4IA 4CRIA 3OYIA 5CIUA 4A4FA 3OS2A 3H8ZA 5C6SA 3ZEHA 5FRMA 2YRVA 4B9WA 2BUDA 4IUQA 2EQKA 2XK0A 4GY5A 3OYKA 4C5GA 3PFSA 2HQXA 2RJFA 3OMCA 2BIVA 3PMIA 3META 4QW2A 3OMGA 5KE3A 1OZ3A 3P8HA 4ZTFA 2GF7A 3UWNA 2RHYA 4HCZA 2O4XA 3LYIA 3E9GA 1XNIA 2JZ2A 3MP8A 4QQGA 3L2QA 3OYNA 2L89A 4C5HA 4BE0A 5KE2A 3FC3A 1SSFA 3LLRA 4C5IA 3DB4A 1OYXA 4IKFA 3MEAA 4Z02A 3OYJA 3S3MA 3C4SA 3L2VA 3MP1A 2WACA 3MO8A 4BD3A 3OYCA 2MWPA 3H6ZA 3OYGA 3OY9A 3OQ5A 2EQJA 4BDYA 1G5VA 2K3YA 3OYDA 2EKOA 3OA6A 2RJDA 4E7KA 2L3RA 4UC4A 3PNWC 3SD4A 2EQUA 2NLUA 3M9QA 3F70A 3MEUA 4A4EA 3OS0A 4BACA 2P0KA 2JTFA 2R57A 2EQMA 4X34A 3L42A 2X4XA 2D9TA 2F5KA 4L59A 2B8AA 2R5MA 2LVMA 3DB3A 3O8VA 2K3XA 3QIIA 4IUUA 2PQWA 3PMTA 3UT1A 5KH6A 4Q5WA 5M9OA 3FDRA 4EDUA 3OYFA 4ZTJA 2E5QA 2M16A 2X4WA 4NS5A 2E6NA 4BE1A 2IG0A 5D6YA 3ASKA 2LTOA 3FLGA 4IUTA 4OVAA 4C5EA 5FRNA 2FHDA 2RJCA 3FEOA 3E9FA 2RJEA 3QJ6A 2O4XB 5IN1A 1WJSA 3EAEA 2QQRA 4PL6A 4IURA
chains in the Genus database with same CATH superfamily
5FROA 2EGEA 4EMKC 1OZ2A 5GAN7 1YHQA 2YXYA 4Z8AA 4C8QC 2FG0A 1YCYA 1WGSA 2J06A 3QHSA 3V8LA 2DJQA 1ABOA 4CC4B 1OPLA 2L3QA 2LJ1A 2P84A 4HKEA 3X28B 3I55Q 1YWOA 2KRMA 4MDWA 1LVKA 3SB2A 4JLGA 3I56A 3CCVA 1S1NA 4M77F 4AT1B 3WXMB 4C0FA 1IO6A 3EFSA 1GCQC 4AFUC 1K9MU 1EX4A 3JAME 1B07A 3INZA 3ZL7C 4RG2A 2M1HA 1ACMB 4Z88A 2L0AA 1RAGB 4Z89A 1YJWT 4IUPA 1V1CA 2RF0A 2EYQA 3OS2A 3CD6A 1BI2A 4DQ2A 3PVQA 5AYFA 2F5TX 3JCMg 2QA4T 3CCMA 4QW2A 2BZYA 1KC8C 1VQOT 3UDCA 4RTZA 2F1LA 4PJNA 4PFPA 3UWNA 1Q81C 3MKDA 2E64A 3JSCA 3MP8A 5KE2A 2ZPIB 5GAN8 4PJOF 2Y90A 2XIDA 3JB9G 3X20B 3HRTA 1YP5A 4AG1C 5LL6S 1GBRA 4DBQA 3H6ZA 3OYGA 4JJDA 1G5VA 1LNXA 5LJ3g 2JN0A 1UHFA 1M90U 4HVWA 2RB6A 3NHNA 2LX9A 1BK2A 4KULA 2NWMA 2ABLA 5HK0A 4J9BA 2JT4A 4KBMB 3FDRA 3M57A 3QSUA 1PC0A 2E3IA 5GANd 5ECAA 4M7DE 2E10A 2IVWA 4RUGA 4J9DA 4J9IA 2DNUA 3CEYA 4BY6B 3PTAA 2RHIA 3CCRQ 4O5VA 1I1JA 2DLPA 1YIJQ 1M2OA 2HAXA 4BI8B 2GTJA 1PRMC 2RD1A 2K5IA 2YUNA 2GQIA 4C92E 1VIFA 2J6FA 2LNVA 4PJOC 2LCSA 1YJNA 1SHGA 2QQBA 4M77B 5KYXB 1ZSZA 5A0LA 2YUPA 4XU0A 2LP5A 3I5RA 4LE9A 1YITQ 1JO8A 4FW2A 4Y91A 2W0ZA 4QVZA 3KBGA 3CMAT 1RL2A 1VQPQ 4IUVA 5GANe 3NPFA 4LD6A 2FB7A 1UGVA 5KYUB 4MMKA 1UHCA 2WSCE 2XICA 1KQSA 4J9EA 1ZBXA 3EG2A 2GTOA 1HK9A 2HSEB 4ZGEB 3I35A 2RQTA 2KXDA 3A98A 1VQNQ 4OMPA 1T0JA 4MZMA 1FMKA 3JCMd 1TS9A 2O4XA 1FWZA 4EPCA 5KYNA 2CP5A 2EJFA 4C5IA 2SRCA 4GLKA 2EPDA 1OULA 2FL7A 4MZPA 3S3MA 2RQWA 3CCQQ 1ZUKA 4M78F 1WDXA 1JU5C 4F7UG 4A4EA 2E70A 1YJWA 2D8HA 5LJ3d 2NUPA 4X34A 3EGDB 3L42A 2DTOA 1D1AA 2HMAA 4F7UA 5I22A 2LZ6B 4JRKA 3T9NA 5IHNA 3PMTA 3M0SA 1K9MR 1WHMA 4JLIA 5FWCA 3C12A 1WHJA 2QA4A 2DBKA 1T3LA 3CCRT 4J5YA 3X26B 1VQOA 1YIJT 3RBBB 3G1JA 3SWNB 1LPLA 2QQRA 4KGVB 2DFUA 2DL4A 4E2FB 2DJZA 4X1VA 2DL8A 2O9VA 4N0AA 1FXXA 2E4HA 1KD1U 3X24B 1C1AA 1VQLQ 4XTUA 1BKBA 2WSFE 4J8OA 2CP6A 5GANj 1YITT 3VS0A 4IIMA 5IXFA 3OYMA 3EGXB 2CDTA 1A0NB 3HPWA 1OU8A 1AZGB 1VQPT 4OGCA 1WQWA 5LJ3e 4FYYB 2LC4A 3VYHB 1ZLMA 1MV0B 1AVZC 1U1TA 2EGCA 4JRPA 1QVFA 2ENMA 2PVOB 4LUDA 2HKNA 2RHZA 2B86A 4OB0B 2CKKA 1VQNT 3CMEQ 3OYIA 2AKKA 3BW1A 1N9SA 2VGNA 1YWPA 1OX9A 1TU0B 1WIEA 2HDAA 1NG2A 4M7DD 1SSHA 3OMCA 3CCUT 3META 1RAFB 3PIOA 4J9FA 3CCQT 1QLYA 3FRNA 3PE0A 2K6DA 2KXCA 4BE0A 4M78B 2A3LA 1D3BA 2BE7D 4C92D 4A54A 2L2PA 2MWPA 4XAXB 1VQ5Q 3CMAA 2PTKA 2EKOA 3PT9A 2L3RA 2DVJA 1RAAB 1YI2Q 1YBYA 5LJ5h 2D9TA 2FYKA 2E3HA 2FVUA 2JMCA 2COWA 4AG2C 2H8HA 2R5MA 1ARKA 2PQWA 3KXTA 2KRNA 3GIBA 4OB1B 2X4WA 4BE1A 2XDBA 5GANh 5GJVB 4IUTA 1V76A 2C0OA 2JOYA 3E9FA 4J9GA 5IN1A 2QG9B 1VQLT 3LX7A 2E12A 5LJ3j 1IGQA 1GRIA 4M77E 2VYTA 1Z9QA 1X6GA 4O6JA 1YNZA 2LQWA 1Y96A 1ZA2B 4HCKA 2JNGA 4TVRA 1IREB 3VS7A 1OI1A 4EMGA 1I81A 1PCXA 2DIQA 5HY6A 2DAQA 2AK5A 1K8AU 3CCRA 1JBMA 2XDPA 2XD0A 1VQ6A 4AFSC 1YIJA 4PLLA 4ATOA 2A36A 2JJ9A 4LDXA 1VQ8T 3QKJA 1U3OA 3TSZA 2BKDN 2RQVA 5KCOA 8AT1B 3OSSC 3DLMA 1JXMA 3ZBDA 2RA2A 2DA9A 1ZQ1A 3RNJA 2CUDA 3J7AF 2VASA 3CC2Q 4RTXA 1TOVA 2EQKA 3OYKA 3HFNA 2HQXA 1YITA 1K9MC 3EFRA 2DK3A 1VQ5T 3C94A 3JCMh 4LN2A 2CT4A 1MNDA 2JZ2A 3R6NA 1KD1R 2ECZA 1HXDA 2KBTA 1AWXA 3CPFA 3H9NA 1UDLA 3OBWA 4M7DA 1O9SA 2GNCA 3OQ5A 4R56A 2NLUA 3E1SA 1QVGS 4BI3A 1VQNA 1SRMA 1UGSB 5LJ3h 4FCYA 1MMGA 2HCKA 1F1BB 1PSEA 2K79A 4JRIA 4M7DC 4M75G 4WTOB 4C92A 3OYFA 4IIOA 2EW3A 2KSSA 3CCUA 4QVCA 3CCQA 5FU7B 2PVGB 5HCKA 4C5EA 2HZYA 2VGMA 5DM7R 2ZPHB 2K5LA 3FB9A 3A8OB 2FRWA 3JCMc 4RTUA 1Q86U 4R0KA 1PHTA 2QQSA 5J39A 4C92C 2VKNA 5L23A 3GBQA 1N5ZA 3NGPA 8ATCB 5CR2A 1U5SA 1S72Q 4F04B 1BCOA 3L2WA 2YDLA 5J26A 1PNJA 2P4TA 3L2ZA 1NLPC 3MEWA 3ZFJA 4YTLA 5A2QE 3RUXA 3CBPA 4QQDA 2FO0A 4FT4A 1N27A 2ATCB 3CC2T 1X69A 4E7JA 1VQLA 5EC7A 5GAOr 2O01E 4OF1A 3QWXX 4DBHA 4PKCC 4ZN3A 2XHCA 2EYXA 3HSBA 1M4ZA 2QXFA 1LOJA 1N6AA 3RIRA 3EFOB 3EHRA 5CQYA 5DLOA 2YWWA 4M78E 4HCBA 3OMGA 5D7UA 1G2BA 2GBQA 4M77D 3L2QA 5GANf 1PD1A 4C5HA 1RAIB 1SSFA 3UATA 2MMPA 1UJ0A 2DXTA 2RM4A 1VQ8A 2OTJQ 2KEAA 3A8HB 4DOVA 1GL5A 2HKQB 4DBRA 5FU6C 4BACA 3PIPA 4RTVA 1K8AR 2DTHA 2BE9B 2B8AA 2LJ3A 1MMDA 3ER0A 3M58A 2J6KA 4ANJA 4OGEA 1KQ2A 4IUUA 3M4GA 1VUBA 1OOTA 3A8GB 4LDUA 3SEMA 4FYXB 2DXCA 2K2VA 1RAHB 1X6BA 1T0HA 1M1FA 4FSXA 3VS6A 1GXIE 1V29B 1VQ7T 2EBPA 1KFZA 4N4GA 1MGQA 3TEEA 2MIOA 2ZGWA 2RN8A 4A53A 1VQ4Q 4PJOD 1PKSA 4C8QG 5I11A 4M7AB 4GBQA 2HSPA 1Q82U 2CREA 3OYHA 2L8DA 3RESA 3A1PA 4J9CA 1GFCA 5L8RE 5CCAA 1WHHA 3V8JA 4PJLA 2OTLQ 4MMLA 1Q7YR 3ULRB 2R58A 2LDMA 2EQIA 3TQ7P 2HEQA 3MP6A 1VQKT 3JCMf 1WI7A 4HVUA 1KD1C 2CH4W 4FYVB 3X25B 1MMNA 3C95A 2LNHB 2QGGA 5KCHA 5CKDA 2M9UA 3CXCS 3QYGB 1RUWA 1GCQA 3MEVA 2MWOA 4E6RA 2HL3A 1VQ9T 1QWEA 1NYGA 2H3JA 4B9WA 5CQXA 5LJ3f 4C5GA 3MHXA 1Q86R 2K4YA 4JS5A 2BIVA 3PMIA 5KE3A 4JS4A 2OTJT 2E5KA 2CT3A 3REBB 1PM3A 3VKIA 4HCZA 1K1ZA 4BUGA 2JS2A 2CZ1B 3TVTA 2CS7A 3MO8A 3EG0A 3CC2A 1GBQA 2LCLA 2FZCB 2JS0A 3PNWC 2EQUA 2JUFA 3MEUA 2JTFA 1I07A 2EQMA 4EMHA 4BY6C 1QVGA 2J05A 4M77A 3J80E 4DA4A 2DO3A 2DTIA 5GMKl 4HA8A 4OMMA 5EG2A 2E6NA 2LT1A 1VQ4T 5FRNA 3JB9F 1QP2A 3TREA 4M77C 2E41A 2KYMA 2OX7A 3JB9H 3EHQA 5GAMg 5CAIA 3THKA 3E19A 2BZXA 2DF6A 5KYUA 2JVVA 1D09B 5LJ5d 3M5AA 4JJNK 3BY7A 3G71Q 2CYZB 5CK9A 4DEXA 2ZPGB 4M78D 4JJBA 2KDSA 5KYWB 2EWNA 2D1XA 4PJOG 2V8JA 1SEMA 2LQ8A 4Y92A 3JCMQ 4OP0A 2HBWA 2I0NA 4ME7A 2XDDA 4PJOA 4OMFB 3I55T 1KHIA 3LGFA 4E7LA 2JTEA 4FL6A 3OYYA 2QTXA 1AZEA 2YSQA 1VQ7A 2VB6A 2QAZA 1PWTA 3CXCP 3EGDA 4XU1A 3OB9A 2P4RA 1E6HA 5CKBA 1G3YA 1K8AC 4IUQA 2XKOC 3EGUA 2KAFA 2KI7A 2QEXQ 5LJ5e 3BE3A 1EZZB 4DOWA 3TU4K 1PSFA 1K0XA 1B34A 1Q82R 1VQKA 2C06A 3DB4A 7AT1B 3CCSQ 4HCCA 1OEBA 2DXUA 4XU2A 2NUZA 2QI2A 4ELZC 3SWNC 3VS2A 2V1QA 2DYIA 2YLBA 4KGZB 2JMAA 2PNIA 2P0KA 3H0HA 3VYGA 2R57A 4OB2B 2AIRB 2F5KA 1VQ9A 3EGXA 2LVMA 4OB3B 5GAOq 4PFZA 4XU3A 1QVPA 1Q7YC 4RTWA 2XMFA 5D6YA 1D0ZA 1R0BG 1PD0A 4M7AE 2OTJA 3G71T 2ESWA 1VQMQ 5I2MA 3OBYA 1M3AA 3M0TA 3L1AA 4OMLA 4A63B 2R5AA 5GAMd 2X3WD 1ZUYA 2ED0A 2I2LA 2PUOB 2X35A 1TXQA 3VU3C 1SHFA 4JZ3A 1N8RR 1X43A 2V8KA 2RHXA 1YN8A 1KSWA 2AZVA 5KYYB 3VJPA 2VXEA 1Q86C 1BI1A 5GAOp 2NUTA 1QP3A 3VS1A 4M78A 1M1KU 5IAYA 3OS1A 5LJ5j 4PJJA 1ZSZB 3LH5A 3JCMe 1M2VA 1I4K1 4E7HA 2IPOB 2YLCA 1RACB 3JCMP 2BZ8A 3OW2P 4M78C 2K3BA 2X51A 5FRMA 3ZEHA 2F2WA 2YRVA 2XU8A 2DILA 1W4SA 4GY5A 3PFSA 4LDYA 5I2SA 1H3HA 2M02A 3CCLQ 1UJYA 1X27A 1ZHIA 4J6XA 1ZA1B 4ELYC 1QMCA 1B3QA 3RERA 3EG9B 1MNEA 3I55A 5CVIA 3JRZA 2K9GA 4F14A 3HFOA 5IH2A 2WACA 3OYCA 1XTDA 4PNOA 3M9QA 3VS5A 3CC7Q 3JCMb 3GPLA 6AT1B 1R0CB 5GAOm 4D8KA 4OMQA 4L59A 1WHLA 2VVKA 3FIFA 3DB3A 3UT1A 1M9SA 4C8QE 2KY9A 1K4US 2GGRA 2M16A 2RJCA 2RJEA 4B6MA 1M8MA 2A0FB 3OA6A 2RK2A 3H0FA 1EIFA 1ZUUA 3CPWP 2M51A 1X2QA 4RG8A 4WCIA 4RCBA 4JPBW 4E7ZA 3A8MB 2QTVA 4FU6A 3FJPA 3H41A 1Q82C 5GAMj 3G71A 1NEBA 1XQHA 2FZKB 5J3BA 2RI2A 3NTKA 3G6EQ 1NBEB 3M0QA 2MOXA 4PK4A 2HL5C 2COZA 2GFAA 2QK0A 3CC4Q 2V26A 4J7FA 3GLXA 1H641 3CCLT 4CI0C 2L3PA 1SF9A 2FPFA 1M1GA 1I5OB 2MPXC 2CUBA 3AT1B 1G83A 4CC7A 1X6OA 3CMET 2DL5A 1OZ3A 3P8HA 4RTYA 4RCCA 1HSQA 1E7OA 1PKTA 1JRIA 3CC7T 1BBZA 1FMVA 1TWBA 3SHWA 2C0TA 3HHTB 2DERA 5FU7C 3CCVQ 3I56Q 2E6ZA 4R55A 1JQQA 4BDYA 3M56A 3M0PA 1N8RC 2AKLA 1N9RA 3QDFA 1TG0A 1M1KR 4KH0B 2K3XA 5M9OA 4M7DG 1VQPA 1QW1A 2CH4A 2LT4A 1YI2T 1HJDA 1Q7YU 4JJCA 2YT6A 2PZ1A 1BYMA 4PL6A 3P8BB 2LMJA 3C0CA 3Q1JA 3CCMQ 4C92G 5GAMh 4LXCA 1WHGA 5IXBA 3GNGA 4M75F 3HRSA 3SFMA 2DD4A 1QKWA 1JB0E 4E7IA 1M5Q1 1G3SA 3QUIA 5GAOl 1VYTA 2CZ0B 2NYSA 3G6ET 3REAB 2DE0X 2XG8D 3QWYA 1Y96B 1UTIA 1QWFA 1J3TA 1Y71A 1R77A 3A5ZB 5A0GA 3GNFB 1JJ2P 2ZAEA 1H3ZA 2DVEA 3OYLA 3M55A 3L2UA 2CP3A 4F17A 4M7AF 1WXTA 3P8DA 2DL7A 2LCCA 1MV3A 1X01A 1WJRA 4A4FA 1NYFA 4C0DB 1E6GA 5IT9E 2HQHA 2BUDA 4FYWB 5HKCA 4QT7A 3EH1A 2KQWA 1KIKA 1NLOC 4LDVA 2YRDA 3LWIA 1FYNA 3CCVT 3JCMJ 3EG1A 3CBMA 2DRKA 4L5GA 1YJNQ 1OYXA 2LQNA 2DM1A 2YHTA 1WQ7A 2RJDA 4RTTA 1QCFA 4HT9A 5LJ5f 1K0SA 5GMKm 2CSIA 1MMAA 2Y4XA 2KRSA 4NL2A 2SEMA 4F7UE 3CCLA 5IHIA 2CP2A 5GAN4 2KGTA 1I5LA 1UUEA 1TTHB 4KGXB 2DL3A 1FMWA 4ZNXA 2DX1A 2E5QA 1YCSB 2F69A 3CCMT 3CMEA 3UA6A 4JDSA 1UB4A 4IURA 3CC7A 4BDZA 3OYAA 1MHNA 3CCEQ 2DMOA 4M75B 1UGPB 1EFNA 3OYBA 2FRYA 1KQSS 2YUOA 3JCMW 2EJGA 3MCAB 3NTIA 1VQ5A 5D6WA 2ZZDA 4QKUA 1UFFA 4L6V5 4D8DA 4LUEA 1YI2A 1S72T 1YJWQ 3G4SQ 3DLLA 4C8QF 3JB9D 2ZPEB 2HQEA 4PFOA 3LH0A 4AMCA 2RNAA 2RI3A 2ZPFB 2QQAA 2QA4Q 4E47A 3CCJQ 1RI0A 1VQOQ 4ZN1A 3VUBA 2BTTA 3AHUA 2DKGA 4MZTA 1HYOA 4X9CA 1M1KC 1AWJA 1YJNT 1BB9A 2MYSA 4KUDK 2DPPB 3TCJA 3G6EA 4ZTFA 1C6VX 2O88A 1RABB 4AFQC 1TUDA 2EIFA 1Q95G 1OPKA 1AEYA 3QYHB 3TSWA 2EQJA 2K3YA 1BIBA 2K5FA 3OYDA 5KYWA 2QYZA 4ORZA 4EIKA 5GAMf 1WPYA 2LQKA 1XJWB 1N8RU 1KJWA 5KH6A 1BIAA 4LD9K 1WHKA 3CCET 2LTOA 5CKHA 4X9DA 1IZ6A 4M4ZA 3DKMA 4M77G 1K73R 2EYWA 5FLXE 1QVFS 1HD3A 2GFUA 1QQJA 3GOXA 1RI9A 3RDVA 3QG1A 5KYXA 2E65A 4II1A 3ME9A 5C0MA 2KT1A 4KUIA 3G4ST 4ZGDB 3HL8A 1KQSP 1RADB 3LW5E 3M0UA 5D6XA 3O5ZA 3M4YA 4FIBA 4EMKB 3CMAQ 1SRLA 2LX7A 4C8QB 2QDYB 4OMNA 2O2OA 4J6YA 3CCJT 2MF2A 3V8KA 2OTLT 4VUBA 5FWBA 1XOVA 1MUZA 1W1FA 1D0XA 5IHKA 2RO0A 1GCPA 1NPPA 2YUQA 4JRQA 3VRYA 2JM8A 1UEBA 4MDXA 1ABQA 4C0GA 1WXBA 2FZGB 1D0YA 3BFMA 1NE8A 2D6FA 2RHYA 3LYIA 1K76A 3E9GA 1WYXA 1S72A 2K7AA 1NJIU 1X75C 3VUZA 1PRLC 3MEAA 1SKUB 3OW2S 4V2SA 3NMZC 2V8IA 2DZCA 2L3SA 3SD4A 3J81E 4LNPA 1G3WA 1VQ6Q 5KYYA 3EH2A 4J7IA 4XTWA 1M3CA 2F2VA 4CC3A 2EJ9A 2ZPBB 3SWNA 2P0PA 2EAYA 1JXOA 3QZ9B 2HD0A 1VA7A 3FLGA 4M75E 2A28A 3CQTA 1IGUA 2ZCFB 2QDLA 4XTXA 2PVDB 2G6FX 3RKWA 1QVFP 4J83A 2G3RA 1RAEB 4XTZA 2ROLA 1W70A 1ZSZC 3NTHA 3SDZA 3UA7A 1KHCA 5GAN2 2RQRA 3VV0A 2ED1A 3QBYA 1VIEA 1Y57A 2VUBA 2FEIA 1WXUA 1UECA 2JXBA 3HP9A 4F7UF 4B9XA 4RMOA 3CCEA 3EG9A 3CPWS 2HBPA 4D6WA 3UF4A 2DIGA 1RLPC 3HTRA 1GFDA 4QQ6A 4PJOB 4CC2A 1WFWA 1WZOA 1VYVA 2RHUA 3CCUQ 3VRZA 2CSQA 1AT1B 4M78G 1WA7A 5GAOn 2DBMA 1TUGB 1Z9ZA 4J6WA 1H8KA 3MJXA 1KQ1A 1TSFA 1KG1A 3G4SA 1AWOA 2DD5A 2KYBA 2KT8A 2VWFA 1WLPB 1VQ4A 4KT0E 5GAN3 3QJYA 3LLRA 2RMOA 1VQ6T 2QEXT 3CCJA 1K73C 1QCOA 2DYBA 2OTLA 2KROA 3JB9J 3CXCA 5CKEA 2A7YA 2PU9B 2EGAA 1B34B 3IQLA 1X2KA 4E7KA 1AD5A 3H0IA 3V7RA 5GAMe 5GMKi 2QGFB 1TUCA 3CCST 2A08A 3O8VA 4BB7A 1OQKA 4Q5WA 3GF5A 3WVEB 2FPEA 1ZBJA 3URGA 2IG0A 4N0AC 2FHDA 1WX6A 4RKUE 4JZ4A 2Y4YA 2O4XB 2COYA 1B7TA 1M90R 3KFVA 1WJQA 2D0QB 3KUFA 1M3BA 1W2BS 2VC8A 2YRCA 1VQMT 1P92A 3NFCA 2L5QA 4J9HA 2NUPB 4QVDA 1NJIR 4F7UB 2JTMA 1VQ8Q 2RPNA 3BDUA 2DEQA 4A4GA 1NZ9A 4N4HA 2DRMA 2RK1A 9ATCB 3S3NA 4A4HA 1NM7A 2ROTA 2NUTB 3HRUA 1KC8U 3JCMX 1JEGA 2RH2A 3JB9I 2RI5A 4HXJA 3VS4A 4ZGJB 1AOJA 1DJ7B 1Q81U 4NL3A 1O75A 3M0RA 4N4IA 1RLQC 2V1RA 5CIUA 1SPKA 5I21A 1M2VB 2XK0A 4M75D 3RR6A 1SG5A 1JJ2S 1G8XA 4FSSA 3V7CA 1Y07A 2JM9A 2PUKB 2DXBA 1IHWA 3PVLA 3EG3A 2D0NA 2J6OA 2L89A 4DEYA 4Z02A 1YJ9Q 3C4SA 1H92A 3OY9A 3OW2A 2CP0A 2OJ2A 2QQ9A 4M7AD 1Y7XA 5AT1B 1YHQQ 5FW9A 2KNBB 4FT2A 2CP7A 1D1CA 2MI6A 4DBFA 4EDUA 1NPRA 4A4KA 1BCMA 2XI9A 3D7SB 5GMKe 4F16A 3QJ6A 1OV3A 2A37A 5GAN6 3FJ5A 1FX7A 2MAMA 2C0IA 2FPDA 2QEXA 2JW4A 1U06A 3N5BB 1D3BB 2P0QA 1ZSGA 2EFIA 3G7ZA 1W2BP 2M0OA 4XQ3A 4M7DF 1U1SA 2EYYA 2EKHA 2MCNA 3CCSA 5GAN5 3BDLA 4PJOE 3CD6Q 2OI3A 4C0DC 2EVRA 2EYZA 3S3OA 4FW1A 4BE2A 5DLQE 1OU9A 4C92F 4PLIA 4AFZC 4Y28E 3LWHA 3CPWA 3EFOA 2IIMA 3RKYA 1AHJB 5HK3A 2KVQG 4PJMA 4KRTA 1K9AA 1CSKA 3GP8A 1VQMA 3QXEB 3JCMV 3H8ZA 5C6SA 2RQUA 2CZ7B 4NOYA 3M59A 1LCKA 1YJ9T 1T3SA 5CO7A 3WVDB 3CC4T 2O9SA 2E1HA 2GF7A 1BI3A 2J7IA 1XNIA 1YFNA 4QQGA 2CZ6B 1QCNA 1M27C 1YHQT 1TH7A 3OYJA 1BI0A 4M75A 3L2VA 4BD3A 3RMSA 1M90C 4C8QD 1K73U 5GMKj 1QKXA 1PG5B 1UG1A 5A0DA 3OS0A 3F70A 2K57A 1UGQB 1LJOA 1G3TA 1ZX6A 4C0ZA 2X3XD 1D1BA 4M75C 3QIIA 1WNLA 1NJIC 3I56T 1VQ7Q 4M7AG 2KR3A 2MK5A 1KC8R 4ZTJA 4LDWA 2DETA 2OAWA 4HVVA 4P5NA 3ASKA 4BI4A 4OVAA 1Q81R 3RKXA 2K2MA 2DEUA 3M53A 4M7AA 3PGGA 4FM4B 2X9HA 2Z0WA 1AWWA 1WJSA 3EAEA 4K11A 3R6OA 3I9QA 2DZ9A 4ESRA 4M7DB 1C0MA 3A8LB 2H3EB 1M30A 3L2RA 4OMOA 3CD6T 2HNIA 1W2BA 4M7AC 1IB8A 1VOMA 1VQKQ 1I0CA 1Y0MA 2LJ0A 4E7SA 3S6WA 2KK4A 4KH1B 3OS5A 1IRXA 4C92B 2X4YA 2LRQA 2VV5A 3QPHA 5CKFA 1NEGA 2AT1B 1UE9A 1UGRB 1VQ9Q 3M54A 5DY9A 3OYEA 3MPUB 3OSVA 2M0YA 1IXDA 3QZ5B 3QO3A 1BU1A 1M8VA 3LGLA 4JUVA 3HKSA 4CRIA 2AZSA 5GMKh 3U23A 2AHJB 1U8RA 3I5SA 2WSEE 1QVGP 2OAUA 2KMTA 2RJFA 3VS3A 4XK8E 2QASA 1JJ2A 1W6XA 1I8FA 1VYUA 2O31A 4HT8A 3OYNA 3FC3A 2D8JA 4IKFA 1CKBA 3MP1A 3QDRB 1KK7A 4XTVA 5LJ5g 1R8OB 4GLMA 1IHVA 4UC4A 2KE9A 4WF2A 4XTYA 3UPUA 2X4XA 2F2XA 4EMKA 2CGHA 5GANg 4C8QA 2X4JA 1OX8A 1YJ9A 4NS5A 3CC4A 2W10A 1CKAA 3RMQA 3E2UA 3V7SA 2GCXA 2GQVA 2VXFA 3FEOA 3CBOA 3JV3A 5FU6B 5GJWB
chains in the Genus database with same CATH topology
5FROA 4EMKC 3RKWA 2QQSA 2RK2A 1OZ2A 5GAN7 1YHQA 5J39A 4J83A 4C92C 1EIFA 2G3RA 4C8QC 1YCYA 4XTZA 1WGSA 3QHSA 3V8LA 5CR2A 3NTHA 3SDZA 1KHCA 5GAN2 3VV0A 4RG8A 4HKEA 3X28B 3QBYA 4RCBA 1VIEA 2VUBA 4MDWA 3L2WA 5J26A 3A8MB 3SB2A 4JLGA 3I56A 3HP9A 3CCVA 4M77F 2P4TA 3L2ZA 3WXMB 4FU6A 4B9XA 4C0FA 4F7UF 4RMOA 3CCEA 3MEWA 3ZFJA 3EFSA 3FJPA 4YTLA 5A2QE 3CPWS 2HBPA 5GAMj 3G71A 3RUXA 1Q82C 3CBPA 4QQDA 1K9MU 4D6WA 4FT4A 1N27A 3JAME 1XQHA 2DIGA 3INZA 5J3BA 2RI2A 3NTKA 4RG2A 2M1HA 4QQ6A 3CC2T 4PJOB 4E7JA 1VQLA 5GAOr 2O01E 4OF1A 4PKCC 4ZN3A 2GFAA 2RHUA 2XHCA 1YJWT 3HSBA 4IUPA 4J7FA 1M4ZA 3GLXA 1H641 2QXFA 3CCLT 4M78G 4CI0C 1LOJA 1N6AA 2EYQA 3RIRA 5GAOn 3OS2A 3CD6A 4J6WA 1BI2A 4DQ2A 1KQ1A 1M1GA 5AYFA 5CQYA 5DLOA 3G4SA 1KG1A 4M78E 2DD5A 2F5TX 3JCMg 2QA4T 3CCMA 4HCBA 4QW2A 1VQ4A 1X6OA 3CMET 3OMGA 1KC8C 1VQOT 3UDCA 1OZ3A 3P8HA 3UWNA 4KT0E 4RCCA 1Q81C 2E64A 3JSCA 3MP8A 4M77D 5GANf 5GAN3 3QJYA 3L2QA 4C5HA 1JRIA 5KE2A 3CC7T 1SSFA 3LLRA 2ZPIB 1VQ6T 2QEXT 3CCJA 1K73C 5GAN8 2MMPA 4PJOF 2Y90A 2XIDA 3JB9G 3HHTB 3HRTA 3X20B 2DXTA 3JB9J 2RM4A 5LL6S 3CXCA 3H6ZA 5CKEA 1VQ8A 2A7YA 3OYGA 2PU9B 5FU7C 1B34B 2E6ZA 4R55A 1LNXA 3A8HB 2JN0A 5LJ3g 4BDYA 4DOVA 1G5VA 4E7KA 1M90U 3M56A 5FU6C 2RB6A 4BACA 2LX9A 3V7RA 3PIPA 5GAMe 4KULA 5GMKi 2DTHA 1N8RC 2OTLA 1N9RA 3CCST 5HK0A 2B8AA 3ER0A 3M58A 1KQ2A 4OGEA 3O8VA 4BB7A 2K3XA 4IUUA 4KBMB 5M9OA 4M7DG 4Q5WA 1VQPA 1QW1A 3GF5A 3FDRA 3M4GA 3WVEB 1VUBA 3M57A 2LT4A 3QSUA 1YI2T 3A8GB 4LDUA 2DXCA 3URGA 2IG0A 5GANd 1Q7YU 4N0AC 4M7DE 2E10A 2K2VA 2FHDA 4RKUE 1BYMA 2IVWA 2Y4YA 1M1FA 4FSXA 2O4XB 1GXIE 1V29B 4PL6A 1VQ7T 3CEYA 4BY6B 3P8BB 2RHIA 4N4GA 1MGQA 3PTAA 3TEEA 2ZGWA 3Q1JA 4O5VA 4C92G 4A53A 4PJOD 1WJQA 4C8QG 5GAMh 4M7AB 2D0QB 3KUFA 2HAXA 1W2BS 4BI8B 2VC8A 1VQMT 1Q82U 2RD1A 1P92A 2K5IA 2L8DA 3GNGA 3RESA 3OYHA 3NFCA 2L5QA 3HRSA 4M75F 2DD4A 3SFMA 4C92E 1VIFA 4HT9A 5L8RE 2LNVA 5CCAA 4PJOC 1YJNA 1JB0E 3V8JA 4E7IA 2QQBA 1M5Q1 1G3SA 3QUIA 4QVDA 4M77B 5GAOl 4MMLA 4F7UB 2JTMA 2CZ0B 3G6ET 5A0LA 2R58A 2LDMA 2XG8D 1Y96B 4XU0A 3BDUA 2DEQA 4A4GA 1NZ9A 3MP6A 4N4HA 1Y71A 2RK1A 1VQKT 3A5ZB 3S3NA 4A4HA 5A0GA 3JCMf 3GNFB 1KD1C 1H3ZA 4Y91A 3HRUA 3X25B 2DVEA 1KC8U 3JCMX 4QVZA 2RH2A 3KBGA 3JB9I 3M55A 3OYLA 3CMAT 3C95A 1RL2A 2RI5A 4ZGJB 5KCHA 4IUVA 3L2UA 1DJ7B 5GANe 2M9UA 5CKDA 4M7AF 3CXCS 3QYGB 1Q81U 4LD6A 4NL3A 1O75A 2FB7A 3P8DA 2LCCA 4MMKA 1X01A 3MEVA 4N4IA 2MWOA 2WSCE 1WJRA 2XICA 1KQSA 5CIUA 4A4FA 1VQ9T 4C0DB 5I21A 5IT9E 2H3JA 4B9WA 1ZBXA 2BUDA 5CQXA 1HK9A 2XK0A 4M75D 5LJ3f 4ZGEB 5HKCA 2KQWA 4C5GA 3MHXA 2K4YA 4JS5A 2BIVA 4LDVA 3PMIA 1JJ2S 3V7CA 5KE3A 1Y07A 4JS4A 4MZMA 2OTJT 2PUKB 3LWIA 3JCMd 2DXBA 3CCVT 3VKIA 4HCZA 2O4XA 1FWZA 4EPCA 3JCMJ 2L89A 3CBMA 2EJFA 4L5GA 4C5IA 1OYXA 4Z02A 4BUGA 2CZ1B 4GLKA 2FL7A 3C4SA 3S3MA 4MZPA 2CS7A 3MO8A 4M78F 3OY9A 3OW2A 3CC2A 2LCLA 2YHTA 1WQ7A 4F7UG 2RJDA 3PNWC 2EQUA 2E70A 2JUFA 3MEUA 2QQ9A 4A4EA 5LJ5f 5GMKm 1Y7XA 1YJWA 2JTFA 2Y4XA 5LJ3d 4M7AD 2EQMA 4X34A 3L42A 4NL2A 4BY6C 4EMHA 2DTOA 4F7UE 1QVGA 4M77A 3J80E 4FT2A 3CCLA 4DA4A 2DO3A 4F7UA 5GAN4 4JRKA 1I5LA 3T9NA 2MI6A 3PMTA 4JLIA 4EDUA 2DTIA 1NPRA 4A4KA 3C12A 5GMKl 2QA4A 2E5QA 2XI9A 4HA8A 3CCRT 5EG2A 2E6NA 2F69A 3CCMT 2LT1A 3CMEA 4J5YA 3X26B 1VQ4T 1VQOA 1YIJT 5FRNA 5GMKe 3JB9F 1QP2A 3SWNB 3TREA 3QJ6A 4M77C 4JDSA 2E41A 2QQRA 1UB4A 5GAN6 3JB9H 4IURA 1FX7A 2DJZA 5GAMg 2MAMA 3CC7A 4BDZA 3OYAA 2QEXA 5CAIA 1MHNA 3E19A 4N0AA 3N5BB 1D3BB 2JVVA 1FXXA 4M75B 5LJ5d 3M5AA 1UGPB 3BY7A 4JJNK 2P0QA 2CYZB 5CK9A 2ZPGB 2EFIA 3G7ZA 4M78D 1KD1U 2KDSA 2M0OA 4XQ3A 3X24B 3OYBA 4M7DF 1U1SA 4XTUA 1BKBA 2EWNA 2WSFE 4J8OA 3JCMW 4PJOG 1KQSS 2V8JA 2EJGA 5GANj 1YITT 3MCAB 3CCSA 3NTIA 5GAN5 1VQ5A 2LQ8A 3BDLA 5D6WA 3OYMA 3JCMQ 2ZZDA 3HPWA 4OP0A 4PJOE 4ME7A 2XDDA 4L6V5 4OGCA 1WQWA 4C0DC 1VQPT 4PJOA 5LJ3e 3S3OA 2LC4A 4BE2A 3VYHB 1YI2A 1S72T 1U1TA 4OMFB 5DLQE 3DLLA 3I55T 4JRPA 1QVFA 1KHIA 3LGFA 4PLIA 4C92F 4E7LA 4FL6A 4Y28E 4C8QF 3JB9D 3OYYA 2QTXA 3LWHA 2PVOB 2ZPEB 3CPWA 2RHZA 2HQEA 3LH0A 1VQ7A 2RI3A 1AHJB 3RKYA 2ZPFB 2QQAA 2CKKA 4OB0B 5HK3A 2KVQG 4E47A 1VQNT 1RI0A 4XU1A 3OYIA 3BW1A 3OB9A 4ZN1A 1N9SA 3VUBA 3GP8A 3QXEB 1VQMA 3AHUA 2VGNA 2DKGA 5CKBA 3JCMV 1G3YA 3H8ZA 5C6SA 1K8AC 4MZTA 4X9CA 4IUQA 2XKOC 1M1KC 4M7DD 2KAFA 2CZ7B 4NOYA 5LJ5e 1YJNT 3M59A 3OMCA 3CCUT 1YJ9T 3WVDB 3META 5CO7A 3PIOA 2DPPB 3CC4T 3TCJA 4KUDK 4DOWA 3CCQT 2E1HA 3G6EA 3TU4K 1PSFA 3FRNA 4ZTFA 2GF7A 1BI3A 1B34A 1XNIA 4QQGA 2CZ6B 1VQKA 2C06A 4BE0A 2EIFA 4M78B 3DB4A 2A3LA 1YHQT 1TH7A 3OYJA 1D3BA 1BI0A 4M75A 3L2VA 4BD3A 3QYHB 3RMSA 4A54A 2MWPA 4XAXB 4C8QD 4C92D 1K73U 1M90C 4HCCA 5GMKj 3CMAA 2EQJA 2DXUA 4XU2A 2QI2A 4ELZC 2K3YA 3SWNC 1BIBA 2K5FA 2EKOA 3OYDA 3PT9A 2L3RA 5A0DA 2YLBA 3F70A 5GAMf 1YBYA 3OS0A 2K57A 1UGQB 2P0KA 1LJOA 1G3TA 3VYGA 2R57A 5LJ5h 4C0ZA 1WPYA 2LQKA 2D9TA 2FYKA 2F5KA 4OB2B 1VQ9A 2FVUA 2R5MA 2LVMA 4M75C 4OB3B 5GAOq 3QIIA 1WNLA 2PQWA 4XU3A 5KH6A 3I56T 1QVPA 1N8RU 1NJIC 1Q7YC 4M7AG 3KXTA 3GIBA 4OB1B 4ZTJA 4LDWA 1BIAA 2X4WA 4LD9K 3CCET 4BE1A 2XDBA 5D6YA 4P5NA 5GANh 3ASKA 2LTOA 5CKHA 4IUTA 4OVAA 4BI4A 4M7AE 4X9DA 3RKXA 3G71T 2OTJA 3M53A 2JOYA 5I2MA 1IZ6A 3E9FA 3OBYA 3PGGA 4M7AA 4FM4B 3DKMA 5IN1A 1WJSA 4M77G 3EAEA 5FLXE 3L1AA 1QVFS 1VQLT 3LX7A 3R6OA 2R5AA 2E12A 2DZ9A 5LJ3j 2GFUA 4M77E 3GOXA 2VYTA 5GAMd 4M7DB 3A8LB 3QG1A 3L2RA 2E65A 2I2LA 2PUOB 2X35A 3ME9A 2HNIA 4II1A 4O6JA 5C0MA 1W2BA 3VU3C 3CD6T 4M7AC 1Y96A 2V8KA 2RHXA 4KUIA 3G4ST 4ZGDB 2JNGA 3HL8A 3VJPA 4TVRA 3LW5E 3S6WA 1IREB 2VXEA 2KK4A 1OI1A 1BI1A 1Q86C 4EMGA 5D6XA 5GAOp 3M4YA 4FIBA 4EMKB 1I81A 2DIQA 3OS5A 5HY6A 2DAQA 1QP3A 4C92B 1K8AU 2X4YA 2LRQA 4C8QB 1JBMA 2VV5A 2QDYB 2XDPA 3CCRA 3QPHA 2XD0A 1VQ6A 4M78A 1M1KU 5CKFA 4J6YA 5IAYA 1YIJA 3OS1A 2MF2A 5LJ5j 3CCJT 4PLLA 1UGRB 3V8KA 3JCMe 4ATOA 2OTLT 3M54A 4VUBA 4LDXA 1VQ8T 3QKJA 5DY9A 3OYEA 2BKDN 1XOVA 3OSVA 1I4K1 5KCOA 4E7HA 3QZ5B 3OSSC 3DLMA 3QO3A 1M8VA 3LGLA 4JUVA 2RA2A 3ZBDA 2YLCA 1ZQ1A 2RO0A 3JCMP 3HKSA 4M78C 4CRIA 1NPPA 3J7AF 5FRMA 3ZEHA 5GMKh 4JRQA 2YRVA 2XU8A 2AHJB 2EQKA 1W4SA 4GY5A 3OYKA 1U8RA 1UEBA 4MDXA 4C0GA 2WSEE 3HFNA 2HQXA 3PFSA 4LDYA 5I2SA 1YITA 2OAUA 1K9MC 2KMTA 2RJFA 3EFRA 3BFMA 2DK3A 1VQ5T 1NE8A 4XK8E 3C94A 1ZHIA 3JCMh 4J6XA 1JJ2A 2D6FA 2RHYA 4ELYC 3LYIA 3E9GA 1I8FA 2JZ2A 1S72A 4HT8A 3OYNA 1NJIU 3RERA 1X75C 3VUZA 3FC3A 3I55A 5CVIA 3MEAA 1HXDA 3JRZA 4IKFA 3HFOA 3OW2S 3CPFA 3MP1A 2WACA 3OBWA 3OYCA 4M7DA 4V2SA 1O9SA 2V8IA 2DZCA 3OQ5A 3QDRB 4R56A 4XTVA 5LJ5g 1R8OB 1XTDA 4PNOA 4UC4A 3SD4A 3J81E 2NLUA 3E1SA 3M9QA 1QVGS 4BI3A 1G3WA 3JCMb 1UGSB 4WF2A 3GPLA 4XTYA 1VQNA 5LJ3h 3UPUA 4J7IA 4XTWA 2X4XA 5GAOm 4L59A 2EJ9A 2ZPBB 3FIFA 3SWNA 1PSEA 2P0PA 3DB3A 4JRIA 3UT1A 4M75G 1M9SA 2CGHA 4EMKA 5GANg 4M7DC 4C8QE 2KY9A 2EAYA 4C92A 3OYFA 4C8QA 2X4JA 2KSSA 2HD0A 2M16A 3QZ9B 4NS5A 3CCUA 1YJ9A 3CC4A 4QVCA 3FLGA 4M75E 3RMQA 5FU7B 2PVGB 3V7SA 2GCXA 2VGMA 2GQVA 4C5EA 3CCQA 5DM7R 2VXFA 2RJCA 2ZPHB 3FEOA 2ZCFB 3CBOA 2RJEA 2K5LA 3FB9A 3A8OB 4XTXA 5FU6B 3JCMc 1Q86U 2PVDB 3OA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FRO A;  3CEY A;  3LX7 A;  4BDZ A;  3OYA A;  2QQS A;  2RHI A;  4N4G A;  1OZ2 A;  2R5A A;  1MHN A;  5J39 A;  2GFU A;  3Q1J A;  2G3R A;  3GOX A;  2VYT A;  1WJQ A;  3KUF A;  1WGS A;  2EFI A;  3OYH A;  2L8D A;  3L2R A;  2X35 A;  4II1 A;  3ME9 A;  3NTH A;  2M0O A;  5C0M A;  3OYB A;  1KHC A;  2RHX A;  3QBY A;  4E7I A;  3NTI A;  3S6W A;  3L2W A;  1OI1 A;  3BDL A;  5D6W A;  3OYM A;  5D6X A;  5J26 A;  2R58 A;  2LDM A;  2DIQ A;  2DAQ A;  4A4G A;  4FU6 A;  3MP6 A;  2X4Y A;  4B9X A;  2LRQ A;  4BE2 A;  2XDP A;  4N4H A;  3S3O A;  3MEW A;  5IAY A;  4A4H A;  3S3N A;  3OS1 A;  3LGF A;  4PLI A;  4PLL A;  4QQD A;  4E7L A;  4FL6 A;  1N27 A;  1H3Z A;  2DIG A;  2RHZ A;  2HQE A;  2RI2 A;  3LH0 A;  3NTK A;  3QKJ A;  4QVZ A;  2M1H A;  2BKD N;  4QQ6 A;  4RG2 A;  3OYE A;  3OYL A;  4E7J A;  2RI5 A;  3L2U A;  2RI3 A;  4IUV A;  5KCH A;  5KCO A;  4E7H A;  2CKK A;  2GFA A;  2RHU A;  3DLM A;  4LD6 A;  3P8D A;  3LGL A;  2LCC A;  2RO0 A;  3MEV A;  1RI0 A;  2MWO A;  4IUP A;  3OB9 A;  1WJR A;  4N4I A;  4CRI A;  3OYI A;  5CIU A;  4A4F A;  3OS2 A;  3H8Z A;  5C6S A;  3ZEH A;  5FRM A;  2YRV A;  4B9W A;  2BUD A;  4IUQ A;  2EQK A;  2XK0 A;  4GY5 A;  3OYK A;  4C5G A;  3PFS A;  2HQX A;  2RJF A;  3OMC A;  2BIV A;  3PMI A;  3MET A;  4QW2 A;  3OMG A;  5KE3 A;  1OZ3 A;  3P8H A;  4ZTF A;  2GF7 A;  3UWN A;  2RHY A;  4HCZ A;  2O4X A;  3LYI A;  3E9G A;  1XNI A;  2JZ2 A;  3MP8 A;  4QQG A;  3L2Q A;  3OYN A;  2L89 A;  4C5H A;  4BE0 A;  5KE2 A;  3FC3 A;  1SSF A;  3LLR A;  4C5I A;  3DB4 A;  1OYX A;  4IKF A;  3MEA A;  4Z02 A;  3OYJ A;  3S3M A;  3C4S A;  3L2V A;  3MP1 A;  2WAC A;  3MO8 A;  4BD3 A;  3OYC A;  2MWP A;  3H6Z A;  3OYG A;  3OY9 A;  3OQ5 A;  2EQJ A;  4BDY A;  1G5V A;  2K3Y A;  3OYD A;  2EKO A;  3OA6 A;  2RJD A;  4E7K A;  2L3R A;  4UC4 A;  3PNW C;  3SD4 A;  2EQU A;  2NLU A;  3M9Q A;  3F70 A;  3MEU A;  4A4E A;  3OS0 A;  4BAC A;  2P0K A;  2JTF A;  2R57 A;  2EQM A;  4X34 A;  3L42 A;  2X4X A;  2D9T A;  2F5K A;  4L59 A;  2B8A A;  2R5M A;  2LVM A;  3DB3 A;  3O8V A;  2K3X A;  3QII A;  4IUU A;  2PQW A;  3PMT A;  3UT1 A;  5KH6 A;  4Q5W A;  5M9O A;  3FDR A;  4EDU A;  3OYF A;  4ZTJ A;  2E5Q A;  2M16 A;  2X4W A;  4NS5 A;  2E6N A;  4BE1 A;  2IG0 A;  5D6Y A;  3ASK A;  2LTO A;  3FLG A;  4IUT A;  4OVA A;  4C5E A;  5FRN A;  2FHD A;  2RJC A;  3FEO A;  3E9F A;  2RJE A;  3QJ6 A;  2O4X B;  5IN1 A;  1WJS A;  3EAE A;  2QQR A;  4PL6 A;  4IUR A; 
#chains in the Genus database with same CATH topology
 5FRO A;  2EGE A;  4EMK C;  1OZ2 A;  5GAN 7;  1YHQ A;  2YXY A;  4Z8A A;  4C8Q C;  2FG0 A;  1YCY A;  1WGS A;  2J06 A;  3QHS A;  3V8L A;  2DJQ A;  1ABO A;  4CC4 B;  1OPL A;  2L3Q A;  2LJ1 A;  2P84 A;  4HKE A;  3X28 B;  3I55 Q;  1YWO A;  2KRM A;  4MDW A;  1LVK A;  3SB2 A;  4JLG A;  3I56 A;  3CCV A;  1S1N A;  4M77 F;  4AT1 B;  3WXM B;  4C0F A;  1IO6 A;  3EFS A;  1GCQ C;  4AFU C;  1K9M U;  1EX4 A;  3JAM E;  1B07 A;  3INZ A;  3ZL7 C;  4RG2 A;  2M1H A;  1ACM B;  4Z88 A;  2L0A A;  1RAG B;  4Z89 A;  1YJW T;  4IUP A;  1V1C A;  2RF0 A;  2EYQ A;  3OS2 A;  3CD6 A;  1BI2 A;  4DQ2 A;  3PVQ A;  5AYF A;  2F5T X;  3JCM g;  2QA4 T;  3CCM A;  4QW2 A;  2BZY A;  1KC8 C;  1VQO T;  3UDC A;  4RTZ A;  2F1L A;  4PJN A;  4PFP A;  3UWN A;  1Q81 C;  3MKD A;  2E64 A;  3JSC A;  3MP8 A;  5KE2 A;  2ZPI B;  5GAN 8;  4PJO F;  2Y90 A;  2XID A;  3JB9 G;  3X20 B;  3HRT A;  1YP5 A;  4AG1 C;  5LL6 S;  1GBR A;  4DBQ A;  3H6Z A;  3OYG A;  4JJD A;  1G5V A;  1LNX A;  5LJ3 g;  2JN0 A;  1UHF A;  1M90 U;  4HVW A;  2RB6 A;  3NHN A;  2LX9 A;  1BK2 A;  4KUL A;  2NWM A;  2ABL A;  5HK0 A;  4J9B A;  2JT4 A;  4KBM B;  3FDR A;  3M57 A;  3QSU A;  1PC0 A;  2E3I A;  5GAN d;  5ECA A;  4M7D E;  2E10 A;  2IVW A;  4RUG A;  4J9D A;  4J9I A;  2DNU A;  3CEY A;  4BY6 B;  3PTA A;  2RHI A;  3CCR Q;  4O5V A;  1I1J A;  2DLP A;  1YIJ Q;  1M2O A;  2HAX A;  4BI8 B;  2GTJ A;  1PRM C;  2RD1 A;  2K5I A;  2YUN A;  2GQI A;  4C92 E;  1VIF A;  2J6F A;  2LNV A;  4PJO C;  2LCS A;  1YJN A;  1SHG A;  2QQB A;  4M77 B;  5KYX B;  1ZSZ A;  5A0L A;  2YUP A;  4XU0 A;  2LP5 A;  3I5R A;  4LE9 A;  1YIT Q;  1JO8 A;  4FW2 A;  4Y91 A;  2W0Z A;  4QVZ A;  3KBG A;  3CMA T;  1RL2 A;  1VQP Q;  4IUV A;  5GAN e;  3NPF A;  4LD6 A;  2FB7 A;  1UGV A;  5KYU B;  4MMK A;  1UHC A;  2WSC E;  2XIC A;  1KQS A;  4J9E A;  1ZBX A;  3EG2 A;  2GTO A;  1HK9 A;  2HSE B;  4ZGE B;  3I35 A;  2RQT A;  2KXD A;  3A98 A;  1VQN Q;  4OMP A;  1T0J A;  4MZM A;  1FMK A;  3JCM d;  1TS9 A;  2O4X A;  1FWZ A;  4EPC A;  5KYN A;  2CP5 A;  2EJF A;  4C5I A;  2SRC A;  4GLK A;  2EPD A;  1OUL A;  2FL7 A;  4MZP A;  3S3M A;  2RQW A;  3CCQ Q;  1ZUK A;  4M78 F;  1WDX A;  1JU5 C;  4F7U G;  4A4E A;  2E70 A;  1YJW A;  2D8H A;  5LJ3 d;  2NUP A;  4X34 A;  3EGD B;  3L42 A;  2DTO A;  1D1A A;  2HMA A;  4F7U A;  5I22 A;  2LZ6 B;  4JRK A;  3T9N A;  5IHN A;  3PMT A;  3M0S A;  1K9M R;  1WHM A;  4JLI A;  5FWC A;  3C12 A;  1WHJ A;  2QA4 A;  2DBK A;  1T3L A;  3CCR T;  4J5Y A;  3X26 B;  1VQO A;  1YIJ T;  3RBB B;  3G1J A;  3SWN B;  1LPL A;  2QQR A;  4KGV B;  2DFU A;  2DL4 A;  4E2F B;  2DJZ A;  4X1V A;  2DL8 A;  2O9V A;  4N0A A;  1FXX A;  2E4H A;  1KD1 U;  3X24 B;  1C1A A;  1VQL Q;  4XTU A;  1BKB A;  2WSF E;  4J8O A;  2CP6 A;  5GAN j;  1YIT T;  3VS0 A;  4IIM A;  5IXF A;  3OYM A;  3EGX B;  2CDT A;  1A0N B;  3HPW A;  1OU8 A;  1AZG B;  1VQP T;  4OGC A;  1WQW A;  5LJ3 e;  4FYY B;  2LC4 A;  3VYH B;  1ZLM A;  1MV0 B;  1AVZ C;  1U1T A;  2EGC A;  4JRP A;  1QVF A;  2ENM A;  2PVO B;  4LUD A;  2HKN A;  2RHZ A;  2B86 A;  4OB0 B;  2CKK A;  1VQN T;  3CME Q;  3OYI A;  2AKK A;  3BW1 A;  1N9S A;  2VGN A;  1YWP A;  1OX9 A;  1TU0 B;  1WIE A;  2HDA A;  1NG2 A;  4M7D D;  1SSH A;  3OMC A;  3CCU T;  3MET A;  1RAF B;  3PIO A;  4J9F A;  3CCQ T;  1QLY A;  3FRN A;  3PE0 A;  2K6D A;  2KXC A;  4BE0 A;  4M78 B;  2A3L A;  1D3B A;  2BE7 D;  4C92 D;  4A54 A;  2L2P A;  2MWP A;  4XAX B;  1VQ5 Q;  3CMA A;  2PTK A;  2EKO A;  3PT9 A;  2L3R A;  2DVJ A;  1RAA B;  1YI2 Q;  1YBY A;  5LJ5 h;  2D9T A;  2FYK A;  2E3H A;  2FVU A;  2JMC A;  2COW A;  4AG2 C;  2H8H A;  2R5M A;  1ARK A;  2PQW A;  3KXT A;  2KRN A;  3GIB A;  4OB1 B;  2X4W A;  4BE1 A;  2XDB A;  5GAN h;  5GJV B;  4IUT A;  1V76 A;  2C0O A;  2JOY A;  3E9F A;  4J9G A;  5IN1 A;  2QG9 B;  1VQL T;  3LX7 A;  2E12 A;  5LJ3 j;  1IGQ A;  1GRI A;  4M77 E;  2VYT A;  1Z9Q A;  1X6G A;  4O6J A;  1YNZ A;  2LQW A;  1Y96 A;  1ZA2 B;  4HCK A;  2JNG A;  4TVR A;  1IRE B;  3VS7 A;  1OI1 A;  4EMG A;  1I81 A;  1PCX A;  2DIQ A;  5HY6 A;  2DAQ A;  2AK5 A;  1K8A U;  3CCR A;  1JBM A;  2XDP A;  2XD0 A;  1VQ6 A;  4AFS C;  1YIJ A;  4PLL A;  4ATO A;  2A36 A;  2JJ9 A;  4LDX A;  1VQ8 T;  3QKJ A;  1U3O A;  3TSZ A;  2BKD N;  2RQV A;  5KCO A;  8AT1 B;  3OSS C;  3DLM A;  1JXM A;  3ZBD A;  2RA2 A;  2DA9 A;  1ZQ1 A;  3RNJ A;  2CUD A;  3J7A F;  2VAS A;  3CC2 Q;  4RTX A;  1TOV A;  2EQK A;  3OYK A;  3HFN A;  2HQX A;  1YIT A;  1K9M C;  3EFR A;  2DK3 A;  1VQ5 T;  3C94 A;  3JCM h;  4LN2 A;  2CT4 A;  1MND A;  2JZ2 A;  3R6N A;  1KD1 R;  2ECZ A;  1HXD A;  2KBT A;  1AWX A;  3CPF A;  3H9N A;  1UDL A;  3OBW A;  4M7D A;  1O9S A;  2GNC A;  3OQ5 A;  4R56 A;  2NLU A;  3E1S A;  1QVG S;  4BI3 A;  1VQN A;  1SRM A;  1UGS B;  5LJ3 h;  4FCY A;  1MMG A;  2HCK A;  1F1B B;  1PSE A;  2K79 A;  4JRI A;  4M7D C;  4M75 G;  4WTO B;  4C92 A;  3OYF A;  4IIO A;  2EW3 A;  2KSS A;  3CCU A;  4QVC A;  3CCQ A;  5FU7 B;  2PVG B;  5HCK A;  4C5E A;  2HZY A;  2VGM A;  5DM7 R;  2ZPH B;  2K5L A;  3FB9 A;  3A8O B;  2FRW A;  3JCM c;  4RTU A;  1Q86 U;  4R0K A;  1PHT A;  2QQS A;  5J39 A;  4C92 C;  2VKN A;  5L23 A;  3GBQ A;  1N5Z A;  3NGP A;  8ATC B;  5CR2 A;  1U5S A;  1S72 Q;  4F04 B;  1BCO A;  3L2W A;  2YDL A;  5J26 A;  1PNJ A;  2P4T A;  3L2Z A;  1NLP C;  3MEW A;  3ZFJ A;  4YTL A;  5A2Q E;  3RUX A;  3CBP A;  4QQD A;  2FO0 A;  4FT4 A;  1N27 A;  2ATC B;  3CC2 T;  1X69 A;  4E7J A;  1VQL A;  5EC7 A;  5GAO r;  2O01 E;  4OF1 A;  3QWX X;  4DBH A;  4PKC C;  4ZN3 A;  2XHC A;  2EYX A;  3HSB A;  1M4Z A;  2QXF A;  1LOJ A;  1N6A A;  3RIR A;  3EFO B;  3EHR A;  5CQY A;  5DLO A;  2YWW A;  4M78 E;  4HCB A;  3OMG A;  5D7U A;  1G2B A;  2GBQ A;  4M77 D;  3L2Q A;  5GAN f;  1PD1 A;  4C5H A;  1RAI B;  1SSF A;  3UAT A;  2MMP A;  1UJ0 A;  2DXT A;  2RM4 A;  1VQ8 A;  2OTJ Q;  2KEA A;  3A8H B;  4DOV A;  1GL5 A;  2HKQ B;  4DBR A;  5FU6 C;  4BAC A;  3PIP A;  4RTV A;  1K8A R;  2DTH A;  2BE9 B;  2B8A A;  2LJ3 A;  1MMD A;  3ER0 A;  3M58 A;  2J6K A;  4ANJ A;  4OGE A;  1KQ2 A;  4IUU A;  3M4G A;  1VUB A;  1OOT A;  3A8G B;  4LDU A;  3SEM A;  4FYX B;  2DXC A;  2K2V A;  1RAH B;  1X6B A;  1T0H A;  1M1F A;  4FSX A;  3VS6 A;  1GXI E;  1V29 B;  1VQ7 T;  2EBP A;  1KFZ A;  4N4G A;  1MGQ A;  3TEE A;  2MIO A;  2ZGW A;  2RN8 A;  4A53 A;  1VQ4 Q;  4PJO D;  1PKS A;  4C8Q G;  5I11 A;  4M7A B;  4GBQ A;  2HSP A;  1Q82 U;  2CRE A;  3OYH A;  2L8D A;  3RES A;  3A1P A;  4J9C A;  1GFC A;  5L8R E;  5CCA A;  1WHH A;  3V8J A;  4PJL A;  2OTL Q;  4MML A;  1Q7Y R;  3ULR B;  2R58 A;  2LDM A;  2EQI A;  3TQ7 P;  2HEQ A;  3MP6 A;  1VQK T;  3JCM f;  1WI7 A;  4HVU A;  1KD1 C;  2CH4 W;  4FYV B;  3X25 B;  1MMN A;  3C95 A;  2LNH B;  2QGG A;  5KCH A;  5CKD A;  2M9U A;  3CXC S;  3QYG B;  1RUW A;  1GCQ A;  3MEV A;  2MWO A;  4E6R A;  2HL3 A;  1VQ9 T;  1QWE A;  1NYG A;  2H3J A;  4B9W A;  5CQX A;  5LJ3 f;  4C5G A;  3MHX A;  1Q86 R;  2K4Y A;  4JS5 A;  2BIV A;  3PMI A;  5KE3 A;  4JS4 A;  2OTJ T;  2E5K A;  2CT3 A;  3REB B;  1PM3 A;  3VKI A;  4HCZ A;  1K1Z A;  4BUG A;  2JS2 A;  2CZ1 B;  3TVT A;  2CS7 A;  3MO8 A;  3EG0 A;  3CC2 A;  1GBQ A;  2LCL A;  2FZC B;  2JS0 A;  3PNW C;  2EQU A;  2JUF A;  3MEU A;  2JTF A;  1I07 A;  2EQM A;  4EMH A;  4BY6 C;  1QVG A;  2J05 A;  4M77 A;  3J80 E;  4DA4 A;  2DO3 A;  2DTI A;  5GMK l;  4HA8 A;  4OMM A;  5EG2 A;  2E6N A;  2LT1 A;  1VQ4 T;  5FRN A;  3JB9 F;  1QP2 A;  3TRE A;  4M77 C;  2E41 A;  2KYM A;  2OX7 A;  3JB9 H;  3EHQ A;  5GAM g;  5CAI A;  3THK A;  3E19 A;  2BZX A;  2DF6 A;  5KYU A;  2JVV A;  1D09 B;  5LJ5 d;  3M5A A;  4JJN K;  3BY7 A;  3G71 Q;  2CYZ B;  5CK9 A;  4DEX A;  2ZPG B;  4M78 D;  4JJB A;  2KDS A;  5KYW B;  2EWN A;  2D1X A;  4PJO G;  2V8J A;  1SEM A;  2LQ8 A;  4Y92 A;  3JCM Q;  4OP0 A;  2HBW A;  2I0N A;  4ME7 A;  2XDD A;  4PJO A;  4OMF B;  3I55 T;  1KHI A;  3LGF A;  4E7L A;  2JTE A;  4FL6 A;  3OYY A;  2QTX A;  1AZE A;  2YSQ A;  1VQ7 A;  2VB6 A;  2QAZ A;  1PWT A;  3CXC P;  3EGD A;  4XU1 A;  3OB9 A;  2P4R A;  1E6H A;  5CKB A;  1G3Y A;  1K8A C;  4IUQ A;  2XKO C;  3EGU A;  2KAF A;  2KI7 A;  2QEX Q;  5LJ5 e;  3BE3 A;  1EZZ B;  4DOW A;  3TU4 K;  1PSF A;  1K0X A;  1B34 A;  1Q82 R;  1VQK A;  2C06 A;  3DB4 A;  7AT1 B;  3CCS Q;  4HCC A;  1OEB A;  2DXU A;  4XU2 A;  2NUZ A;  2QI2 A;  4ELZ C;  3SWN C;  3VS2 A;  2V1Q A;  2DYI A;  2YLB A;  4KGZ B;  2JMA A;  2PNI A;  2P0K A;  3H0H A;  3VYG A;  2R57 A;  4OB2 B;  2AIR B;  2F5K A;  1VQ9 A;  3EGX A;  2LVM A;  4OB3 B;  5GAO q;  4PFZ A;  4XU3 A;  1QVP A;  1Q7Y C;  4RTW A;  2XMF A;  5D6Y A;  1D0Z A;  1R0B G;  1PD0 A;  4M7A E;  2OTJ A;  3G71 T;  2ESW A;  1VQM Q;  5I2M A;  3OBY A;  1M3A A;  3M0T A;  3L1A A;  4OML A;  4A63 B;  2R5A A;  5GAM d;  2X3W D;  1ZUY A;  2ED0 A;  2I2L A;  2PUO B;  2X35 A;  1TXQ A;  3VU3 C;  1SHF A;  4JZ3 A;  1N8R R;  1X43 A;  2V8K A;  2RHX A;  1YN8 A;  1KSW A;  2AZV A;  5KYY B;  3VJP A;  2VXE A;  1Q86 C;  1BI1 A;  5GAO p;  2NUT A;  1QP3 A;  3VS1 A;  4M78 A;  1M1K U;  5IAY A;  3OS1 A;  5LJ5 j;  4PJJ A;  1ZSZ B;  3LH5 A;  3JCM e;  1M2V A;  1I4K 1;  4E7H A;  2IPO B;  2YLC A;  1RAC B;  3JCM P;  2BZ8 A;  3OW2 P;  4M78 C;  2K3B A;  2X51 A;  5FRM A;  3ZEH A;  2F2W A;  2YRV A;  2XU8 A;  2DIL A;  1W4S A;  4GY5 A;  3PFS A;  4LDY A;  5I2S A;  1H3H A;  2M02 A;  3CCL Q;  1UJY A;  1X27 A;  1ZHI A;  4J6X A;  1ZA1 B;  4ELY C;  1QMC A;  1B3Q A;  3RER A;  3EG9 B;  1MNE A;  3I55 A;  5CVI A;  3JRZ A;  2K9G A;  4F14 A;  3HFO A;  5IH2 A;  2WAC A;  3OYC A;  1XTD A;  4PNO A;  3M9Q A;  3VS5 A;  3CC7 Q;  3JCM b;  3GPL A;  6AT1 B;  1R0C B;  5GAO m;  4D8K A;  4OMQ A;  4L59 A;  1WHL A;  2VVK A;  3FIF A;  3DB3 A;  3UT1 A;  1M9S A;  4C8Q E;  2KY9 A;  1K4U S;  2GGR A;  2M16 A;  2RJC A;  2RJE A;  4B6M A;  1M8M A;  2A0F B;  3OA6 A;  2RK2 A;  3H0F A;  1EIF A;  1ZUU A;  3CPW P;  2M51 A;  1X2Q A;  4RG8 A;  4WCI A;  4RCB A;  4JPB W;  4E7Z A;  3A8M B;  2QTV A;  4FU6 A;  3FJP A;  3H41 A;  1Q82 C;  5GAM j;  3G71 A;  1NEB A;  1XQH A;  2FZK B;  5J3B A;  2RI2 A;  3NTK A;  3G6E Q;  1NBE B;  3M0Q A;  2MOX A;  4PK4 A;  2HL5 C;  2COZ A;  2GFA A;  2QK0 A;  3CC4 Q;  2V26 A;  4J7F A;  3GLX A;  1H64 1;  3CCL T;  4CI0 C;  2L3P A;  1SF9 A;  2FPF A;  1M1G A;  1I5O B;  2MPX C;  2CUB A;  3AT1 B;  1G83 A;  4CC7 A;  1X6O A;  3CME T;  2DL5 A;  1OZ3 A;  3P8H A;  4RTY A;  4RCC A;  1HSQ A;  1E7O A;  1PKT A;  1JRI A;  3CC7 T;  1BBZ A;  1FMV A;  1TWB A;  3SHW A;  2C0T A;  3HHT B;  2DER A;  5FU7 C;  3CCV Q;  3I56 Q;  2E6Z A;  4R55 A;  1JQQ A;  4BDY A;  3M56 A;  3M0P A;  1N8R C;  2AKL A;  1N9R A;  3QDF A;  1TG0 A;  1M1K R;  4KH0 B;  2K3X A;  5M9O A;  4M7D G;  1VQP A;  1QW1 A;  2CH4 A;  2LT4 A;  1YI2 T;  1HJD A;  1Q7Y U;  4JJC A;  2YT6 A;  2PZ1 A;  1BYM A;  4PL6 A;  3P8B B;  2LMJ A;  3C0C A;  3Q1J A;  3CCM Q;  4C92 G;  5GAM h;  4LXC A;  1WHG A;  5IXB A;  3GNG A;  4M75 F;  3HRS A;  3SFM A;  2DD4 A;  1QKW A;  1JB0 E;  4E7I A;  1M5Q 1;  1G3S A;  3QUI A;  5GAO l;  1VYT A;  2CZ0 B;  2NYS A;  3G6E T;  3REA B;  2DE0 X;  2XG8 D;  3QWY A;  1Y96 B;  1UTI A;  1QWF A;  1J3T A;  1Y71 A;  1R77 A;  3A5Z B;  5A0G A;  3GNF B;  1JJ2 P;  2ZAE A;  1H3Z A;  2DVE A;  3OYL A;  3M55 A;  3L2U A;  2CP3 A;  4F17 A;  4M7A F;  1WXT A;  3P8D A;  2DL7 A;  2LCC A;  1MV3 A;  1X01 A;  1WJR A;  4A4F A;  1NYF A;  4C0D B;  1E6G A;  5IT9 E;  2HQH A;  2BUD A;  4FYW B;  5HKC A;  4QT7 A;  3EH1 A;  2KQW A;  1KIK A;  1NLO C;  4LDV A;  2YRD A;  3LWI A;  1FYN A;  3CCV T;  3JCM J;  3EG1 A;  3CBM A;  2DRK A;  4L5G A;  1YJN Q;  1OYX A;  2LQN A;  2DM1 A;  2YHT A;  1WQ7 A;  2RJD A;  4RTT A;  1QCF A;  4HT9 A;  5LJ5 f;  1K0S A;  5GMK m;  2CSI A;  1MMA A;  2Y4X A;  2KRS A;  4NL2 A;  2SEM A;  4F7U E;  3CCL A;  5IHI A;  2CP2 A;  5GAN 4;  2KGT A;  1I5L A;  1UUE A;  1TTH B;  4KGX B;  2DL3 A;  1FMW A;  4ZNX A;  2DX1 A;  2E5Q A;  1YCS B;  2F69 A;  3CCM T;  3CME A;  3UA6 A;  4JDS A;  1UB4 A;  4IUR A;  3CC7 A;  4BDZ A;  3OYA A;  1MHN A;  3CCE Q;  2DMO A;  4M75 B;  1UGP B;  1EFN A;  3OYB A;  2FRY A;  1KQS S;  2YUO A;  3JCM W;  2EJG A;  3MCA B;  3NTI A;  1VQ5 A;  5D6W A;  2ZZD A;  4QKU A;  1UFF A;  4L6V 5;  4D8D A;  4LUE A;  1YI2 A;  1S72 T;  1YJW Q;  3G4S Q;  3DLL A;  4C8Q F;  3JB9 D;  2ZPE B;  2HQE A;  4PFO A;  3LH0 A;  4AMC A;  2RNA A;  2RI3 A;  2ZPF B;  2QQA A;  2QA4 Q;  4E47 A;  3CCJ Q;  1RI0 A;  1VQO Q;  4ZN1 A;  3VUB A;  2BTT A;  3AHU A;  2DKG A;  4MZT A;  1HYO A;  4X9C A;  1M1K C;  1AWJ A;  1YJN T;  1BB9 A;  2MYS A;  4KUD K;  2DPP B;  3TCJ A;  3G6E A;  4ZTF A;  1C6V X;  2O88 A;  1RAB B;  4AFQ C;  1TUD A;  2EIF A;  1Q95 G;  1OPK A;  1AEY A;  3QYH B;  3TSW A;  2EQJ A;  2K3Y A;  1BIB A;  2K5F A;  3OYD A;  5KYW A;  2QYZ A;  4ORZ A;  4EIK A;  5GAM f;  1WPY A;  2LQK A;  1XJW B;  1N8R U;  1KJW A;  5KH6 A;  1BIA A;  4LD9 K;  1WHK A;  3CCE T;  2LTO A;  5CKH A;  4X9D A;  1IZ6 A;  4M4Z A;  3DKM A;  4M77 G;  1K73 R;  2EYW A;  5FLX E;  1QVF S;  1HD3 A;  2GFU A;  1QQJ A;  3GOX A;  1RI9 A;  3RDV A;  3QG1 A;  5KYX A;  2E65 A;  4II1 A;  3ME9 A;  5C0M A;  2KT1 A;  4KUI A;  3G4S T;  4ZGD B;  3HL8 A;  1KQS P;  1RAD B;  3LW5 E;  3M0U A;  5D6X A;  3O5Z A;  3M4Y A;  4FIB A;  4EMK B;  3CMA Q;  1SRL A;  2LX7 A;  4C8Q B;  2QDY B;  4OMN A;  2O2O A;  4J6Y A;  3CCJ T;  2MF2 A;  3V8K A;  2OTL T;  4VUB A;  5FWB A;  1XOV A;  1MUZ A;  1W1F A;  1D0X A;  5IHK A;  2RO0 A;  1GCP A;  1NPP A;  2YUQ A;  4JRQ A;  3VRY A;  2JM8 A;  1UEB A;  4MDX A;  1ABQ A;  4C0G A;  1WXB A;  2FZG B;  1D0Y A;  3BFM A;  1NE8 A;  2D6F A;  2RHY A;  3LYI A;  1K76 A;  3E9G A;  1WYX A;  1S72 A;  2K7A A;  1NJI U;  1X75 C;  3VUZ A;  1PRL C;  3MEA A;  1SKU B;  3OW2 S;  4V2S A;  3NMZ C;  2V8I A;  2DZC A;  2L3S A;  3SD4 A;  3J81 E;  4LNP A;  1G3W A;  1VQ6 Q;  5KYY A;  3EH2 A;  4J7I A;  4XTW A;  1M3C A;  2F2V A;  4CC3 A;  2EJ9 A;  2ZPB B;  3SWN A;  2P0P A;  2EAY A;  1JXO A;  3QZ9 B;  2HD0 A;  1VA7 A;  3FLG A;  4M75 E;  2A28 A;  3CQT A;  1IGU A;  2ZCF B;  2QDL A;  4XTX A;  2PVD B;  2G6F X;  3RKW A;  1QVF P;  4J83 A;  2G3R A;  1RAE B;  4XTZ A;  2ROL A;  1W70 A;  1ZSZ C;  3NTH A;  3SDZ A;  3UA7 A;  1KHC A;  5GAN 2;  2RQR A;  3VV0 A;  2ED1 A;  3QBY A;  1VIE A;  1Y57 A;  2VUB A;  2FEI A;  1WXU A;  1UEC A;  2JXB A;  3HP9 A;  4F7U F;  4B9X A;  4RMO A;  3CCE A;  3EG9 A;  3CPW S;  2HBP A;  4D6W A;  3UF4 A;  2DIG A;  1RLP C;  3HTR A;  1GFD A;  4QQ6 A;  4PJO B;  4CC2 A;  1WFW A;  1WZO A;  1VYV A;  2RHU A;  3CCU Q;  3VRZ A;  2CSQ A;  1AT1 B;  4M78 G;  1WA7 A;  5GAO n;  2DBM A;  1TUG B;  1Z9Z A;  4J6W A;  1H8K A;  3MJX A;  1KQ1 A;  1TSF A;  1KG1 A;  3G4S A;  1AWO A;  2DD5 A;  2KYB A;  2KT8 A;  2VWF A;  1WLP B;  1VQ4 A;  4KT0 E;  5GAN 3;  3QJY A;  3LLR A;  2RMO A;  1VQ6 T;  2QEX T;  3CCJ A;  1K73 C;  1QCO A;  2DYB A;  2OTL A;  2KRO A;  3JB9 J;  3CXC A;  5CKE A;  2A7Y A;  2PU9 B;  2EGA A;  1B34 B;  3IQL A;  1X2K A;  4E7K A;  1AD5 A;  3H0I A;  3V7R A;  5GAM e;  5GMK i;  2QGF B;  1TUC A;  3CCS T;  2A08 A;  3O8V A;  4BB7 A;  1OQK A;  4Q5W A;  3GF5 A;  3WVE B;  2FPE A;  1ZBJ A;  3URG A;  2IG0 A;  4N0A C;  2FHD A;  1WX6 A;  4RKU E;  4JZ4 A;  2Y4Y A;  2O4X B;  2COY A;  1B7T A;  1M90 R;  3KFV A;  1WJQ A;  2D0Q B;  3KUF A;  1M3B A;  1W2B S;  2VC8 A;  2YRC A;  1VQM T;  1P92 A;  3NFC A;  2L5Q A;  4J9H A;  2NUP B;  4QVD A;  1NJI R;  4F7U B;  2JTM A;  1VQ8 Q;  2RPN A;  3BDU A;  2DEQ A;  4A4G A;  1NZ9 A;  4N4H A;  2DRM A;  2RK1 A;  9ATC B;  3S3N A;  4A4H A;  1NM7 A;  2ROT A;  2NUT B;  3HRU A;  1KC8 U;  3JCM X;  1JEG A;  2RH2 A;  3JB9 I;  2RI5 A;  4HXJ A;  3VS4 A;  4ZGJ B;  1AOJ A;  1DJ7 B;  1Q81 U;  4NL3 A;  1O75 A;  3M0R A;  4N4I A;  1RLQ C;  2V1R A;  5CIU A;  1SPK A;  5I21 A;  1M2V B;  2XK0 A;  4M75 D;  3RR6 A;  1SG5 A;  1JJ2 S;  1G8X A;  4FSS A;  3V7C A;  1Y07 A;  2JM9 A;  2PUK B;  2DXB A;  1IHW A;  3PVL A;  3EG3 A;  2D0N A;  2J6O A;  2L89 A;  4DEY A;  4Z02 A;  1YJ9 Q;  3C4S A;  1H92 A;  3OY9 A;  3OW2 A;  2CP0 A;  2OJ2 A;  2QQ9 A;  4M7A D;  1Y7X A;  5AT1 B;  1YHQ Q;  5FW9 A;  2KNB B;  4FT2 A;  2CP7 A;  1D1C A;  2MI6 A;  4DBF A;  4EDU A;  1NPR A;  4A4K A;  1BCM A;  2XI9 A;  3D7S B;  5GMK e;  4F16 A;  3QJ6 A;  1OV3 A;  2A37 A;  5GAN 6;  3FJ5 A;  1FX7 A;  2MAM A;  2C0I A;  2FPD A;  2QEX A;  2JW4 A;  1U06 A;  3N5B B;  1D3B B;  2P0Q A;  1ZSG A;  2EFI A;  3G7Z A;  1W2B P;  2M0O A;  4XQ3 A;  4M7D F;  1U1S A;  2EYY A;  2EKH A;  2MCN A;  3CCS A;  5GAN 5;  3BDL A;  4PJO E;  3CD6 Q;  2OI3 A;  4C0D C;  2EVR A;  2EYZ A;  3S3O A;  4FW1 A;  4BE2 A;  5DLQ E;  1OU9 A;  4C92 F;  4PLI A;  4AFZ C;  4Y28 E;  3LWH A;  3CPW A;  3EFO A;  2IIM A;  3RKY A;  1AHJ B;  5HK3 A;  2KVQ G;  4PJM A;  4KRT A;  1K9A A;  1CSK A;  3GP8 A;  1VQM A;  3QXE B;  3JCM V;  3H8Z A;  5C6S A;  2RQU A;  2CZ7 B;  4NOY A;  3M59 A;  1LCK A;  1YJ9 T;  1T3S A;  5CO7 A;  3WVD B;  3CC4 T;  2O9S A;  2E1H A;  2GF7 A;  1BI3 A;  2J7I A;  1XNI A;  1YFN A;  4QQG A;  2CZ6 B;  1QCN A;  1M27 C;  1YHQ T;  1TH7 A;  3OYJ A;  1BI0 A;  4M75 A;  3L2V A;  4BD3 A;  3RMS A;  1M90 C;  4C8Q D;  1K73 U;  5GMK j;  1QKX A;  1PG5 B;  1UG1 A;  5A0D A;  3OS0 A;  3F70 A;  2K57 A;  1UGQ B;  1LJO A;  1G3T A;  1ZX6 A;  4C0Z A;  2X3X D;  1D1B A;  4M75 C;  3QII A;  1WNL A;  1NJI C;  3I56 T;  1VQ7 Q;  4M7A G;  2KR3 A;  2MK5 A;  1KC8 R;  4ZTJ A;  4LDW A;  2DET A;  2OAW A;  4HVV A;  4P5N A;  3ASK A;  4BI4 A;  4OVA A;  1Q81 R;  3RKX A;  2K2M A;  2DEU A;  3M53 A;  4M7A A;  3PGG A;  4FM4 B;  2X9H A;  2Z0W A;  1AWW A;  1WJS A;  3EAE A;  4K11 A;  3R6O A;  3I9Q A;  2DZ9 A;  4ESR A;  4M7D B;  1C0M A;  3A8L B;  2H3E B;  1M30 A;  3L2R A;  4OMO A;  3CD6 T;  2HNI A;  1W2B A;  4M7A C;  1IB8 A;  1VOM A;  1VQK Q;  1I0C A;  1Y0M A;  2LJ0 A;  4E7S A;  3S6W A;  2KK4 A;  4KH1 B;  3OS5 A;  1IRX A;  4C92 B;  2X4Y A;  2LRQ A;  2VV5 A;  3QPH A;  5CKF A;  1NEG A;  2AT1 B;  1UE9 A;  1UGR B;  1VQ9 Q;  3M54 A;  5DY9 A;  3OYE A;  3MPU B;  3OSV A;  2M0Y A;  1IXD A;  3QZ5 B;  3QO3 A;  1BU1 A;  1M8V A;  3LGL A;  4JUV A;  3HKS A;  4CRI A;  2AZS A;  5GMK h;  3U23 A;  2AHJ B;  1U8R A;  3I5S A;  2WSE E;  1QVG P;  2OAU A;  2KMT A;  2RJF A;  3VS3 A;  4XK8 E;  2QAS A;  1JJ2 A;  1W6X A;  1I8F A;  1VYU A;  2O31 A;  4HT8 A;  3OYN A;  3FC3 A;  2D8J A;  4IKF A;  1CKB A;  3MP1 A;  3QDR B;  1KK7 A;  4XTV A;  5LJ5 g;  1R8O B;  4GLM A;  1IHV A;  4UC4 A;  2KE9 A;  4WF2 A;  4XTY A;  3UPU A;  2X4X A;  2F2X A;  4EMK A;  2CGH A;  5GAN g;  4C8Q A;  2X4J A;  1OX8 A;  1YJ9 A;  4NS5 A;  3CC4 A;  2W10 A;  1CKA A;  3RMQ A;  3E2U A;  3V7S A;  2GCX A;  2GQV A;  2VXF A;  3FEO A;  3CBO A;  3JV3 A;  5FU6 B;  5GJW B; 
#chains in the Genus database with same CATH homology
 5FRO A;  4EMK C;  3RKW A;  2QQS A;  2RK2 A;  1OZ2 A;  5GAN 7;  1YHQ A;  5J39 A;  4J83 A;  4C92 C;  1EIF A;  2G3R A;  4C8Q C;  1YCY A;  4XTZ A;  1WGS A;  3QHS A;  3V8L A;  5CR2 A;  3NTH A;  3SDZ A;  1KHC A;  5GAN 2;  3VV0 A;  4RG8 A;  4HKE A;  3X28 B;  3QBY A;  4RCB A;  1VIE A;  2VUB A;  4MDW A;  3L2W A;  5J26 A;  3A8M B;  3SB2 A;  4JLG A;  3I56 A;  3HP9 A;  3CCV A;  4M77 F;  2P4T A;  3L2Z A;  3WXM B;  4FU6 A;  4B9X A;  4C0F A;  4F7U F;  4RMO A;  3CCE A;  3MEW A;  3ZFJ A;  3EFS A;  3FJP A;  4YTL A;  5A2Q E;  3CPW S;  2HBP A;  5GAM j;  3G71 A;  3RUX A;  1Q82 C;  3CBP A;  4QQD A;  1K9M U;  4D6W A;  4FT4 A;  1N27 A;  3JAM E;  1XQH A;  2DIG A;  3INZ A;  5J3B A;  2RI2 A;  3NTK A;  4RG2 A;  2M1H A;  4QQ6 A;  3CC2 T;  4PJO B;  4E7J A;  1VQL A;  5GAO r;  2O01 E;  4OF1 A;  4PKC C;  4ZN3 A;  2GFA A;  2RHU A;  2XHC A;  1YJW T;  3HSB A;  4IUP A;  4J7F A;  1M4Z A;  3GLX A;  1H64 1;  2QXF A;  3CCL T;  4M78 G;  4CI0 C;  1LOJ A;  1N6A A;  2EYQ A;  3RIR A;  5GAO n;  3OS2 A;  3CD6 A;  4J6W A;  1BI2 A;  4DQ2 A;  1KQ1 A;  1M1G A;  5AYF A;  5CQY A;  5DLO A;  3G4S A;  1KG1 A;  4M78 E;  2DD5 A;  2F5T X;  3JCM g;  2QA4 T;  3CCM A;  4HCB A;  4QW2 A;  1VQ4 A;  1X6O A;  3CME T;  3OMG A;  1KC8 C;  1VQO T;  3UDC A;  1OZ3 A;  3P8H A;  3UWN A;  4KT0 E;  4RCC A;  1Q81 C;  2E64 A;  3JSC A;  3MP8 A;  4M77 D;  5GAN f;  5GAN 3;  3QJY A;  3L2Q A;  4C5H A;  1JRI A;  5KE2 A;  3CC7 T;  1SSF A;  3LLR A;  2ZPI B;  1VQ6 T;  2QEX T;  3CCJ A;  1K73 C;  5GAN 8;  2MMP A;  4PJO F;  2Y90 A;  2XID A;  3JB9 G;  3HHT B;  3HRT A;  3X20 B;  2DXT A;  3JB9 J;  2RM4 A;  5LL6 S;  3CXC A;  3H6Z A;  5CKE A;  1VQ8 A;  2A7Y A;  3OYG A;  2PU9 B;  5FU7 C;  1B34 B;  2E6Z A;  4R55 A;  1LNX A;  3A8H B;  2JN0 A;  5LJ3 g;  4BDY A;  4DOV A;  1G5V A;  4E7K A;  1M90 U;  3M56 A;  5FU6 C;  2RB6 A;  4BAC A;  2LX9 A;  3V7R A;  3PIP A;  5GAM e;  4KUL A;  5GMK i;  2DTH A;  1N8R C;  2OTL A;  1N9R A;  3CCS T;  5HK0 A;  2B8A A;  3ER0 A;  3M58 A;  1KQ2 A;  4OGE A;  3O8V A;  4BB7 A;  2K3X A;  4IUU A;  4KBM B;  5M9O A;  4M7D G;  4Q5W A;  1VQP A;  1QW1 A;  3GF5 A;  3FDR A;  3M4G A;  3WVE B;  1VUB A;  3M57 A;  2LT4 A;  3QSU A;  1YI2 T;  3A8G B;  4LDU A;  2DXC A;  3URG A;  2IG0 A;  5GAN d;  1Q7Y U;  4N0A C;  4M7D E;  2E10 A;  2K2V A;  2FHD A;  4RKU E;  1BYM A;  2IVW A;  2Y4Y A;  1M1F A;  4FSX A;  2O4X B;  1GXI E;  1V29 B;  4PL6 A;  1VQ7 T;  3CEY A;  4BY6 B;  3P8B B;  2RHI A;  4N4G A;  1MGQ A;  3PTA A;  3TEE A;  2ZGW A;  3Q1J A;  4O5V A;  4C92 G;  4A53 A;  4PJO D;  1WJQ A;  4C8Q G;  5GAM h;  4M7A B;  2D0Q B;  3KUF A;  2HAX A;  1W2B S;  4BI8 B;  2VC8 A;  1VQM T;  1Q82 U;  2RD1 A;  1P92 A;  2K5I A;  2L8D A;  3GNG A;  3RES A;  3OYH A;  3NFC A;  2L5Q A;  3HRS A;  4M75 F;  2DD4 A;  3SFM A;  4C92 E;  1VIF A;  4HT9 A;  5L8R E;  2LNV A;  5CCA A;  4PJO C;  1YJN A;  1JB0 E;  3V8J A;  4E7I A;  2QQB A;  1M5Q 1;  1G3S A;  3QUI A;  4QVD A;  4M77 B;  5GAO l;  4MML A;  4F7U B;  2JTM A;  2CZ0 B;  3G6E T;  5A0L A;  2R58 A;  2LDM A;  2XG8 D;  1Y96 B;  4XU0 A;  3BDU A;  2DEQ A;  4A4G A;  1NZ9 A;  3MP6 A;  4N4H A;  1Y71 A;  2RK1 A;  1VQK T;  3A5Z B;  3S3N A;  4A4H A;  5A0G A;  3JCM f;  3GNF B;  1KD1 C;  1H3Z A;  4Y91 A;  3HRU A;  3X25 B;  2DVE A;  1KC8 U;  3JCM X;  4QVZ A;  2RH2 A;  3KBG A;  3JB9 I;  3M55 A;  3OYL A;  3CMA T;  3C95 A;  1RL2 A;  2RI5 A;  4ZGJ B;  5KCH A;  4IUV A;  3L2U A;  1DJ7 B;  5GAN e;  2M9U A;  5CKD A;  4M7A F;  3CXC S;  3QYG B;  1Q81 U;  4LD6 A;  4NL3 A;  1O75 A;  2FB7 A;  3P8D A;  2LCC A;  4MMK A;  1X01 A;  3MEV A;  4N4I A;  2MWO A;  2WSC E;  1WJR A;  2XIC A;  1KQS A;  5CIU A;  4A4F A;  1VQ9 T;  4C0D B;  5I21 A;  5IT9 E;  2H3J A;  4B9W A;  1ZBX A;  2BUD A;  5CQX A;  1HK9 A;  2XK0 A;  4M75 D;  5LJ3 f;  4ZGE B;  5HKC A;  2KQW A;  4C5G A;  3MHX A;  2K4Y A;  4JS5 A;  2BIV A;  4LDV A;  3PMI A;  1JJ2 S;  3V7C A;  5KE3 A;  1Y07 A;  4JS4 A;  4MZM A;  2OTJ T;  2PUK B;  3LWI A;  3JCM d;  2DXB A;  3CCV T;  3VKI A;  4HCZ A;  2O4X A;  1FWZ A;  4EPC A;  3JCM J;  2L89 A;  3CBM A;  2EJF A;  4L5G A;  4C5I A;  1OYX A;  4Z02 A;  4BUG A;  2CZ1 B;  4GLK A;  2FL7 A;  3C4S A;  3S3M A;  4MZP A;  2CS7 A;  3MO8 A;  4M78 F;  3OY9 A;  3OW2 A;  3CC2 A;  2LCL A;  2YHT A;  1WQ7 A;  4F7U G;  2RJD A;  3PNW C;  2EQU A;  2E70 A;  2JUF A;  3MEU A;  2QQ9 A;  4A4E A;  5LJ5 f;  5GMK m;  1Y7X A;  1YJW A;  2JTF A;  2Y4X A;  5LJ3 d;  4M7A D;  2EQM A;  4X34 A;  3L42 A;  4NL2 A;  4BY6 C;  4EMH A;  2DTO A;  4F7U E;  1QVG A;  4M77 A;  3J80 E;  4FT2 A;  3CCL A;  4DA4 A;  2DO3 A;  4F7U A;  5GAN 4;  4JRK A;  1I5L A;  3T9N A;  2MI6 A;  3PMT A;  4JLI A;  4EDU A;  2DTI A;  1NPR A;  4A4K A;  3C12 A;  5GMK l;  2QA4 A;  2E5Q A;  2XI9 A;  4HA8 A;  3CCR T;  5EG2 A;  2E6N A;  2F69 A;  3CCM T;  2LT1 A;  3CME A;  4J5Y A;  3X26 B;  1VQ4 T;  1VQO A;  1YIJ T;  5FRN A;  5GMK e;  3JB9 F;  1QP2 A;  3SWN B;  3TRE A;  3QJ6 A;  4M77 C;  4JDS A;  2E41 A;  2QQR A;  1UB4 A;  5GAN 6;  3JB9 H;  4IUR A;  1FX7 A;  2DJZ A;  5GAM g;  2MAM A;  3CC7 A;  4BDZ A;  3OYA A;  2QEX A;  5CAI A;  1MHN A;  3E19 A;  4N0A A;  3N5B B;  1D3B B;  2JVV A;  1FXX A;  4M75 B;  5LJ5 d;  3M5A A;  1UGP B;  3BY7 A;  4JJN K;  2P0Q A;  2CYZ B;  5CK9 A;  2ZPG B;  2EFI A;  3G7Z A;  4M78 D;  1KD1 U;  2KDS A;  2M0O A;  4XQ3 A;  3X24 B;  3OYB A;  4M7D F;  1U1S A;  4XTU A;  1BKB A;  2EWN A;  2WSF E;  4J8O A;  3JCM W;  4PJO G;  1KQS S;  2V8J A;  2EJG A;  5GAN j;  1YIT T;  3MCA B;  3CCS A;  3NTI A;  5GAN 5;  1VQ5 A;  2LQ8 A;  3BDL A;  5D6W A;  3OYM A;  3JCM Q;  2ZZD A;  3HPW A;  4OP0 A;  4PJO E;  4ME7 A;  2XDD A;  4L6V 5;  4OGC A;  1WQW A;  4C0D C;  1VQP T;  4PJO A;  5LJ3 e;  3S3O A;  2LC4 A;  4BE2 A;  3VYH B;  1YI2 A;  1S72 T;  1U1T A;  4OMF B;  5DLQ E;  3DLL A;  3I55 T;  4JRP A;  1QVF A;  1KHI A;  3LGF A;  4PLI A;  4C92 F;  4E7L A;  4FL6 A;  4Y28 E;  4C8Q F;  3JB9 D;  3OYY A;  2QTX A;  3LWH A;  2PVO B;  2ZPE B;  3CPW A;  2RHZ A;  2HQE A;  3LH0 A;  1VQ7 A;  2RI3 A;  1AHJ B;  3RKY A;  2ZPF B;  2QQA A;  2CKK A;  4OB0 B;  5HK3 A;  2KVQ G;  4E47 A;  1VQN T;  1RI0 A;  4XU1 A;  3OYI A;  3BW1 A;  3OB9 A;  4ZN1 A;  1N9S A;  3VUB A;  3GP8 A;  3QXE B;  1VQM A;  3AHU A;  2VGN A;  2DKG A;  5CKB A;  3JCM V;  1G3Y A;  3H8Z A;  5C6S A;  1K8A C;  4MZT A;  4X9C A;  4IUQ A;  2XKO C;  1M1K C;  4M7D D;  2KAF A;  2CZ7 B;  4NOY A;  5LJ5 e;  1YJN T;  3M59 A;  3OMC A;  3CCU T;  1YJ9 T;  3WVD B;  3MET A;  5CO7 A;  3PIO A;  2DPP B;  3CC4 T;  3TCJ A;  4KUD K;  4DOW A;  3CCQ T;  2E1H A;  3G6E A;  3TU4 K;  1PSF A;  3FRN A;  4ZTF A;  2GF7 A;  1BI3 A;  1B34 A;  1XNI A;  4QQG A;  2CZ6 B;  1VQK A;  2C06 A;  4BE0 A;  2EIF A;  4M78 B;  3DB4 A;  2A3L A;  1YHQ T;  1TH7 A;  3OYJ A;  1D3B A;  1BI0 A;  4M75 A;  3L2V A;  4BD3 A;  3QYH B;  3RMS A;  4A54 A;  2MWP A;  4XAX B;  4C8Q D;  4C92 D;  1K73 U;  1M90 C;  4HCC A;  5GMK j;  3CMA A;  2EQJ A;  2DXU A;  4XU2 A;  2QI2 A;  4ELZ C;  2K3Y A;  3SWN C;  1BIB A;  2K5F A;  2EKO A;  3OYD A;  3PT9 A;  2L3R A;  5A0D A;  2YLB A;  3F70 A;  5GAM f;  1YBY A;  3OS0 A;  2K57 A;  1UGQ B;  2P0K A;  1LJO A;  1G3T A;  3VYG A;  2R57 A;  5LJ5 h;  4C0Z A;  1WPY A;  2LQK A;  2D9T A;  2FYK A;  2F5K A;  4OB2 B;  1VQ9 A;  2FVU A;  2R5M A;  2LVM A;  4M75 C;  4OB3 B;  5GAO q;  3QII A;  1WNL A;  2PQW A;  4XU3 A;  5KH6 A;  3I56 T;  1QVP A;  1N8R U;  1NJI C;  1Q7Y C;  4M7A G;  3KXT A;  3GIB A;  4OB1 B;  4ZTJ A;  4LDW A;  1BIA A;  2X4W A;  4LD9 K;  3CCE T;  4BE1 A;  2XDB A;  5D6Y A;  4P5N A;  5GAN h;  3ASK A;  2LTO A;  5CKH A;  4IUT A;  4OVA A;  4BI4 A;  4M7A E;  4X9D A;  3RKX A;  3G71 T;  2OTJ A;  3M53 A;  2JOY A;  5I2M A;  1IZ6 A;  3E9F A;  3OBY A;  3PGG A;  4M7A A;  4FM4 B;  3DKM A;  5IN1 A;  1WJS A;  4M77 G;  3EAE A;  5FLX E;  3L1A A;  1QVF S;  1VQL T;  3LX7 A;  3R6O A;  2R5A A;  2E12 A;  2DZ9 A;  5LJ3 j;  2GFU A;  4M77 E;  3GOX A;  2VYT A;  5GAM d;  4M7D B;  3A8L B;  3QG1 A;  3L2R A;  2E65 A;  2I2L A;  2PUO B;  2X35 A;  3ME9 A;  2HNI A;  4II1 A;  4O6J A;  5C0M A;  1W2B A;  3VU3 C;  3CD6 T;  4M7A C;  1Y96 A;  2V8K A;  2RHX A;  4KUI A;  3G4S T;  4ZGD B;  2JNG A;  3HL8 A;  3VJP A;  4TVR A;  3LW5 E;  3S6W A;  1IRE B;  2VXE A;  2KK4 A;  1OI1 A;  1BI1 A;  1Q86 C;  4EMG A;  5D6X A;  5GAO p;  3M4Y A;  4FIB A;  4EMK B;  1I81 A;  2DIQ A;  3OS5 A;  5HY6 A;  2DAQ A;  1QP3 A;  4C92 B;  1K8A U;  2X4Y A;  2LRQ A;  4C8Q B;  1JBM A;  2VV5 A;  2QDY B;  2XDP A;  3CCR A;  3QPH A;  2XD0 A;  1VQ6 A;  4M78 A;  1M1K U;  5CKF A;  4J6Y A;  5IAY A;  1YIJ A;  3OS1 A;  2MF2 A;  5LJ5 j;  3CCJ T;  4PLL A;  1UGR B;  3V8K A;  3JCM e;  4ATO A;  2OTL T;  3M54 A;  4VUB A;  4LDX A;  1VQ8 T;  3QKJ A;  5DY9 A;  3OYE A;  2BKD N;  1XOV A;  3OSV A;  1I4K 1;  5KCO A;  4E7H A;  3QZ5 B;  3OSS C;  3DLM A;  3QO3 A;  1M8V A;  3LGL A;  4JUV A;  2RA2 A;  3ZBD A;  2YLC A;  1ZQ1 A;  2RO0 A;  3JCM P;  3HKS A;  4M78 C;  4CRI A;  1NPP A;  3J7A F;  5FRM A;  3ZEH A;  5GMK h;  4JRQ A;  2YRV A;  2XU8 A;  2AHJ B;  2EQK A;  1W4S A;  4GY5 A;  3OYK A;  1U8R A;  1UEB A;  4MDX A;  4C0G A;  2WSE E;  3HFN A;  2HQX A;  3PFS A;  4LDY A;  5I2S A;  1YIT A;  2OAU A;  1K9M C;  2KMT A;  2RJF A;  3EFR A;  3BFM A;  2DK3 A;  1VQ5 T;  1NE8 A;  4XK8 E;  3C94 A;  1ZHI A;  3JCM h;  4J6X A;  1JJ2 A;  2D6F A;  2RHY A;  4ELY C;  3LYI A;  3E9G A;  1I8F A;  2JZ2 A;  1S72 A;  4HT8 A;  3OYN A;  1NJI U;  3RER A;  1X75 C;  3VUZ A;  3FC3 A;  3I55 A;  5CVI A;  3MEA A;  1HXD A;  3JRZ A;  4IKF A;  3HFO A;  3OW2 S;  3CPF A;  3MP1 A;  2WAC A;  3OBW A;  3OYC A;  4M7D A;  4V2S A;  1O9S A;  2V8I A;  2DZC A;  3OQ5 A;  3QDR B;  4R56 A;  4XTV A;  5LJ5 g;  1R8O B;  1XTD A;  4PNO A;  4UC4 A;  3SD4 A;  3J81 E;  2NLU A;  3E1S A;  3M9Q A;  1QVG S;  4BI3 A;  1G3W A;  3JCM b;  1UGS B;  4WF2 A;  3GPL A;  4XTY A;  1VQN A;  5LJ3 h;  3UPU A;  4J7I A;  4XTW A;  2X4X A;  5GAO m;  4L59 A;  2EJ9 A;  2ZPB B;  3FIF A;  3SWN A;  1PSE A;  2P0P A;  3DB3 A;  4JRI A;  3UT1 A;  4M75 G;  1M9S A;  2CGH A;  4EMK A;  5GAN g;  4M7D C;  4C8Q E;  2KY9 A;  2EAY A;  4C92 A;  3OYF A;  4C8Q A;  2X4J A;  2KSS A;  2HD0 A;  2M16 A;  3QZ9 B;  4NS5 A;  3CCU A;  1YJ9 A;  3CC4 A;  4QVC A;  3FLG A;  4M75 E;  3RMQ A;  5FU7 B;  2PVG B;  3V7S A;  2GCX A;  2VGM A;  2GQV A;  4C5E A;  3CCQ A;  5DM7 R;  2VXF A;  2RJC A;  2ZPH B;  3FEO A;  2ZCF B;  3CBO A;  2RJE A;  2K5L A;  3FB9 A;  3A8O B;  4XTX A;  5FU6 B;  3JCM c;  1Q86 U;  2PVD B;  3OA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...