2PRBA

Crystal structure of aminoglycoside acetyltransferase aac(6')-ib in complex whith coenzyme a
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
176
structure length
173
Chain Sequence
SVTLRLMTEHDLAMLYEWLNRSHIVEWWGARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEEETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFERTRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside 6-N-acetyltransferase type Ib11
publication title Enzyme structural plasticity and the emergence of broad-spectrum antibiotic resistance.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 50
structure length 173
sequence length 176
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2007-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13523 Acetyltransf_8 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2prbA00
3IGRA 4HNYB 4Y49C 2R98A 4NEXA 1VHSA 1NMTA 4CAVA 2WPXA 2Q4YA 5JQ4A 3QAHA 1IICA 1KUYA 4L8AA 2Q4VA 4R3KA 2A4NA 1K4JA 4OLLA 1GHEA 5KTDA 2VZZA 2ZW4A 3B8GA 1Y9KA 2OZHA 3PGPA 4KVME 2B4DB 4HKFA 3BJ8A 4AVAA 4IUSA 1QSNA 4X5KA 2FS5A 3TCVA 2BL1A 4OADA 4XPLA 2BEIA 2G3TA 2HQYA 5I0CA 3TO6A 3IWGA 2PSWA 1YR0A 2PDOA 2FIAA 4K30A 2Z0ZA 4KVOE 1M4GA 2FXFA 1PUAA 2IL4A 4RI1A 2F5IA 3EO4A 4UA3A 4MY0A 4JLYA 1IB1E 4F0YA 3GKRA 2OU2A 2JDDA 2PR1A 5J8CA 2VZYA 2J8NA 4CAWA 4R3LA 2REFA 3BLNA 2JLMA 2P6FA 4MI4A 1YREA 2BUEA 3S6FA 4KZTA 2PR8A 3UY5A 4UBRA 1KUXA 1Q2CA 1QSMA 2B5GB 1I21A 5E96A 1S7KA 2CNTA 4AB7A 4JXQA 4KOYA 2GE3A 3R95A 1NE9A 4I49A 4CRYB 4MJ8A 5IX3A 4FD6A 2VI7A 4AVCA 3D8PA 1VKCA 4U5YA 3EFAA 4FD4A 1KZFA 4QUSA 2Q04A 3FYNA 1S60A 3KKWA 2G0BA 3I3GA 1P4NA 1YLEA 2B4DA 1UFHA 2Q44A 2HUZA 1YVOA 5F49A 5EBVA 5KTCA 4EVYA 5F47A 2FL4A 1QSOA 2FSRA 2DXQA 3SXNA 3SXOA 1QSRA 3P2FA 2VQYA 3WR7A 4PK3A 4JXRA 4KUBA 2NMTA 1IYKA 2ZW5A 1RO5A 4XPKA 3TOAA 2EVNA 1ON0A 2EUIA 4L89A 5H84A 2PC1A 4YGOA 1IIDA 4E8OA 1YX0A 4U9YA 3K9UA 1BO4A 1CM0A 2D4OA 2FCKA 4UWIA 4H89A 2B5GA 3DNSA 3PP9A 2G3AA 5F46A 1IYLA 5H86A 4KOVA 2B3UA 5IV0A 2I00A 2QMLA 2VXKA 3GYAA 5GCNA 3GY9A 5J8FA 4H6ZA 1Y9WA 3LODA 3R9FA 3DDDA 3BJ7A 1XIXA 1LRZA 3PZJA 3T9YA 3ZJ0A 3EY5A 3H4QA 1I1DA 4U9ZA 4AG9A 2R8VA 2OB0A 3DR6A 5HMNA 5DWMA 4AVBA 4KORA 3W6XA 4E0AA 1XMTA 4II9A 4ZBGA 3VWDA 1XEBA 1YVKA 4FD7A 2ZPAA 2K5TA 4NCZA 2P6EA 3S6GA 3W91A 1S7NA 3R96A 2GIVA 4R9MA 4CAXA 1XF8A 4DNCA 4E2AA 4MY3A 4QB9A 2X7BA 3DR8A 3VWEA 1M1DA 3FBUA 3TE4A 3F0AA 4M85A 4KOSA 4JJXA 1S7LA 2WPWA 3N7ZA 2FIWA 5EC4A 3TOBA 3D3SA 2D4PA 2Q7BA 3SHPA 4AG7A 4BMHA 2REEA 2J8RA 5ISVA 4B5PB 3TTHA 2P6GA 1MJ9A 3LD2A 1KUVA 2ZW7A 1MJBA 3R9EA 2B58A 2OH1A 1Y7RA 4R87A 2RC4A 3F5BA 2CY2A 2QIRA 4QVTA 1U6MA 3FNCA 4KOUA 2FE7A 4HNWB 3CXPA 4MHDA 1RXTA 4B5OA 4KVXA 1N71A 1S5KA 3S6HA 4JD6A 3QB8A 2HV2A 3P2HA 4PSXA 4R57A 2CNMA 2Y0MA 2QECA 3TO7A 1BOBA 2JEVA 3D2MA 1I12A 4LX9A 5HH1A 3E0KA 5IB0A 1M4DA 2AE6A 4KOXA 3V8IA 1V0CA 4GS4A 1MK4A 2AJ6A 1XE4A 4QC6A 5C82A 1B87A 4OAEA 4J3GA 3FRMA 2OZUA 5C88A 3TFYA 1NSLA 3D2PA 5JPHA 4XNHB 3TT2A 1TIQA 4FD5A 4PK2A 4NF1A 1WK4A 3G3SA 4PV6A 4H6UA 4UWJA 1M44A 2Z10A 3EXNA 3FB3A 4RS2A 2PQ8A 4PSWA 1QSTA 2GANA 4XPDB 5FVJA 3OWCA 4B5PA 1S7FA 4KOTA 1Z9UA 2Q0YA 2FT0A 2I79A 3G8WA 4ONUA 2R1IA 2ZW6A 3TO9A 1M4IA 1S3ZA 1L0CA 3FXTA 1SQHA 1Z4EA 4IF5A 3R9GA 4YFJA 4CS0B 3EC4A 1YK3A 2VEZA 2KCWA 3MGDA 2VBQA 1R57A 3I9SA 4NSQA 4Y49B 5CNPA 4KUAA 2J8MA 5F48A 4KOWA 4HNXB 3S6KA 1OZPA 3W6SA 2C27A 2H5MA 1P0HA 1Z4RA 2ARHA 5KTAA 3T90A 2BSWA 4LUAA 1PU9A 4XNHC 1WWZA 3RYOA 3CXSA 2ATRA 2B3VA 2R7HA 2OZGA 3JVNA 4NXYA 3CXQA 2ZXVA 2CNSA 1MJAA 1CJWA 1Q2YA 4XPDC 4CRZB 4ORFA 2PRBA 3R1KA 3ZZIA 4MBUA 4JWPA 4M3SA 2JDCA 3NE7A 5DWNA 3DSBA 1Q2DA 4KLWA 1FY7A 2Z11A 4F6AA 1B6BA 2P0WA 2O28A 3C26A 4QBJA 1YGHA 4YRHA 3FIXA 4KLVA 3JUWA 1J4JA 2B4BA 3F8KA
chains in the Genus database with same CATH superfamily
4FBEA 3H8GA 5AG4A 2DEAA 3IGRA 4HNYB 5DS0A 1HEEA 4Y49C 2R98A 3NE8A 4NEXA 1VHSA 4CGPA 1NMTA 1YSJA 1Q7LA 4CAVA 2Z3KA 2PJ1A 4CYQA 3IWEA 4Q7AA 3V7ZA 1Y0YA 3IEHA 2WPXA 4A31A 3PBBA 1EE3P 4OC4A 3A9LA 3VH9A 2Q4YA 3D7HA 5JQ4A 1ARMA 3QAHA 1IICA 1KUYA 1CPSA 4L8AA 2Q4VA 4F9VA 4KSFA 1TKJA 4R3KA 1IOFA 2A4NA 4NGSA 4CPAA 1KWMA 4JZ0A 1K4JA 4OLLA 4ZX8A 1GHEA 5KTDA 1VHOA 3KQXA 2VZZA 3IWWA 3PRTA 6CPAA 2ZW4A 3PB9X 4M6HA 3B8GA 5LRJA 1Y9KA 2OZHA 3PGPA 4KVME 2B4DB 1M4LA 3BXMA 2XEFA 3SI1A 4HKFA 4M6IA 3BJ8A 4AVAA 4IUSA 1QSNA 4X5KA 2FS5A 3WT4A 3TCVA 5K8MA 4OC2A 2BL1A 4OADA 5LYLA 4XPLA 2BEIA 4NGQA 2G3TA 3GIUA 4C2ZA 3NH8A 5K8OA 2HQYA 5I0CA 3TO6A 1TKHA 2PJBA 3IWGA 3JTKA 3IJ3A 2PSWA 2AFMA 2PIYA 1YR0A 2HC9A 1AYEA 2PDOA 3PFOA 2FIAA 4K30A 2Z0ZA 2O53A 4KVOE 5D29A 5G20A 1BLLE 1R43A 1M4GA 2FXFA 4A30A 3H8FA 2ZEFA 3B7IA 4ONWA 1HDQA 2PJAA 1PUAA 4A94A 1IU8A 4MMOA 2PJ9A 2V8DA 2IL4A 4A32A 1CP7A 4RI1A 1XRYA 2F5IA 3FMCA 1Z2LA 1Z8XA 2XEJA 3EO4A 4UA3A 1ELMP 4UEFA 5J1QA 4GXHA 4MY0A 4JLYA 1IB1E 3KR5A 4F0YA 3GKRA 2OU2A 2JDDA 2PR1A 2PJ8A 5LYIA 5J8CA 2VZYA 1DTDA 4RUHA 2J8NA 4CAWA 1DE4C 4R3LA 2REFA 5K8NA 3BLNA 2JLMA 2P6FA 4MI4A 2QYVA 1YREA 2BUEA 3S6FA 4KZTA 2PR8A 3UY5A 2C6GA 4UBRA 2PJ0A 1KUXA 1Q2CA 1QSMA 1F57A 2JBKA 2B5GB 2ZEMA 1I21A 1F2PA 2O4HA 3GUXA 5E96A 2FVGA 1S7KA 2CNTA 4AB7A 4JXQA 4KOYA 2GE3A 3R95A 1NE9A 5BWAB 4I49A 1YW6A 4MJ8A 4CRYB 3I1UA 4KSIA 5IX3A 4FD6A 2VI7A 1ARLA 3BI0A 3B3TA 4AVCA 2DF5A 2CF4A 3D8PA 1VKCA 4U5YA 3EFAA 1Z8LA 4ZI6A 4FD4A 4PQAA 3SI0A 3NA6A 1KZFA 4QUSA 2PE3A 2Q04A 3FYNA 4NGNA 1S60A 1YLOA 3KKWA 2G0BA 3I3GA 1P4NA 1YLEA 2B4DA 3KHZA 2ZEOA 4B14A 1XMBA 4C7HA 1UFHA 2Q44A 2HUZA 1YVOA 4MHNA 1BPNA 3DGVA 1GYTA 5F49A 5EBVA 5KTCA 4EVYA 5F47A 2FL4A 4A39A 1QSOA 2FSRA 1CPXA 2DXQA 4OC5A 4MCPA 2Z3PA 5A27A 3D4UA 4FAIA 5LRKA 1XFOA 4WWVA 5ELYA 3SXNA 4OC1A 3SXOA 1QSRA 1XBUA 3P2FA 4PPZA 2ODFA 5IB9A 4PXCA 2CXAA 5JGFA 4Q38A 2VQYA 4A95A 2ZEEA 3WR7A 2WSAA 4PK3A 4JXRA 2YGWA 3HLPA 3CPAA 4KUBA 2PJ7A 2ZELA 2NMTA 1IYKA 2ZW5A 1RO5A 4XPKA 4NGMA 2Z3OA 3TOAA 5EMIA 2EVNA 4ZY1A 1ZO0A 2V8GA 4X8IA 1ON0A 3FECA 3ISXA 2EUIA 4L89A 3RZAA 4G1PA 2BOAA 5H84A 2PC1A 4YGOA 1IIDA 3SJEA 4E8OA 2V8VA 1YX0A 2ANPA 2NSMA 3K9UA 1BO4A 2Z3NA 4U9YA 4UFVA 1CM0A 2D4OA 2FCKA 4UIBA 2AFSA 3CZXA 2WUUA 3LMSA 4UWIA 3DLJA 4H2KA 4H89A 2DPSA 2B5GA 2ZENA 1Z8TA 3DNSA 1VIXA 3TC8A 3PP9A 4MXUA 4OKOA 4YU9A 1LAPA 2G3AA 3B2YA 4NGPA 3D7GA 5F46A 2AFZA 2OOTA 2DPTA 1IYLA 5H86A 4KOVA 2B3UA 1Z5RA 3QNVA 5IV0A 2I00A 2OR4A 2QMLA 4P6YA 1VGYA 2V8HA 1JQGA 2ABZA 3PB7X 2VXKA 5HVFA 3GYAA 5GCNA 3GY9A 4EFDA 5J8FA 4H6ZA 4UF4A 4TWEA 1Y9WA 4IK2A 5I4MA 3LODA 3R9FA 3FF3A 3WC7A 5CBMA 3DDDA 3BJ7A 1LRZA 1XIXA 2GLJA 3PZJA 2GU2A 3T9YA 2ZOFA 3S9MA 3ZJ0A 4EWTA 4R7MA 3EY5A 3GB0A 3H4QA 1I1DA 4BINA 5JH9A 4U9ZA 4B13A 1TF8A 3PBEA 4CGLA 1LAMA 4AG9A 2R8VA 2OB0A 3DR6A 4PXEA 4R8FA 4UCPA 3SJFA 5HMNA 3TX8A 1IY7A 2GREA 2C6CA 1IGBA 3D66A 5DWMA 3KGQA 4AVBA 4KORA 2PIZA 4BD9A 2NYQA 2YNCC 3W6XA 4E0AA 1XMTA 1UWYA 4II9A 4MHPA 4DUKA 3NH5A 4CYPA 2YNCA 2JEWA 3GLJA 4UCNA 4ZBGA 3VWDA 3IO1A 3FEEA 1XEBA 1YVKA 2Q4ZA 4FD7A 4NGRA 4UIAA 2ZPAA 2K5TA 1CP6A 2WZNA 4IHMA 4MFKA 2CTBA 2P6EA 1TKFA 4NCZA 3S6GA 3W91A 1S7NA 3MRUA 4LQ6A 4OIDA 3R96A 3B35A 2GIVA 4UFXA 4R9MA 4CAXA 5LRGA 5LYFA 1ZG7A 4CGMA 1XOVA 1XF8A 4C7IA 4DNCA 3H5ZA 4E2AA 1ZLHA 4MY3A 4P4IA 3CPXA 3WC6A 4QB9A 2X7BA 3DR8A 3VWEA 4DYOA 1M1DA 3FBUA 3TE4A 3S9NA 3F0AA 4M85A 4KOSA 5THWA 1FT7A 3BI1A 4W9YA 4JJXA 3S9LA 1S7LA 2PVWA 2WPWA 4F8ZA 3FEDA 2EWBA 4B6ZA 3N7ZA 2GLFA 2V77A 1YMEA 1XJOA 2FIWA 2PJ2A 5EC4A 1Z8WA 1CG2A 5K8PA 3QAYA 5G1ZA 2IQ6A 3TOBA 1ZG9A 4CGNA 3IU2A 1TF9A 3D3SA 3RNZA 2D4PA 2Q7BA 3SHPA 1ZG8A 3FVLA 2XEGA 4NJQA 2F7VA 2POKA 4OMEA 4AG7A 4BMHA 2YNDA 5HVGA 4F9UA 2REEA 5HVHA 3KHXA 2J8RA 2ZEHA 4X2TA 5ISVA 1LANA 4C2YA 2CIJA 3D7DA 4NGTA 4EMEA 4ZX9A 4B5PB 3TTHA 2BO9A 2P6GA 2EO8A 1MJ9A 4LQGA 3LD2A 2PJ4A 4GM5A 1KUVA 2ZW7A 1MJBA 3CT9A 3WABA 2ZEGA 3LWUA 3R9EA 2B58A 1CBXA 1Y7RA 2OH1A 4R87A 2RC4A 4R76A 3F5BA 4OC3A 1QMUA 2CY2A 2QIRA 4QVTA 1U6MA 3FNCA 4KOUA 2FE7A 4HNWB 3CXPA 4OIWA 8CPAA 5F09A 5HXDA 4B11A 4HPSA 4B10A 4OP4A 4MHDA 1RXTA 4B5OA 4KVXA 1N71A 3LACA 1S5KA 4P4EA 2C6PA 3B3SA 3PFEA 2Z3LA 3S6HA 4JD6A 3QB8A 4RN7A 4MHYA 2ZEDA 3IFEA 4MCSA 2HV2A 3ISZA 3P2HA 4CGOA 2BCOA 4PSXA 4R57A 4P4JA 4UEZA 2CNMA 3SJXA 1JWQA 1NSAA 1RTQA 2Y0MA 4UCMA 2QECA 1F2OA 3D67A 3TO7A 2IJZA 1BOBA 2JEVA 3D2MA 2RB7A 4ZY0A 1I12A 1A2ZA 4LX9A 4C2XA 5HH1A 3E0KA 5IB0A 1M4DA 1IOIA 2AE6A 4KOXA 3V8IA 1V0CA 3B3WA 4GS4A 3N5FA 1MK4A 1Y0RA 2AJ6A 1ZLIA 4BBHA 4IAVA 1R3NA 2JBJA 4B12A 1PYTB 1XE4A 4QC6A 4CAEA 5C82A 4CAFA 2AFOA 1B87A 1LOKA 4MRIA 5A28A 3PB6X 4KS9A 4OAEA 4J3GA 3FRMA 2OZUA 5C88A 2ZOGA 3TFYA 1NSLA 3FJUA 4DJLA 4M6GA 3PB8X 2CTCA 3D2PA 3IC1A 3PEIA 4XNHB 3TT2A 1TIQA 2EBJA 5JPHA 5G21A 4FD5A 4UFWA 4F0XA 4PK2A 1YW4A 2F8HA 2PCUA 3KI9A 2PRQA 4NF1A 1WK4A 4MFJA 2PJCA 3G3SA 4PV6A 1H8LA 4H6UA 4TNUA 5AG5A 4UWJA 1M44A 2Z10A 3EXNA 4MFQA 3FB3A 2AFUA 3D68A 4MHZA 3RO0A 4RS2A 2PQ8A 2YNEA 4MFPA 4PSWA 5AG6A 4A33A 4ZGYB 1QSTA 2GANA 2ZEPA 4FUUA 3HUVA 2HB6A 2XEIA 4XPDB 5FVJA 3OWCA 4B5PA 1S7FA 4KOTA 3PB4X 2Q51A 3KL9A 1Z9UA 2Q0YA 4JYWA 2FT0A 2I79A 3G8WA 5D8NA 4ONUA 4A2ZA 4YWYA 2AFXA 1CX8A 2R1IA 2ZW6A 3MN8A 1M4IA 2EK9A 3TO9A 3VARA 3D7FA 4R6TA 1X12A 4CYOA 1S3ZA 1L0CA 4CYNA 3FXTA 1SQHA 3B3VA 1BPMA 1Z4EA 4ZYQA 3T8WA 4K3NA 2EK8A 4IF5A 1QQ9A 4P4DA 3KQZA 3R9GA 4YFJA 4CS0B 2RFHA 3EC4A 1YK3A 2C1CA 2VEZA 3WC5A 4Z65A 5JM6A 3CDXA 2KCWA 2J9AA 2PJ5A 3MGDA 4P4BA 3JRUA 2VBQA 2PVVA 1R57A 3I9SA 4NSQA 4NFRA 4Y49B 5AG7A 5CNPA 4KUAA 2J8MA 5F48A 4O23A 2WYRA 4KOWA 3V38A 4HNXB 4MFLA 2QVPA 3RAMA 3S6KA 1PCAA 1OZPA 3W6SA 2C27A 1FNOA 2H5MA 2G9DA 3K9TA 3L2NA 4OC0A 2VL1A 1LFWA 1P0HA 1Z4RA 2ARHA 1AUGA 5KTAA 3T90A 4KSAA 1AMPA 2BSWA 1YQEA 4LUAA 1ELLP 5G22A 1PU9A 5LYDA 2Q7SA 4XNHC 4AXVA 3IU1A 4X3RA 1WWZA 3RYOA 2QJ8A 4MCQA 3CXSA 3NFZA 4UEEA 4P44A 2ATRA 2B3VA 2R7HA 3B3CA 3BHXA 2OZGA 2Q43A 2PJ3A 3KR4A 3K2KA 4PXDA 3JVNA 4NXYA 3CXQA 3IIBA 2ZXVA 1LCPA 2I3CA 2CNSA 1MJAA 1CJWA 1Q2YA 4XPDC 4CRZB 4ORFA 2GFQA 4Q36A 2PRBA 1VHEA 3FX6A 3R1KA 3RBUA 4P10A 3ZZIA 4MBUA 4ZY2A 4JWPA 2PJ6A 4MFZA 4M3SA 2JDCA 1X10A 3NE7A 3SJGA 5DWNA 2IMOA 3DSBA 1HDUA 1Q2DA 1FY7A 4KLWA 2Z11A 4NJRA 4PXBA 4A37A 4F6AA 7CPAA 4C68A 2P0WA 1B6BA 3VATA 2O28A 3C26A 2Z3MA 1Y7EA 4P45A 3H8EA 1BAVA 4QBJA 5CPAA 1YGHA 4YRHA 1TXRA 4FWUA 3FIXA 4KLVA 3JUWA 4MCRA 1J4JA 1OBRA 4A38A 2B4BA 2AFWA 3FH4A 3KASA 3NH4A 4WJBA 3F8KA 3SI2A 5AGEA 3KZWA 4P4FA
chains in the Genus database with same CATH topology
5AG4A 3IGRA 4HNYB 4Y49C 2R98A 4NEXA 4CGPA 1VHSA 1NMTA 4CAVA 2Z3KA 4CYQA 3IWEA 2WPXA 4A31A 3A9LA 2Q4YA 5JQ4A 3QAHA 1IICA 1KUYA 4L8AA 2Q4VA 4KSFA 4R3KA 2A4NA 1K4JA 4OLLA 1GHEA 5KTDA 2VZZA 2ZW4A 3B8GA 1Y9KA 2OZHA 3PGPA 4KVME 2B4DB 4HKFA 3BJ8A 4AVAA 4IUSA 1QSNA 4X5KA 2FS5A 3TCVA 2BL1A 4OADA 4XPLA 2BEIA 4C2ZA 2G3TA 2HQYA 5I0CA 3TO6A 3IWGA 3JTKA 2PSWA 1YR0A 2PDOA 2FIAA 4K30A 2Z0ZA 4KVOE 5G20A 1M4GA 2FXFA 4A30A 1PUAA 2IL4A 4A32A 4RI1A 2F5IA 3EO4A 4UA3A 4MY0A 4JLYA 1IB1E 4F0YA 3GKRA 2OU2A 2JDDA 2PR1A 5J8CA 2VZYA 2J8NA 4CAWA 4R3LA 2REFA 3BLNA 2JLMA 2P6FA 4MI4A 1YREA 2BUEA 3S6FA 4KZTA 2PR8A 3UY5A 4UBRA 1KUXA 1Q2CA 1QSMA 2B5GB 1I21A 5E96A 1S7KA 2CNTA 4AB7A 4JXQA 4KOYA 2GE3A 3R95A 1NE9A 5BWAB 4I49A 4CRYB 4MJ8A 5IX3A 4FD6A 2VI7A 4AVCA 3D8PA 1VKCA 4U5YA 3EFAA 4FD4A 1KZFA 4QUSA 2Q04A 3FYNA 1S60A 3KKWA 2G0BA 3I3GA 1P4NA 1YLEA 2B4DA 4B14A 4C7HA 1UFHA 2Q44A 2HUZA 1YVOA 5F49A 5EBVA 5KTCA 4EVYA 5F47A 2FL4A 1QSOA 2FSRA 2DXQA 2Z3PA 5A27A 3SXNA 3SXOA 1QSRA 3P2FA 2CXAA 4Q38A 2VQYA 4A95A 3WR7A 2WSAA 4PK3A 4JXRA 2YGWA 4KUBA 2NMTA 1IYKA 2ZW5A 1RO5A 4XPKA 2Z3OA 3TOAA 2EVNA 1ZO0A 1ON0A 2EUIA 4L89A 5H84A 2PC1A 4YGOA 1IIDA 4E8OA 1YX0A 4U9YA 3K9UA 1BO4A 2Z3NA 4UFVA 1CM0A 2D4OA 2FCKA 2WUUA 4UWIA 4H89A 2DPSA 2B5GA 3DNSA 3PP9A 2G3AA 5F46A 2DPTA 1IYLA 5H86A 4KOVA 2B3UA 5IV0A 2I00A 2QMLA 2VXKA 3GYAA 5GCNA 3GY9A 5J8FA 4H6ZA 1Y9WA 3LODA 3R9FA 3DDDA 3BJ7A 1XIXA 1LRZA 3PZJA 3T9YA 3ZJ0A 3EY5A 3H4QA 1I1DA 4U9ZA 4B13A 4CGLA 4AG9A 2R8VA 2OB0A 3DR6A 4UCPA 5HMNA 5DWMA 4AVBA 4KORA 2YNCC 3W6XA 4E0AA 1XMTA 4II9A 4CYPA 2YNCA 4ZBGA 4UCNA 3VWDA 1XEBA 1YVKA 4FD7A 2ZPAA 2K5TA 4MFKA 4NCZA 2P6EA 3S6GA 3W91A 1S7NA 3R96A 2GIVA 4UFXA 4R9MA 4CAXA 4CGMA 4C7IA 1XF8A 4DNCA 3H5ZA 4E2AA 4MY3A 4QB9A 2X7BA 3DR8A 3VWEA 1M1DA 3FBUA 3TE4A 3F0AA 4M85A 4KOSA 4JJXA 1S7LA 2WPWA 3N7ZA 2FIWA 5EC4A 5G1ZA 3TOBA 4CGNA 3IU2A 3D3SA 2D4PA 2Q7BA 3SHPA 4AG7A 4BMHA 2YNDA 2REEA 2J8RA 5ISVA 4C2YA 4B5PB 3TTHA 2P6GA 1MJ9A 3LD2A 1KUVA 2ZW7A 1MJBA 3R9EA 2B58A 2OH1A 1Y7RA 4R87A 2RC4A 3F5BA 2CY2A 2QIRA 4QVTA 1U6MA 3FNCA 4KOUA 2FE7A 4HNWB 3CXPA 4B11A 4B10A 4MHDA 1RXTA 4B5OA 4KVXA 1N71A 1S5KA 2Z3LA 3S6HA 4JD6A 3QB8A 2HV2A 3P2HA 4CGOA 4PSXA 4R57A 2CNMA 2Y0MA 4UCMA 2QECA 3TO7A 1BOBA 2JEVA 3D2MA 1I12A 4LX9A 4C2XA 5HH1A 3E0KA 5IB0A 1M4DA 2AE6A 4KOXA 3V8IA 1V0CA 4GS4A 1MK4A 2AJ6A 4BBHA 4B12A 1XE4A 4QC6A 4CAEA 5C82A 4CAFA 1B87A 5A28A 4KS9A 4OAEA 4J3GA 3FRMA 2OZUA 5C88A 3TFYA 1NSLA 3D2PA 5JPHA 4XNHB 3TT2A 1TIQA 5G21A 4FD5A 4UFWA 4F0XA 4PK2A 4NF1A 1WK4A 4MFJA 3G3SA 4PV6A 4H6UA 5AG5A 4UWJA 1M44A 2Z10A 3EXNA 4MFQA 3FB3A 4RS2A 2PQ8A 2YNEA 4MFPA 4PSWA 5AG6A 4A33A 4ZGYB 1QSTA 2GANA 4XPDB 5FVJA 3OWCA 4B5PA 1S7FA 4KOTA 1Z9UA 2Q0YA 2FT0A 2I79A 3G8WA 4A2ZA 4ONUA 2R1IA 2ZW6A 3TO9A 1M4IA 4CYOA 1S3ZA 1L0CA 4CYNA 3FXTA 1SQHA 1Z4EA 4IF5A 3R9GA 4YFJA 4CS0B 3EC4A 1YK3A 2VEZA 2KCWA 3MGDA 2VBQA 1R57A 3I9SA 4NSQA 4Y49B 5CNPA 5AG7A 4KUAA 2J8MA 5F48A 4KOWA 4HNXB 4MFLA 3S6KA 1OZPA 3W6SA 2C27A 2H5MA 1P0HA 1Z4RA 2ARHA 5KTAA 3T90A 4KSAA 2BSWA 4LUAA 5G22A 1PU9A 4XNHC 3IU1A 1WWZA 3RYOA 3CXSA 2ATRA 2B3VA 2R7HA 2OZGA 3JVNA 4NXYA 3CXQA 2ZXVA 2CNSA 1MJAA 1CJWA 1Q2YA 4XPDC 4CRZB 4ORFA 4Q36A 2PRBA 3R1KA 3ZZIA 4MBUA 4JWPA 4MFZA 4M3SA 2JDCA 3NE7A 5DWNA 3DSBA 1Q2DA 4KLWA 1FY7A 2Z11A 4F6AA 4C68A 1B6BA 2P0WA 2O28A 3C26A 2Z3MA 4QBJA 1YGHA 4YRHA 3FIXA 4KLVA 3JUWA 1J4JA 2B4BA 3F8KA 5AGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IGR A;  4HNY B;  4Y49 C;  2R98 A;  4NEX A;  1VHS A;  1NMT A;  4CAV A;  2WPX A;  2Q4Y A;  5JQ4 A;  3QAH A;  1IIC A;  1KUY A;  4L8A A;  2Q4V A;  4R3K A;  2A4N A;  1K4J A;  4OLL A;  1GHE A;  5KTD A;  2VZZ A;  2ZW4 A;  3B8G A;  1Y9K A;  2OZH A;  3PGP A;  4KVM E;  2B4D B;  4HKF A;  3BJ8 A;  4AVA A;  4IUS A;  1QSN A;  4X5K A;  2FS5 A;  3TCV A;  2BL1 A;  4OAD A;  4XPL A;  2BEI A;  2G3T A;  2HQY A;  5I0C A;  3TO6 A;  3IWG A;  2PSW A;  1YR0 A;  2PDO A;  2FIA A;  4K30 A;  2Z0Z A;  4KVO E;  1M4G A;  2FXF A;  1PUA A;  2IL4 A;  4RI1 A;  2F5I A;  3EO4 A;  4UA3 A;  4MY0 A;  4JLY A;  1IB1 E;  4F0Y A;  3GKR A;  2OU2 A;  2JDD A;  2PR1 A;  5J8C A;  2VZY A;  2J8N A;  4CAW A;  4R3L A;  2REF A;  3BLN A;  2JLM A;  2P6F A;  4MI4 A;  1YRE A;  2BUE A;  3S6F A;  4KZT A;  2PR8 A;  3UY5 A;  4UBR A;  1KUX A;  1Q2C A;  1QSM A;  2B5G B;  1I21 A;  5E96 A;  1S7K A;  2CNT A;  4AB7 A;  4JXQ A;  4KOY A;  2GE3 A;  3R95 A;  1NE9 A;  4I49 A;  4CRY B;  4MJ8 A;  5IX3 A;  4FD6 A;  2VI7 A;  4AVC A;  3D8P A;  1VKC A;  4U5Y A;  3EFA A;  4FD4 A;  1KZF A;  4QUS A;  2Q04 A;  3FYN A;  1S60 A;  3KKW A;  2G0B A;  3I3G A;  1P4N A;  1YLE A;  2B4D A;  1UFH A;  2Q44 A;  2HUZ A;  1YVO A;  5F49 A;  5EBV A;  5KTC A;  4EVY A;  5F47 A;  2FL4 A;  1QSO A;  2FSR A;  2DXQ A;  3SXN A;  3SXO A;  1QSR A;  3P2F A;  2VQY A;  3WR7 A;  4PK3 A;  4JXR A;  4KUB A;  2NMT A;  1IYK A;  2ZW5 A;  1RO5 A;  4XPK A;  3TOA A;  2EVN A;  1ON0 A;  2EUI A;  4L89 A;  5H84 A;  2PC1 A;  4YGO A;  1IID A;  4E8O A;  1YX0 A;  4U9Y A;  3K9U A;  1BO4 A;  1CM0 A;  2D4O A;  2FCK A;  4UWI A;  4H89 A;  2B5G A;  3DNS A;  3PP9 A;  2G3A A;  5F46 A;  1IYL A;  5H86 A;  4KOV A;  2B3U A;  5IV0 A;  2I00 A;  2QML A;  2VXK A;  3GYA A;  5GCN A;  3GY9 A;  5J8F A;  4H6Z A;  1Y9W A;  3LOD A;  3R9F A;  3DDD A;  3BJ7 A;  1XIX A;  1LRZ A;  3PZJ A;  3T9Y A;  3ZJ0 A;  3EY5 A;  3H4Q A;  1I1D A;  4U9Z A;  4AG9 A;  2R8V A;  2OB0 A;  3DR6 A;  5HMN A;  5DWM A;  4AVB A;  4KOR A;  3W6X A;  4E0A A;  1XMT A;  4II9 A;  4ZBG A;  3VWD A;  1XEB A;  1YVK A;  4FD7 A;  2ZPA A;  2K5T A;  4NCZ A;  2P6E A;  3S6G A;  3W91 A;  1S7N A;  3R96 A;  2GIV A;  4R9M A;  4CAX A;  1XF8 A;  4DNC A;  4E2A A;  4MY3 A;  4QB9 A;  2X7B A;  3DR8 A;  3VWE A;  1M1D A;  3FBU A;  3TE4 A;  3F0A A;  4M85 A;  4KOS A;  4JJX A;  1S7L A;  2WPW A;  3N7Z A;  2FIW A;  5EC4 A;  3TOB A;  3D3S A;  2D4P A;  2Q7B A;  3SHP A;  4AG7 A;  4BMH A;  2REE A;  2J8R A;  5ISV A;  4B5P B;  3TTH A;  2P6G A;  1MJ9 A;  3LD2 A;  1KUV A;  2ZW7 A;  1MJB A;  3R9E A;  2B58 A;  2OH1 A;  1Y7R A;  4R87 A;  2RC4 A;  3F5B A;  2CY2 A;  2QIR A;  4QVT A;  1U6M A;  3FNC A;  4KOU A;  2FE7 A;  4HNW B;  3CXP A;  4MHD A;  1RXT A;  4B5O A;  4KVX A;  1N71 A;  1S5K A;  3S6H A;  4JD6 A;  3QB8 A;  2HV2 A;  3P2H A;  4PSX A;  4R57 A;  2CNM A;  2Y0M A;  2QEC A;  3TO7 A;  1BOB A;  2JEV A;  3D2M A;  1I12 A;  4LX9 A;  5HH1 A;  3E0K A;  5IB0 A;  1M4D A;  2AE6 A;  4KOX A;  3V8I A;  1V0C A;  4GS4 A;  1MK4 A;  2AJ6 A;  1XE4 A;  4QC6 A;  5C82 A;  1B87 A;  4OAE A;  4J3G A;  3FRM A;  2OZU A;  5C88 A;  3TFY A;  1NSL A;  3D2P A;  5JPH A;  4XNH B;  3TT2 A;  1TIQ A;  4FD5 A;  4PK2 A;  4NF1 A;  1WK4 A;  3G3S A;  4PV6 A;  4H6U A;  4UWJ A;  1M44 A;  2Z10 A;  3EXN A;  3FB3 A;  4RS2 A;  2PQ8 A;  4PSW A;  1QST A;  2GAN A;  4XPD B;  5FVJ A;  3OWC A;  4B5P A;  1S7F A;  4KOT A;  1Z9U A;  2Q0Y A;  2FT0 A;  2I79 A;  3G8W A;  4ONU A;  2R1I A;  2ZW6 A;  3TO9 A;  1M4I A;  1S3Z A;  1L0C A;  3FXT A;  1SQH A;  1Z4E A;  4IF5 A;  3R9G A;  4YFJ A;  4CS0 B;  3EC4 A;  1YK3 A;  2VEZ A;  2KCW A;  3MGD A;  2VBQ A;  1R57 A;  3I9S A;  4NSQ A;  4Y49 B;  5CNP A;  4KUA A;  2J8M A;  5F48 A;  4KOW A;  4HNX B;  3S6K A;  1OZP A;  3W6S A;  2C27 A;  2H5M A;  1P0H A;  1Z4R A;  2ARH A;  5KTA A;  3T90 A;  2BSW A;  4LUA A;  1PU9 A;  4XNH C;  1WWZ A;  3RYO A;  3CXS A;  2ATR A;  2B3V A;  2R7H A;  2OZG A;  3JVN A;  4NXY A;  3CXQ A;  2ZXV A;  2CNS A;  1MJA A;  1CJW A;  1Q2Y A;  4XPD C;  4CRZ B;  4ORF A;  2PRB A;  3R1K A;  3ZZI A;  4MBU A;  4JWP A;  4M3S A;  2JDC A;  3NE7 A;  5DWN A;  3DSB A;  1Q2D A;  4KLW A;  1FY7 A;  2Z11 A;  4F6A A;  1B6B A;  2P0W A;  2O28 A;  3C26 A;  4QBJ A;  1YGH A;  4YRH A;  3FIX A;  4KLV A;  3JUW A;  1J4J A;  2B4B A;  3F8K A; 
#chains in the Genus database with same CATH topology
 4FBE A;  3H8G A;  5AG4 A;  2DEA A;  3IGR A;  4HNY B;  5DS0 A;  1HEE A;  4Y49 C;  2R98 A;  3NE8 A;  4NEX A;  1VHS A;  4CGP A;  1NMT A;  1YSJ A;  1Q7L A;  4CAV A;  2Z3K A;  2PJ1 A;  4CYQ A;  3IWE A;  4Q7A A;  3V7Z A;  1Y0Y A;  3IEH A;  2WPX A;  4A31 A;  3PBB A;  1EE3 P;  4OC4 A;  3A9L A;  3VH9 A;  2Q4Y A;  3D7H A;  5JQ4 A;  1ARM A;  3QAH A;  1IIC A;  1KUY A;  1CPS A;  4L8A A;  2Q4V A;  4F9V A;  4KSF A;  1TKJ A;  4R3K A;  1IOF A;  2A4N A;  4NGS A;  4CPA A;  1KWM A;  4JZ0 A;  1K4J A;  4OLL A;  4ZX8 A;  1GHE A;  5KTD A;  1VHO A;  3KQX A;  2VZZ A;  3IWW A;  3PRT A;  6CPA A;  2ZW4 A;  3PB9 X;  4M6H A;  3B8G A;  5LRJ A;  1Y9K A;  2OZH A;  3PGP A;  4KVM E;  2B4D B;  1M4L A;  3BXM A;  2XEF A;  3SI1 A;  4HKF A;  4M6I A;  3BJ8 A;  4AVA A;  4IUS A;  1QSN A;  4X5K A;  2FS5 A;  3WT4 A;  3TCV A;  5K8M A;  4OC2 A;  2BL1 A;  4OAD A;  5LYL A;  4XPL A;  2BEI A;  4NGQ A;  2G3T A;  3GIU A;  4C2Z A;  3NH8 A;  5K8O A;  2HQY A;  5I0C A;  3TO6 A;  1TKH A;  2PJB A;  3IWG A;  3JTK A;  3IJ3 A;  2PSW A;  2AFM A;  2PIY A;  1YR0 A;  2HC9 A;  1AYE A;  2PDO A;  3PFO A;  2FIA A;  4K30 A;  2Z0Z A;  2O53 A;  4KVO E;  5D29 A;  5G20 A;  1BLL E;  1R43 A;  1M4G A;  2FXF A;  4A30 A;  3H8F A;  2ZEF A;  3B7I A;  4ONW A;  1HDQ A;  2PJA A;  1PUA A;  4A94 A;  1IU8 A;  4MMO A;  2PJ9 A;  2V8D A;  2IL4 A;  4A32 A;  1CP7 A;  4RI1 A;  1XRY A;  2F5I A;  3FMC A;  1Z2L A;  1Z8X A;  2XEJ A;  3EO4 A;  4UA3 A;  1ELM P;  4UEF A;  5J1Q A;  4GXH A;  4MY0 A;  4JLY A;  1IB1 E;  3KR5 A;  4F0Y A;  3GKR A;  2OU2 A;  2JDD A;  2PR1 A;  2PJ8 A;  5LYI A;  5J8C A;  2VZY A;  1DTD A;  4RUH A;  2J8N A;  4CAW A;  1DE4 C;  4R3L A;  2REF A;  5K8N A;  3BLN A;  2JLM A;  2P6F A;  4MI4 A;  2QYV A;  1YRE A;  2BUE A;  3S6F A;  4KZT A;  2PR8 A;  3UY5 A;  2C6G A;  4UBR A;  2PJ0 A;  1KUX A;  1Q2C A;  1QSM A;  1F57 A;  2JBK A;  2B5G B;  2ZEM A;  1I21 A;  1F2P A;  2O4H A;  3GUX A;  5E96 A;  2FVG A;  1S7K A;  2CNT A;  4AB7 A;  4JXQ A;  4KOY A;  2GE3 A;  3R95 A;  1NE9 A;  5BWA B;  4I49 A;  1YW6 A;  4MJ8 A;  4CRY B;  3I1U A;  4KSI A;  5IX3 A;  4FD6 A;  2VI7 A;  1ARL A;  3BI0 A;  3B3T A;  4AVC A;  2DF5 A;  2CF4 A;  3D8P A;  1VKC A;  4U5Y A;  3EFA A;  1Z8L A;  4ZI6 A;  4FD4 A;  4PQA A;  3SI0 A;  3NA6 A;  1KZF A;  4QUS A;  2PE3 A;  2Q04 A;  3FYN A;  4NGN A;  1S60 A;  1YLO A;  3KKW A;  2G0B A;  3I3G A;  1P4N A;  1YLE A;  2B4D A;  3KHZ A;  2ZEO A;  4B14 A;  1XMB A;  4C7H A;  1UFH A;  2Q44 A;  2HUZ A;  1YVO A;  4MHN A;  1BPN A;  3DGV A;  1GYT A;  5F49 A;  5EBV A;  5KTC A;  4EVY A;  5F47 A;  2FL4 A;  4A39 A;  1QSO A;  2FSR A;  1CPX A;  2DXQ A;  4OC5 A;  4MCP A;  2Z3P A;  5A27 A;  3D4U A;  4FAI A;  5LRK A;  1XFO A;  4WWV A;  5ELY A;  3SXN A;  4OC1 A;  3SXO A;  1QSR A;  1XBU A;  3P2F A;  4PPZ A;  2ODF A;  5IB9 A;  4PXC A;  2CXA A;  5JGF A;  4Q38 A;  2VQY A;  4A95 A;  2ZEE A;  3WR7 A;  2WSA A;  4PK3 A;  4JXR A;  2YGW A;  3HLP A;  3CPA A;  4KUB A;  2PJ7 A;  2ZEL A;  2NMT A;  1IYK A;  2ZW5 A;  1RO5 A;  4XPK A;  4NGM A;  2Z3O A;  3TOA A;  5EMI A;  2EVN A;  4ZY1 A;  1ZO0 A;  2V8G A;  4X8I A;  1ON0 A;  3FEC A;  3ISX A;  2EUI A;  4L89 A;  3RZA A;  4G1P A;  2BOA A;  5H84 A;  2PC1 A;  4YGO A;  1IID A;  3SJE A;  4E8O A;  2V8V A;  1YX0 A;  2ANP A;  2NSM A;  3K9U A;  1BO4 A;  2Z3N A;  4U9Y A;  4UFV A;  1CM0 A;  2D4O A;  2FCK A;  4UIB A;  2AFS A;  3CZX A;  2WUU A;  3LMS A;  4UWI A;  3DLJ A;  4H2K A;  4H89 A;  2DPS A;  2B5G A;  2ZEN A;  1Z8T A;  3DNS A;  1VIX A;  3TC8 A;  3PP9 A;  4MXU A;  4OKO A;  4YU9 A;  1LAP A;  2G3A A;  3B2Y A;  4NGP A;  3D7G A;  5F46 A;  2AFZ A;  2OOT A;  2DPT A;  1IYL A;  5H86 A;  4KOV A;  2B3U A;  1Z5R A;  3QNV A;  5IV0 A;  2I00 A;  2OR4 A;  2QML A;  4P6Y A;  1VGY A;  2V8H A;  1JQG A;  2ABZ A;  3PB7 X;  2VXK A;  5HVF A;  3GYA A;  5GCN A;  3GY9 A;  4EFD A;  5J8F A;  4H6Z A;  4UF4 A;  4TWE A;  1Y9W A;  4IK2 A;  5I4M A;  3LOD A;  3R9F A;  3FF3 A;  3WC7 A;  5CBM A;  3DDD A;  3BJ7 A;  1LRZ A;  1XIX A;  2GLJ A;  3PZJ A;  2GU2 A;  3T9Y A;  2ZOF A;  3S9M A;  3ZJ0 A;  4EWT A;  4R7M A;  3EY5 A;  3GB0 A;  3H4Q A;  1I1D A;  4BIN A;  5JH9 A;  4U9Z A;  4B13 A;  1TF8 A;  3PBE A;  4CGL A;  1LAM A;  4AG9 A;  2R8V A;  2OB0 A;  3DR6 A;  4PXE A;  4R8F A;  4UCP A;  3SJF A;  5HMN A;  3TX8 A;  1IY7 A;  2GRE A;  2C6C A;  1IGB A;  3D66 A;  5DWM A;  3KGQ A;  4AVB A;  4KOR A;  2PIZ A;  4BD9 A;  2NYQ A;  2YNC C;  3W6X A;  4E0A A;  1XMT A;  1UWY A;  4II9 A;  4MHP A;  4DUK A;  3NH5 A;  4CYP A;  2YNC A;  2JEW A;  3GLJ A;  4UCN A;  4ZBG A;  3VWD A;  3IO1 A;  3FEE A;  1XEB A;  1YVK A;  2Q4Z A;  4FD7 A;  4NGR A;  4UIA A;  2ZPA A;  2K5T A;  1CP6 A;  2WZN A;  4IHM A;  4MFK A;  2CTB A;  2P6E A;  1TKF A;  4NCZ A;  3S6G A;  3W91 A;  1S7N A;  3MRU A;  4LQ6 A;  4OID A;  3R96 A;  3B35 A;  2GIV A;  4UFX A;  4R9M A;  4CAX A;  5LRG A;  5LYF A;  1ZG7 A;  4CGM A;  1XOV A;  1XF8 A;  4C7I A;  4DNC A;  3H5Z A;  4E2A A;  1ZLH A;  4MY3 A;  4P4I A;  3CPX A;  3WC6 A;  4QB9 A;  2X7B A;  3DR8 A;  3VWE A;  4DYO A;  1M1D A;  3FBU A;  3TE4 A;  3S9N A;  3F0A A;  4M85 A;  4KOS A;  5THW A;  1FT7 A;  3BI1 A;  4W9Y A;  4JJX A;  3S9L A;  1S7L A;  2PVW A;  2WPW A;  4F8Z A;  3FED A;  2EWB A;  4B6Z A;  3N7Z A;  2GLF A;  2V77 A;  1YME A;  1XJO A;  2FIW A;  2PJ2 A;  5EC4 A;  1Z8W A;  1CG2 A;  5K8P A;  3QAY A;  5G1Z A;  2IQ6 A;  3TOB A;  1ZG9 A;  4CGN A;  3IU2 A;  1TF9 A;  3D3S A;  3RNZ A;  2D4P A;  2Q7B A;  3SHP A;  1ZG8 A;  3FVL A;  2XEG A;  4NJQ A;  2F7V A;  2POK A;  4OME A;  4AG7 A;  4BMH A;  2YND A;  5HVG A;  4F9U A;  2REE A;  5HVH A;  3KHX A;  2J8R A;  2ZEH A;  4X2T A;  5ISV A;  1LAN A;  4C2Y A;  2CIJ A;  3D7D A;  4NGT A;  4EME A;  4ZX9 A;  4B5P B;  3TTH A;  2BO9 A;  2P6G A;  2EO8 A;  1MJ9 A;  4LQG A;  3LD2 A;  2PJ4 A;  4GM5 A;  1KUV A;  2ZW7 A;  1MJB A;  3CT9 A;  3WAB A;  2ZEG A;  3LWU A;  3R9E A;  2B58 A;  1CBX A;  1Y7R A;  2OH1 A;  4R87 A;  2RC4 A;  4R76 A;  3F5B A;  4OC3 A;  1QMU A;  2CY2 A;  2QIR A;  4QVT A;  1U6M A;  3FNC A;  4KOU A;  2FE7 A;  4HNW B;  3CXP A;  4OIW A;  8CPA A;  5F09 A;  5HXD A;  4B11 A;  4HPS A;  4B10 A;  4OP4 A;  4MHD A;  1RXT A;  4B5O A;  4KVX A;  1N71 A;  3LAC A;  1S5K A;  4P4E A;  2C6P A;  3B3S A;  3PFE A;  2Z3L A;  3S6H A;  4JD6 A;  3QB8 A;  4RN7 A;  4MHY A;  2ZED A;  3IFE A;  4MCS A;  2HV2 A;  3ISZ A;  3P2H A;  4CGO A;  2BCO A;  4PSX A;  4R57 A;  4P4J A;  4UEZ A;  2CNM A;  3SJX A;  1JWQ A;  1NSA A;  1RTQ A;  2Y0M A;  4UCM A;  2QEC A;  1F2O A;  3D67 A;  3TO7 A;  2IJZ A;  1BOB A;  2JEV A;  3D2M A;  2RB7 A;  4ZY0 A;  1I12 A;  1A2Z A;  4LX9 A;  4C2X A;  5HH1 A;  3E0K A;  5IB0 A;  1M4D A;  1IOI A;  2AE6 A;  4KOX A;  3V8I A;  1V0C A;  3B3W A;  4GS4 A;  3N5F A;  1MK4 A;  1Y0R A;  2AJ6 A;  1ZLI A;  4BBH A;  4IAV A;  1R3N A;  2JBJ A;  4B12 A;  1PYT B;  1XE4 A;  4QC6 A;  4CAE A;  5C82 A;  4CAF A;  2AFO A;  1B87 A;  1LOK A;  4MRI A;  5A28 A;  3PB6 X;  4KS9 A;  4OAE A;  4J3G A;  3FRM A;  2OZU A;  5C88 A;  2ZOG A;  3TFY A;  1NSL A;  3FJU A;  4DJL A;  4M6G A;  3PB8 X;  2CTC A;  3D2P A;  3IC1 A;  3PEI A;  4XNH B;  3TT2 A;  1TIQ A;  2EBJ A;  5JPH A;  5G21 A;  4FD5 A;  4UFW A;  4F0X A;  4PK2 A;  1YW4 A;  2F8H A;  2PCU A;  3KI9 A;  2PRQ A;  4NF1 A;  1WK4 A;  4MFJ A;  2PJC A;  3G3S A;  4PV6 A;  1H8L A;  4H6U A;  4TNU A;  5AG5 A;  4UWJ A;  1M44 A;  2Z10 A;  3EXN A;  4MFQ A;  3FB3 A;  2AFU A;  3D68 A;  4MHZ A;  3RO0 A;  4RS2 A;  2PQ8 A;  2YNE A;  4MFP A;  4PSW A;  5AG6 A;  4A33 A;  4ZGY B;  1QST A;  2GAN A;  2ZEP A;  4FUU A;  3HUV A;  2HB6 A;  2XEI A;  4XPD B;  5FVJ A;  3OWC A;  4B5P A;  1S7F A;  4KOT A;  3PB4 X;  2Q51 A;  3KL9 A;  1Z9U A;  2Q0Y A;  4JYW A;  2FT0 A;  2I79 A;  3G8W A;  5D8N A;  4ONU A;  4A2Z A;  4YWY A;  2AFX A;  1CX8 A;  2R1I A;  2ZW6 A;  3MN8 A;  1M4I A;  2EK9 A;  3TO9 A;  3VAR A;  3D7F A;  4R6T A;  1X12 A;  4CYO A;  1S3Z A;  1L0C A;  4CYN A;  3FXT A;  1SQH A;  3B3V A;  1BPM A;  1Z4E A;  4ZYQ A;  3T8W A;  4K3N A;  2EK8 A;  4IF5 A;  1QQ9 A;  4P4D A;  3KQZ A;  3R9G A;  4YFJ A;  4CS0 B;  2RFH A;  3EC4 A;  1YK3 A;  2C1C A;  2VEZ A;  3WC5 A;  4Z65 A;  5JM6 A;  3CDX A;  2KCW A;  2J9A A;  2PJ5 A;  3MGD A;  4P4B A;  3JRU A;  2VBQ A;  2PVV A;  1R57 A;  3I9S A;  4NSQ A;  4NFR A;  4Y49 B;  5AG7 A;  5CNP A;  4KUA A;  2J8M A;  5F48 A;  4O23 A;  2WYR A;  4KOW A;  3V38 A;  4HNX B;  4MFL A;  2QVP A;  3RAM A;  3S6K A;  1PCA A;  1OZP A;  3W6S A;  2C27 A;  1FNO A;  2H5M A;  2G9D A;  3K9T A;  3L2N A;  4OC0 A;  2VL1 A;  1LFW A;  1P0H A;  1Z4R A;  2ARH A;  1AUG A;  5KTA A;  3T90 A;  4KSA A;  1AMP A;  2BSW A;  1YQE A;  4LUA A;  1ELL P;  5G22 A;  1PU9 A;  5LYD A;  2Q7S A;  4XNH C;  4AXV A;  3IU1 A;  4X3R A;  1WWZ A;  3RYO A;  2QJ8 A;  4MCQ A;  3CXS A;  3NFZ A;  4UEE A;  4P44 A;  2ATR A;  2B3V A;  2R7H A;  3B3C A;  3BHX A;  2OZG A;  2Q43 A;  2PJ3 A;  3KR4 A;  3K2K A;  4PXD A;  3JVN A;  4NXY A;  3CXQ A;  3IIB A;  2ZXV A;  1LCP A;  2I3C A;  2CNS A;  1MJA A;  1CJW A;  1Q2Y A;  4XPD C;  4CRZ B;  4ORF A;  2GFQ A;  4Q36 A;  2PRB A;  1VHE A;  3FX6 A;  3R1K A;  3RBU A;  4P10 A;  3ZZI A;  4MBU A;  4ZY2 A;  4JWP A;  2PJ6 A;  4MFZ A;  4M3S A;  2JDC A;  1X10 A;  3NE7 A;  3SJG A;  5DWN A;  2IMO A;  3DSB A;  1HDU A;  1Q2D A;  1FY7 A;  4KLW A;  2Z11 A;  4NJR A;  4PXB A;  4A37 A;  4F6A A;  7CPA A;  4C68 A;  2P0W A;  1B6B A;  3VAT A;  2O28 A;  3C26 A;  2Z3M A;  1Y7E A;  4P45 A;  3H8E A;  1BAV A;  4QBJ A;  5CPA A;  1YGH A;  4YRH A;  1TXR A;  4FWU A;  3FIX A;  4KLV A;  3JUW A;  4MCR A;  1J4J A;  1OBR A;  4A38 A;  2B4B A;  2AFW A;  3FH4 A;  3KAS A;  3NH4 A;  4WJB A;  3F8K A;  3SI2 A;  5AGE A;  3KZW A;  4P4F A; 
#chains in the Genus database with same CATH homology
 5AG4 A;  3IGR A;  4HNY B;  4Y49 C;  2R98 A;  4NEX A;  4CGP A;  1VHS A;  1NMT A;  4CAV A;  2Z3K A;  4CYQ A;  3IWE A;  2WPX A;  4A31 A;  3A9L A;  2Q4Y A;  5JQ4 A;  3QAH A;  1IIC A;  1KUY A;  4L8A A;  2Q4V A;  4KSF A;  4R3K A;  2A4N A;  1K4J A;  4OLL A;  1GHE A;  5KTD A;  2VZZ A;  2ZW4 A;  3B8G A;  1Y9K A;  2OZH A;  3PGP A;  4KVM E;  2B4D B;  4HKF A;  3BJ8 A;  4AVA A;  4IUS A;  1QSN A;  4X5K A;  2FS5 A;  3TCV A;  2BL1 A;  4OAD A;  4XPL A;  2BEI A;  4C2Z A;  2G3T A;  2HQY A;  5I0C A;  3TO6 A;  3IWG A;  3JTK A;  2PSW A;  1YR0 A;  2PDO A;  2FIA A;  4K30 A;  2Z0Z A;  4KVO E;  5G20 A;  1M4G A;  2FXF A;  4A30 A;  1PUA A;  2IL4 A;  4A32 A;  4RI1 A;  2F5I A;  3EO4 A;  4UA3 A;  4MY0 A;  4JLY A;  1IB1 E;  4F0Y A;  3GKR A;  2OU2 A;  2JDD A;  2PR1 A;  5J8C A;  2VZY A;  2J8N A;  4CAW A;  4R3L A;  2REF A;  3BLN A;  2JLM A;  2P6F A;  4MI4 A;  1YRE A;  2BUE A;  3S6F A;  4KZT A;  2PR8 A;  3UY5 A;  4UBR A;  1KUX A;  1Q2C A;  1QSM A;  2B5G B;  1I21 A;  5E96 A;  1S7K A;  2CNT A;  4AB7 A;  4JXQ A;  4KOY A;  2GE3 A;  3R95 A;  1NE9 A;  5BWA B;  4I49 A;  4CRY B;  4MJ8 A;  5IX3 A;  4FD6 A;  2VI7 A;  4AVC A;  3D8P A;  1VKC A;  4U5Y A;  3EFA A;  4FD4 A;  1KZF A;  4QUS A;  2Q04 A;  3FYN A;  1S60 A;  3KKW A;  2G0B A;  3I3G A;  1P4N A;  1YLE A;  2B4D A;  4B14 A;  4C7H A;  1UFH A;  2Q44 A;  2HUZ A;  1YVO A;  5F49 A;  5EBV A;  5KTC A;  4EVY A;  5F47 A;  2FL4 A;  1QSO A;  2FSR A;  2DXQ A;  2Z3P A;  5A27 A;  3SXN A;  3SXO A;  1QSR A;  3P2F A;  2CXA A;  4Q38 A;  2VQY A;  4A95 A;  3WR7 A;  2WSA A;  4PK3 A;  4JXR A;  2YGW A;  4KUB A;  2NMT A;  1IYK A;  2ZW5 A;  1RO5 A;  4XPK A;  2Z3O A;  3TOA A;  2EVN A;  1ZO0 A;  1ON0 A;  2EUI A;  4L89 A;  5H84 A;  2PC1 A;  4YGO A;  1IID A;  4E8O A;  1YX0 A;  4U9Y A;  3K9U A;  1BO4 A;  2Z3N A;  4UFV A;  1CM0 A;  2D4O A;  2FCK A;  2WUU A;  4UWI A;  4H89 A;  2DPS A;  2B5G A;  3DNS A;  3PP9 A;  2G3A A;  5F46 A;  2DPT A;  1IYL A;  5H86 A;  4KOV A;  2B3U A;  5IV0 A;  2I00 A;  2QML A;  2VXK A;  3GYA A;  5GCN A;  3GY9 A;  5J8F A;  4H6Z A;  1Y9W A;  3LOD A;  3R9F A;  3DDD A;  3BJ7 A;  1XIX A;  1LRZ A;  3PZJ A;  3T9Y A;  3ZJ0 A;  3EY5 A;  3H4Q A;  1I1D A;  4U9Z A;  4B13 A;  4CGL A;  4AG9 A;  2R8V A;  2OB0 A;  3DR6 A;  4UCP A;  5HMN A;  5DWM A;  4AVB A;  4KOR A;  2YNC C;  3W6X A;  4E0A A;  1XMT A;  4II9 A;  4CYP A;  2YNC A;  4ZBG A;  4UCN A;  3VWD A;  1XEB A;  1YVK A;  4FD7 A;  2ZPA A;  2K5T A;  4MFK A;  4NCZ A;  2P6E A;  3S6G A;  3W91 A;  1S7N A;  3R96 A;  2GIV A;  4UFX A;  4R9M A;  4CAX A;  4CGM A;  4C7I A;  1XF8 A;  4DNC A;  3H5Z A;  4E2A A;  4MY3 A;  4QB9 A;  2X7B A;  3DR8 A;  3VWE A;  1M1D A;  3FBU A;  3TE4 A;  3F0A A;  4M85 A;  4KOS A;  4JJX A;  1S7L A;  2WPW A;  3N7Z A;  2FIW A;  5EC4 A;  5G1Z A;  3TOB A;  4CGN A;  3IU2 A;  3D3S A;  2D4P A;  2Q7B A;  3SHP A;  4AG7 A;  4BMH A;  2YND A;  2REE A;  2J8R A;  5ISV A;  4C2Y A;  4B5P B;  3TTH A;  2P6G A;  1MJ9 A;  3LD2 A;  1KUV A;  2ZW7 A;  1MJB A;  3R9E A;  2B58 A;  2OH1 A;  1Y7R A;  4R87 A;  2RC4 A;  3F5B A;  2CY2 A;  2QIR A;  4QVT A;  1U6M A;  3FNC A;  4KOU A;  2FE7 A;  4HNW B;  3CXP A;  4B11 A;  4B10 A;  4MHD A;  1RXT A;  4B5O A;  4KVX A;  1N71 A;  1S5K A;  2Z3L A;  3S6H A;  4JD6 A;  3QB8 A;  2HV2 A;  3P2H A;  4CGO A;  4PSX A;  4R57 A;  2CNM A;  2Y0M A;  4UCM A;  2QEC A;  3TO7 A;  1BOB A;  2JEV A;  3D2M A;  1I12 A;  4LX9 A;  4C2X A;  5HH1 A;  3E0K A;  5IB0 A;  1M4D A;  2AE6 A;  4KOX A;  3V8I A;  1V0C A;  4GS4 A;  1MK4 A;  2AJ6 A;  4BBH A;  4B12 A;  1XE4 A;  4QC6 A;  4CAE A;  5C82 A;  4CAF A;  1B87 A;  5A28 A;  4KS9 A;  4OAE A;  4J3G A;  3FRM A;  2OZU A;  5C88 A;  3TFY A;  1NSL A;  3D2P A;  5JPH A;  4XNH B;  3TT2 A;  1TIQ A;  5G21 A;  4FD5 A;  4UFW A;  4F0X A;  4PK2 A;  4NF1 A;  1WK4 A;  4MFJ A;  3G3S A;  4PV6 A;  4H6U A;  5AG5 A;  4UWJ A;  1M44 A;  2Z10 A;  3EXN A;  4MFQ A;  3FB3 A;  4RS2 A;  2PQ8 A;  2YNE A;  4MFP A;  4PSW A;  5AG6 A;  4A33 A;  4ZGY B;  1QST A;  2GAN A;  4XPD B;  5FVJ A;  3OWC A;  4B5P A;  1S7F A;  4KOT A;  1Z9U A;  2Q0Y A;  2FT0 A;  2I79 A;  3G8W A;  4A2Z A;  4ONU A;  2R1I A;  2ZW6 A;  3TO9 A;  1M4I A;  4CYO A;  1S3Z A;  1L0C A;  4CYN A;  3FXT A;  1SQH A;  1Z4E A;  4IF5 A;  3R9G A;  4YFJ A;  4CS0 B;  3EC4 A;  1YK3 A;  2VEZ A;  2KCW A;  3MGD A;  2VBQ A;  1R57 A;  3I9S A;  4NSQ A;  4Y49 B;  5CNP A;  5AG7 A;  4KUA A;  2J8M A;  5F48 A;  4KOW A;  4HNX B;  4MFL A;  3S6K A;  1OZP A;  3W6S A;  2C27 A;  2H5M A;  1P0H A;  1Z4R A;  2ARH A;  5KTA A;  3T90 A;  4KSA A;  2BSW A;  4LUA A;  5G22 A;  1PU9 A;  4XNH C;  3IU1 A;  1WWZ A;  3RYO A;  3CXS A;  2ATR A;  2B3V A;  2R7H A;  2OZG A;  3JVN A;  4NXY A;  3CXQ A;  2ZXV A;  2CNS A;  1MJA A;  1CJW A;  1Q2Y A;  4XPD C;  4CRZ B;  4ORF A;  4Q36 A;  2PRB A;  3R1K A;  3ZZI A;  4MBU A;  4JWP A;  4MFZ A;  4M3S A;  2JDC A;  3NE7 A;  5DWN A;  3DSB A;  1Q2D A;  4KLW A;  1FY7 A;  2Z11 A;  4F6A A;  4C68 A;  1B6B A;  2P0W A;  2O28 A;  3C26 A;  2Z3M A;  4QBJ A;  1YGH A;  4YRH A;  3FIX A;  4KLV A;  3JUW A;  1J4J A;  2B4B A;  3F8K A;  5AGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...