2PRBA

Crystal structure of aminoglycoside acetyltransferase aac(6')-ib in complex whith coenzyme a
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
176
structure length
173
Chain Sequence
b'SVTLRLMTEHDLAMLYEWLNRSHIVEWWGARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEEETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFERTRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside 6-N-acetyltransferase type Ib11
publication title Enzyme structural plasticity and the emergence of broad-spectrum antibiotic resistance.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 50
structure length 173
sequence length 176
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2007-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13523 Acetyltransf_8 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2prbA00
4KVXA 3CXPA 1UFHA 3CXSA 5IV0A 4GS4A 4B5OA 5FVJA 5J8FA 4F6AA 1BO4A 4KOUA 4NSQA 3EC4A 5EBVA 3NE7A 4MY3A 1M44A 3H4QA 1N71A 3P2HA 2P6GA 3R9GA 1MK4A 3R1KA 4QBJA 2G3TA 1P4NA 3G3SA 2WPWA 2ATRA 1WWZA 2I79A 1M4DA 3D8PA 2B5GB 2KCWA 3IGRA 1S7KA 1YVKA 4H6ZA 5DWNA 4PK2A 1Z9UA 3GKRA 4AVAA 2ARHA 3DR8A 3N7ZA 3ZJ0A 1VKCA 3V8IA 5F49A 1QSMA 2B4DA 5GCNA 2H5MA 4LX9A 3S6HA 1SQHA 4R3LA 3T9YA 3EXNA 3QB8A 2D4PA 4HNYB 4R57A 3R96A 2PC1A 4XPDB 2R1IA 4L89A 1MJBA 1QSRA 2OZUA 4R3KA 1U6MA 5HH1A 3PZJA 2J8MA 4HNWB 4QC6A 4KOYA 3KKWA 1ON0A 2QMLA 2Z10A 5JQ4A 1I21A 5IB0A 4CRYB 2FS5A 3FBUA 3IWGA 3G8WA 1Q2YA 3B8GA 2CY2A 2VZYA 3BLNA 5EC4A 1S7NA 3DDDA 2R98A 3D2PA 4UWIA 3DR6A 2JDDA 4CS0B 1Y7RA 3P2FA 5ISVA 1YLEA 4I49A 3GY9A 4CAVA 2GE3A 2C27A 4CAXA 1BOBA 3SXNA 1YR0A 4OAEA 2ZW6A 3JVNA 4PV6A 4ZBGA 2IL4A 1R57A 4U5YA 1B6BA 5DWMA 4CRZB 5HMNA 1IYLA 4FD7A 4LUAA 1YVOA 2DXQA 2X7BA 5CNPA 2QECA 4KOSA 2BEIA 4JXQA 1KZFA 2BUEA 1XF8A 1XEBA 4B5PA 5F46A 3R9FA 4UWJA 1IIDA 4KLVA 2A4NA 3EO4A 4X5KA 3DNSA 4UBRA 3F8KA 2FE7A 4JLYA 4KOXA 2ZW4A 3PP9A 2B5GA 3MGDA 2B3VA 2Q04A 1IYKA 2GIVA 4YFJA 2OZGA 1S7FA 4KUBA 2NMTA 5H86A 2O28A 2AE6A 3I9SA 3FIXA 2CNTA 1XIXA 4PSWA 4AB7A 4B5PB 1Z4RA 2Q0YA 2ZPAA 3FXTA 4II9A 4Y49C 2R7HA 1L0CA 4R87A 2GANA 4YRHA 3TCVA 2HV2A 4QUSA 2REEA 1S7LA 1S5KA 2VBQA 3K9UA 4KOTA 1YGHA 4AG9A 1IICA 4FD6A 2JEVA 1V0CA 4ONUA 3TO7A 2VEZA 4RS2A 4R9MA 2P6EA 4OLLA 2K5TA 1YX0A 1I12A 3SHPA 1M1DA 4M85A 3TE4A 4U9YA 5KTDA 1CJWA 4E8OA 4NXYA 3W6SA 1I1DA 2JLMA 2B58A 5E96A 4EVYA 4XPLA 1YK3A 1Q2DA 3LD2A 4MHDA 2ZXVA 5H84A 1KUYA 2B4BA 2OZHA 2FT0A 2HQYA 1RO5A 3I3GA 4OADA 1NMTA 4L8AA 4DNCA 4HNXB 2F5IA 2ZW5A 4AVCA 3DSBA 4NEXA 1M4GA 4MBUA 3CXQA 3TOAA 2Z0ZA 1QSNA 4KVME 2Y0MA 1S60A 4KVOE 2ZW7A 2RC4A 4JD6A 3C26A 3BJ8A 2FIWA 5F47A 1M4IA 4QVTA 4J3GA 5J8CA 1RXTA 1Y9WA 3F5BA 3TOBA 3TO9A 1Q2CA 4XNHB 2G0BA 2EVNA 2CNSA 2R8VA 2JDCA 4MI4A 2PDOA 2FXFA 5KTAA 4KOWA 2VXKA 5I0CA 5IX3A 4JWPA 4KUAA 4YGOA 2Z11A 1TIQA 3WR7A 3F0AA 3EFAA 1FY7A 2BL1A 5JPHA 3E0KA 4AG7A 4NF1A 2VZZA 1QSTA 4JJXA 2AJ6A 2P0WA 4XPDC 3FYNA 4PK3A 2Q44A 2OH1A 3TT2A 1QSOA 1LRZA 5F48A 3FB3A 1CM0A 1VHSA 2OU2A 3FRMA 4U9ZA 2CNMA 2G3AA 3UY5A 1P0HA 1K4JA 2D4OA 3R95A 4XPKA 3RYOA 3PGPA 2FIAA 2EUIA 4JXRA 1NE9A 2PR1A 4E0AA 1MJAA 1B87A 3VWDA 4AVBA 1MJ9A 1J4JA 2FL4A 3TO6A 4QB9A 3D2MA 2Q4VA 2QIRA 3D3SA 4KOVA 5C82A 2PR8A 3JUWA 3ZZIA 1Y9KA 4H6UA 4UA3A 4HKFA 3FNCA 1Z4EA 2OB0A 4KORA 1S3ZA 3VWEA 3TTHA 1OZPA 3W6XA 4H89A 4IUSA 2P6FA 3LODA 1PUAA 5KTCA 4IF5A 2BSWA 2PRBA 4Y49B 4XNHC 1KUVA 3S6KA 1XMTA 4FD5A 4M3SA 4MY0A 2VQYA 5C88A 4KZTA 4NCZA 3OWCA 1GHEA 2FSRA 3R9EA 3GYAA 2REFA 3S6FA 2B4DB 2WPXA 4E2AA 4MJ8A 1PU9A 2Q7BA 4BMHA 3SXOA 1XE4A 2PQ8A 2I00A 4RI1A 1WK4A 4K30A 4F0YA 2J8NA 3T90A 2PSWA 4CAWA 2HUZA 2FCKA 3EY5A 2VI7A 4KLWA 1YREA 3QAHA 2B3UA 4PSXA 2J8RA 3BJ7A 1KUXA 2Q4YA 3S6GA 1IB1E 3TFYA 1NSLA 3W91A 4ORFA 4FD4A
chains in the Genus database with same CATH superfamily
1LAMA 4KVXA 1TF8A 1ZG7A 2ZELA 4MRIA 5DS0A 3CXPA 4B14A 4NGRA 5LRKA 4Q7AA 3LACA 1UFHA 4LQGA 3CXSA 5IV0A 2Q43A 4GS4A 5CBMA 4F9UA 2CIJA 3FVLA 4B5OA 4FBEA 5FVJA 5J8FA 1UWYA 4F6AA 2PVVA 4UEEA 5AG7A 1BO4A 4LQ6A 3FH4A 2XEJA 4KOUA 4NSQA 3EC4A 5EBVA 3NE7A 1H8LA 1ZO0A 2PIZA 1XBUA 1Z8TA 4MY3A 1M44A 1Z8LA 4ZI6A 1YSJA 3H5ZA 4IHMA 4OMEA 3D4UA 3H4QA 1N71A 1QMUA 3P2HA 2P6GA 3R9GA 1HEEA 1MK4A 2ZEPA 3R1KA 2V77A 4QBJA 2G3TA 1FT7A 4Q36A 5D8NA 1P4NA 3G3SA 3VATA 1X10A 2WPWA 4WJBA 4MCPA 2POKA 2ATRA 3BHXA 3RNZA 4DJLA 1WWZA 2I79A 3GB0A 1M4DA 2PJ9A 3D8PA 2EK9A 2B5GB 2KCWA 4NJRA 3IGRA 2V8VA 3PB9X 1S7KA 1YVKA 4H6ZA 5DWNA 4PK2A 4M6GA 3IC1A 1Z9UA 5AG4A 3GKRA 1CG2A 4AVAA 2ARHA 2IQ6A 3HUVA 4UCMA 3MRUA 3T8WA 3DR8A 3N7ZA 3ISZA 3ZJ0A 4PQAA 1F2OA 2C6PA 4CGOA 1KWMA 1VKCA 4KSAA 4UCPA 4PXDA 5F49A 3V8IA 4B13A 1QSMA 2B4DA 5GCNA 4ZGYB 4UIBA 2H5MA 4LX9A 2XEFA 3S6HA 2V8DA 1SQHA 4O23A 4R3LA 3T9YA 3EXNA 2PJCA 3QB8A 2D4PA 2RB7A 4HNYB 4R57A 2PC1A 3R96A 3B3CA 3IJ3A 4XPDB 3WC5A 3S9LA 2R1IA 4L89A 4KSFA 1MJBA 4BBHA 2PJ3A 1QSRA 2OZUA 3KR4A 2IMOA 1IU8A 4R3KA 1BPNA 1U6MA 4YWYA 5HH1A 1LOKA 3PZJA 2J8MA 2PVWA 2PJ0A 4HNWB 4QC6A 2Z10A 1ON0A 3KKWA 2QMLA 4KOYA 5JQ4A 1I21A 5IB0A 3D68A 4CRYB 2FS5A 3FBUA 3IWGA 3G8WA 1Q2YA 1YQEA 2PIYA 2CY2A 2VZYA 3B8GA 3BLNA 3KHZA 1S7NA 4UFVA 4JYWA 5EC4A 3B3WA 5G22A 3VH9A 3DDDA 2DPSA 2R98A 4GM5A 1ELLP 3D2PA 4UWIA 2ODFA 2DEAA 2JDDA 3DR6A 1Y7RA 4IAVA 4CS0B 3P2FA 3RBUA 1FNOA 2YNCC 4BINA 1YLEA 4I49A 3GY9A 5ISVA 1AYEA 1AUGA 1CP7A 4CAVA 4CGMA 2QJ8A 1TKHA 2GE3A 2C27A 1TKJA 1Y7EA 4X2TA 4EFDA 1XFOA 4CAXA 1BOBA 3SXNA 1YR0A 1ZLIA 4OAEA 4ZY1A 2ZW6A 3JVNA 4PV6A 3D7GA 4UEZA 5ELYA 4ZBGA 2IL4A 1R57A 3WC7A 4U5YA 1B6BA 5DWMA 3SJGA 2PJ8A 4CRZB 2CTCA 4P4EA 5HMNA 1IYLA 2PJ6A 1VGYA 4FD7A 3PB7X 4FAIA 3K9TA 3B7IA 4LUAA 1YVOA 5F09A 3JTKA 2DXQA 3PBEA 2X7BA 2FVGA 4OC4A 5CNPA 2QECA 4C2YA 3LWUA 4KOSA 1VIXA 2BEIA 1KZFA 2BUEA 1XF8A 3CPAA 4JXQA 4NGMA 1XEBA 4B5PA 5F46A 1R43A 3R9FA 4UWJA 1IIDA 4KLVA 2Z3LA 2ABZA 2A4NA 2ZEMA 3EO4A 4X5KA 3DNSA 1YMEA 4M6IA 4M6HA 4ONWA 4OC1A 4UBRA 3F8KA 2FE7A 2ZEDA 4TNUA 4ZY0A 4CGNA 4JLYA 4KOXA 3PB8X 4CYOA 2ZW4A 4MFQA 1TXRA 2PJ2A 2ZEFA 3PP9A 2B5GA 3MGDA 2B3VA 4CGLA 1JWQA 3V38A 3NH8A 5I4MA 2Q04A 3D66A 2GFQA 1IYKA 1PCAA 2GIVA 2OZGA 4YFJA 1LAPA 2EK8A 1S7FA 3PFOA 4KUBA 2CF4A 2NMTA 5H86A 2O28A 3CDXA 5JGFA 2ZOGA 2AE6A 3I9SA 3FJUA 4A37A 2PCUA 4WWVA 3FIXA 1GYTA 4HPSA 2CNTA 1XIXA 4PSWA 4OC3A 4MMOA 3KHXA 4MFLA 3SI0A 3S9NA 4AB7A 4A38A 4NJQA 4B5PB 2PRQA 1Z4RA 2Q0YA 2ZPAA 3FXTA 2Z3PA 4II9A 4Y49C 3IFEA 1CPXA 2R7HA 5BWAB 5K8MA 5JH9A 1L0CA 4MCRA 4R87A 4R7MA 2GANA 4YRHA 3TCVA 2HV2A 1TF9A 4QUSA 4ZYQA 5LYFA 2REEA 1S7LA 1S5KA 2VBQA 2PJAA 3FMCA 3IO1A 4DYOA 3K9UA 4CAFA 3NFZA 4OC2A 1R3NA 4KOTA 1YGHA 2EWBA 4AG9A 2Z3MA 1IICA 4FD6A 2JEVA 4IK2A 2AFWA 3D7FA 1V0CA 4ONUA 4Z65A 3TO7A 2VEZA 2NSMA 2PJ4A 4RS2A 4TWEA 1A2ZA 3WC6A 4C2XA 1YW4A 4G1PA 4R9MA 2P6EA 3K2KA 4OC0A 4MHNA 4OLLA 2YNDA 2K5TA 1YX0A 1I12A 2BOAA 5LRJA 3SHPA 1M1DA 3LMSA 4R8FA 3DLJA 1ARLA 2WSAA 3VARA 1EE3P 4M85A 5LYDA 4U9YA 3TE4A 5KTDA 4FWUA 1CJWA 3D7DA 4E8OA 1Z2LA 4NGQA 1BAVA 5G1ZA 4F9VA 4NXYA 3W6SA 2ZOFA 4R6TA 1I1DA 2F8HA 1PYTB 2Z3NA 2JLMA 2B58A 4NGPA 5E96A 3IWWA 4F8ZA 4EVYA 4XPLA 3SJXA 4P4FA 2ANPA 5K8OA 4OIDA 1YK3A 4EWTA 1Q2DA 4MHPA 5LRGA 3LD2A 4MHDA 2ZXVA 3FECA 3BI1A 1Z8XA 5H84A 2C1CA 1ZLHA 2ZENA 4BD9A 2GLJA 3KQZA 1KUYA 4A2ZA 2B4BA 3H8FA 3BXMA 3PEIA 2OZHA 2FT0A 3H8GA 1IGBA 2HQYA 2OOTA 4CAEA 4PXBA 1RO5A 1QQ9A 2Z3KA 4OIWA 3KI9A 3RAMA 4R76A 5AGEA 5G20A 4A95A 2BO9A 3I3GA 2AFMA 3QAYA 4OADA 4YU9A 4UFWA 1NMTA 4L8AA 2JBJA 5CPAA 2PJBA 1OBRA 4DNCA 4P4DA 4NGNA 1LFWA 2F5IA 4HNXB 2ZW5A 3FEEA 4AVCA 4A32A 3DSBA 4NEXA 3NA6A 1DE4C 1M4GA 4NGTA 4MBUA 2I3CA 3CXQA 3GUXA 4PXEA 5LYIA 4MHZA 3D7HA 3TOAA 2Z0ZA 4UCNA 1QSNA 4KVME 4MCQA 2Y0MA 1S60A 4KVOE 2ZW7A 2RC4A 4JD6A 5AG5A 3MN8A 5A27A 3C26A 3BJ8A 1HDQA 2FIWA 2EO8A 3I1UA 4P4JA 4CYPA 5K8PA 1ZG9A 5F47A 3CPXA 4UFXA 1M4IA 4P4IA 4QVTA 2ZEOA 2AFSA 3B35A 4MXUA 3JRUA 5K8NA 4J3GA 4FUUA 5J8CA 4A30A 2Q4ZA 4PPZA 1RXTA 1Z8WA 3D67A 5HVFA 1YLOA 4EMEA 1Y9WA 3F5BA 5A28A 3TC8A 3TOBA 3TO9A 4P10A 4X3RA 1Q2CA 4XNHB 2G0BA 3PFEA 2EVNA 2CNSA 4CYQA 4MFJA 4C68A 2R8VA 2JDCA 4A33A 3IU2A 4MI4A 5HVHA 2PDOA 2V8GA 4JZ0A 2Z3OA 2FXFA 5KTAA 1TKFA 4B12A 4KOWA 2CTBA 1LANA 3B2YA 3PB6X 2VXKA 2ZEHA 3PB4X 5I0CA 5IX3A 4JWPA 4KUAA 4YGOA 2Z11A 1TIQA 3IWEA 1JQGA 5THWA 3WT4A 3WR7A 4B10A 3SI1A 3F0AA 4W9YA 3EFAA 2XEGA 1FY7A 2AFOA 2BL1A 2AFXA 4CGPA 5AG6A 2J9AA 4B6ZA 5JPHA 3E0KA 1YW6A 3CT9A 4AG7A 4NF1A 4C7HA 3IEHA 5EMIA 4CYNA 2VZZA 2OR4A 1QSTA 2AFZA 2GREA 2G9DA 4JJXA 2AJ6A 2P0WA 4XPDC 2GLFA 2V8HA 3FYNA 4PK3A 2Q44A 1LCPA 2OH1A 4PXCA 1CPSA 1QSOA 1LRZA 1Y0RA 5F48A 3TT2A 3FB3A 2Q7SA 4UEFA 1CM0A 1VHSA 2OU2A 3FRMA 3KL9A 3SJEA 2HB6A 4F0XA 4U9ZA 2WYRA 3KASA 5HVGA 2CXAA 5HXDA 2CNMA 1HDUA 1VHOA 2GU2A 2G3AA 2F7VA 3KQXA 3RO0A 4OC5A 3UY5A 4B11A 1CP6A 3NE8A 1F2PA 2PE3A 1P0HA 3BI0A 3DGVA 4Q38A 4ZX8A 1K4JA 2D4OA 1BLLE 4XPKA 3R95A 3RYOA 4UIAA 3PGPA 4A39A 4MFKA 2FIAA 4DUKA 2EUIA 2AFUA 3QNVA 4JXRA 1NE9A 3NH4A 4NFRA 1ARMA 2PR1A 4K3NA 2O4HA 4E0AA 1MJAA 1Q7LA 3PRTA 1ELMP 4OKOA 1AMPA 1B87A 3VWDA 4AVBA 3SJFA 4MFZA 3V7ZA 1MJ9A 2PJ5A 1J4JA 2FL4A 3TO6A 4MFPA 2BCOA 2YNEA 4QB9A 5LYLA 3WABA 3D2MA 4C7IA 3KR5A 2Q4VA 2QIRA 1ZG8A 3D3SA 4KOVA 1CX8A 3KGQA 4NGSA 5C82A 2PR8A 2RFHA 4P6YA 3JUWA 3IU1A 2C6GA 3ZZIA 4UF4A 1Y9KA 4H6UA 2XEIA 3SI2A 4UA3A 4HKFA 3FNCA 1Z4EA 2QVPA 2WZNA 2OB0A 4KORA 3IIBA 1IOIA 1S3ZA 3VWEA 3TTHA 3S9MA 6CPAA 1OZPA 3W6XA 4H89A 4IUSA 2YGWA 2P6FA 1IY7A 1F57A 3LODA 1PUAA 4AXVA 4IF5A 5KTCA 2BSWA 2PRBA 4Y49B 3N5FA 4XNHC 3A9LA 1KUVA 4A31A 3TX8A 7CPAA 4C2ZA 3S6KA 1XMTA 4RUHA 4FD5A 4M3SA 4MY0A 2VQYA 2ZEGA 5C88A 5JM6A 4MHYA 5D29A 4KZTA 1Z5RA 1RTQA 2JBKA 3ISXA 3L2NA 4NCZA 5IB9A 4MCSA 3OWCA 2IJZA 2JEWA 3GLJA 4KS9A 1GHEA 2FSRA 4X8IA 2HC9A 3R9EA 3GYAA 3PBBA 2REFA 4ZY2A 3S6FA 2B4DB 2WPXA 5G21A 4P44A 4E2AA 4MJ8A 3GIUA 1PU9A 2Q7BA 2ZEEA 1XOVA 4BMHA 3SXOA 2DF5A 3B3VA 4P4BA 1XE4A 2NYQA 2PQ8A 1M4LA 2I00A 2YNCA 4RI1A 3HLPA 2DPTA 4ZX9A 1DTDA 1WK4A 1VHEA 4K30A 4A94A 3CZXA 4F0YA 2J8NA 3T90A 2VL1A 2PSWA 4CAWA 3FEDA 2HUZA 2FCKA 2Q51A 3EY5A 1NSAA 2VI7A 4KLWA 1YREA 3QAHA 1X12A 2EBJA 4H2KA 2B3UA 4PSXA 2J8RA 3BJ7A 1KUXA 3FX6A 1CBXA 2C6CA 2QYVA 3NH5A 2Q4YA 8CPAA 3B3TA 3H8EA 1BPMA 1XMBA 2PJ1A 4OP4A 3B3SA 3S6GA 1IOFA 1IB1E 2WUUA 1Y0YA 4CPAA 1NSLA 3TFYA 3W91A 5J1QA 3KZWA 1XRYA 1XJOA 3FF3A 4KSIA 3RZAA 2PJ7A 4ORFA 4RN7A 2O53A 4GXHA 4FD4A 4P45A
chains in the Genus database with same CATH topology
4KVXA 3CXPA 4B14A 1UFHA 3CXSA 5IV0A 4GS4A 4B5OA 5FVJA 5J8FA 4F6AA 5AG7A 1BO4A 4KOUA 4NSQA 3EC4A 5EBVA 3NE7A 1ZO0A 4MY3A 1M44A 3H5ZA 3H4QA 1N71A 3P2HA 2P6GA 3R9GA 1MK4A 3R1KA 4QBJA 2G3TA 4Q36A 1P4NA 3G3SA 2WPWA 2ATRA 1WWZA 2I79A 1M4DA 3D8PA 2B5GB 2KCWA 3IGRA 1S7KA 1YVKA 4H6ZA 5DWNA 4PK2A 5AG4A 1Z9UA 3GKRA 4AVAA 2ARHA 4UCMA 3DR8A 3N7ZA 3ZJ0A 4CGOA 1VKCA 4KSAA 4UCPA 5F49A 3V8IA 4ZGYB 4B13A 1QSMA 2B4DA 5GCNA 2H5MA 4LX9A 3S6HA 1SQHA 4R3LA 3T9YA 3EXNA 3QB8A 2D4PA 4HNYB 4R57A 3R96A 2PC1A 4XPDB 2R1IA 4L89A 4KSFA 1MJBA 4BBHA 1QSRA 2OZUA 4R3KA 1U6MA 5HH1A 3PZJA 2J8MA 4HNWB 4QC6A 2Z10A 3KKWA 1ON0A 2QMLA 4KOYA 5JQ4A 1I21A 5IB0A 4CRYB 2FS5A 3FBUA 3IWGA 3G8WA 1Q2YA 3B8GA 2CY2A 2VZYA 3BLNA 4UFVA 5EC4A 1S7NA 5G22A 3DDDA 2DPSA 2R98A 3D2PA 4UWIA 3DR6A 2JDDA 4CS0B 1Y7RA 3P2FA 2YNCC 5ISVA 1YLEA 4I49A 3GY9A 4CAVA 4CGMA 2GE3A 2C27A 4CAXA 1BOBA 3SXNA 1YR0A 4OAEA 2ZW6A 3JVNA 4PV6A 4ZBGA 2IL4A 1R57A 4U5YA 1B6BA 5DWMA 4CRZB 5HMNA 1IYLA 4FD7A 4LUAA 1YVOA 3JTKA 2DXQA 2X7BA 5CNPA 2QECA 4C2YA 4KOSA 2BEIA 4JXQA 1KZFA 2BUEA 1XF8A 1XEBA 4B5PA 5F46A 3R9FA 4UWJA 1IIDA 4KLVA 2Z3LA 2A4NA 3EO4A 4X5KA 3DNSA 4UBRA 3F8KA 2FE7A 4CGNA 4JLYA 4KOXA 4CYOA 2ZW4A 4MFQA 3PP9A 2B5GA 3MGDA 2B3VA 4CGLA 2Q04A 1IYKA 2GIVA 4YFJA 2OZGA 1S7FA 4KUBA 2NMTA 5H86A 2O28A 2AE6A 3I9SA 3FIXA 2CNTA 1XIXA 4PSWA 4MFLA 4AB7A 4B5PB 1Z4RA 2Q0YA 2ZPAA 3FXTA 2Z3PA 4II9A 4Y49C 2R7HA 5BWAB 1L0CA 4R87A 2GANA 4YRHA 3TCVA 2HV2A 4QUSA 2REEA 1S7LA 1S5KA 2VBQA 3K9UA 4CAFA 4KOTA 1YGHA 4AG9A 2Z3MA 1IICA 4FD6A 2JEVA 1V0CA 4ONUA 3TO7A 2VEZA 4RS2A 4C2XA 4R9MA 2P6EA 4OLLA 2YNDA 2K5TA 1YX0A 1I12A 3SHPA 1M1DA 2WSAA 4M85A 3TE4A 4U9YA 5KTDA 1CJWA 4E8OA 5G1ZA 4NXYA 3W6SA 1I1DA 2Z3NA 2JLMA 2B58A 5E96A 4EVYA 4XPLA 1YK3A 1Q2DA 3LD2A 4MHDA 2ZXVA 5H84A 1KUYA 4A2ZA 2B4BA 2OZHA 2FT0A 2HQYA 4CAEA 1RO5A 2Z3KA 5AGEA 5G20A 4A95A 3I3GA 4OADA 4UFWA 1NMTA 4L8AA 4DNCA 4HNXB 2F5IA 2ZW5A 4AVCA 4A32A 3DSBA 4NEXA 1M4GA 4MBUA 3CXQA 3TOAA 2Z0ZA 4UCNA 1QSNA 4KVME 2Y0MA 1S60A 4KVOE 2ZW7A 2RC4A 4JD6A 5AG5A 5A27A 3C26A 3BJ8A 2FIWA 4CYPA 5F47A 4UFXA 1M4IA 4QVTA 4J3GA 5J8CA 4A30A 1RXTA 1Y9WA 3F5BA 5A28A 3TOBA 3TO9A 1Q2CA 4XNHB 2G0BA 2EVNA 2CNSA 4CYQA 4MFJA 4C68A 2R8VA 2JDCA 4A33A 3IU2A 4MI4A 2PDOA 2Z3OA 2FXFA 5KTAA 4B12A 4KOWA 2VXKA 5I0CA 5IX3A 4JWPA 4KUAA 4YGOA 2Z11A 1TIQA 3IWEA 3WR7A 3F0AA 3EFAA 1FY7A 2BL1A 4CGPA 5AG6A 5JPHA 3E0KA 4AG7A 4NF1A 4C7HA 4CYNA 2VZZA 1QSTA 4JJXA 2AJ6A 2P0WA 4XPDC 3FYNA 4PK3A 2Q44A 2OH1A 3TT2A 1QSOA 1LRZA 5F48A 3FB3A 1CM0A 1VHSA 2OU2A 3FRMA 4F0XA 4U9ZA 2CXAA 2CNMA 2G3AA 3UY5A 4B11A 1P0HA 4Q38A 1K4JA 2D4OA 3R95A 4XPKA 3RYOA 3PGPA 4MFKA 2FIAA 2EUIA 4JXRA 1NE9A 2PR1A 4E0AA 1MJAA 1B87A 3VWDA 4AVBA 4MFZA 1MJ9A 1J4JA 2FL4A 3TO6A 4MFPA 2YNEA 4QB9A 3D2MA 4C7IA 2Q4VA 2QIRA 3D3SA 4KOVA 5C82A 2PR8A 3JUWA 3IU1A 3ZZIA 1Y9KA 4H6UA 4UA3A 4HKFA 3FNCA 1Z4EA 2OB0A 4KORA 1S3ZA 3VWEA 3TTHA 1OZPA 3W6XA 4H89A 4IUSA 2YGWA 2P6FA 3LODA 1PUAA 5KTCA 4IF5A 2BSWA 2PRBA 4Y49B 4XNHC 3A9LA 1KUVA 4A31A 4C2ZA 3S6KA 1XMTA 4FD5A 4M3SA 4MY0A 2VQYA 5C88A 4KZTA 4NCZA 3OWCA 4KS9A 1GHEA 2FSRA 3R9EA 3GYAA 2REFA 3S6FA 2B4DB 2WPXA 5G21A 4E2AA 4MJ8A 1PU9A 2Q7BA 4BMHA 3SXOA 1XE4A 2PQ8A 4B10A 2I00A 2YNCA 4RI1A 2DPTA 1WK4A 4K30A 4F0YA 2J8NA 3T90A 2PSWA 4CAWA 2HUZA 2FCKA 3EY5A 2VI7A 4KLWA 1YREA 3QAHA 2B3UA 4PSXA 2J8RA 3BJ7A 1KUXA 2Q4YA 3S6GA 1IB1E 2WUUA 3TFYA 1NSLA 3W91A 4ORFA 4FD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KVX A;  3CXP A;  1UFH A;  3CXS A;  5IV0 A;  4GS4 A;  4B5O A;  5FVJ A;  5J8F A;  4F6A A;  1BO4 A;  4KOU A;  4NSQ A;  3EC4 A;  5EBV A;  3NE7 A;  4MY3 A;  1M44 A;  3H4Q A;  1N71 A;  3P2H A;  2P6G A;  3R9G A;  1MK4 A;  3R1K A;  4QBJ A;  2G3T A;  1P4N A;  3G3S A;  2WPW A;  2ATR A;  1WWZ A;  2I79 A;  1M4D A;  3D8P A;  2B5G B;  2KCW A;  3IGR A;  1S7K A;  1YVK A;  4H6Z A;  5DWN A;  4PK2 A;  1Z9U A;  3GKR A;  4AVA A;  2ARH A;  3DR8 A;  3N7Z A;  3ZJ0 A;  1VKC A;  3V8I A;  5F49 A;  1QSM A;  2B4D A;  5GCN A;  2H5M A;  4LX9 A;  3S6H A;  1SQH A;  4R3L A;  3T9Y A;  3EXN A;  3QB8 A;  2D4P A;  4HNY B;  4R57 A;  3R96 A;  2PC1 A;  4XPD B;  2R1I A;  4L89 A;  1MJB A;  1QSR A;  2OZU A;  4R3K A;  1U6M A;  5HH1 A;  3PZJ A;  2J8M A;  4HNW B;  4QC6 A;  4KOY A;  3KKW A;  1ON0 A;  2QML A;  2Z10 A;  5JQ4 A;  1I21 A;  5IB0 A;  4CRY B;  2FS5 A;  3FBU A;  3IWG A;  3G8W A;  1Q2Y A;  3B8G A;  2CY2 A;  2VZY A;  3BLN A;  5EC4 A;  1S7N A;  3DDD A;  2R98 A;  3D2P A;  4UWI A;  3DR6 A;  2JDD A;  4CS0 B;  1Y7R A;  3P2F A;  5ISV A;  1YLE A;  4I49 A;  3GY9 A;  4CAV A;  2GE3 A;  2C27 A;  4CAX A;  1BOB A;  3SXN A;  1YR0 A;  4OAE A;  2ZW6 A;  3JVN A;  4PV6 A;  4ZBG A;  2IL4 A;  1R57 A;  4U5Y A;  1B6B A;  5DWM A;  4CRZ B;  5HMN A;  1IYL A;  4FD7 A;  4LUA A;  1YVO A;  2DXQ A;  2X7B A;  5CNP A;  2QEC A;  4KOS A;  2BEI A;  4JXQ A;  1KZF A;  2BUE A;  1XF8 A;  1XEB A;  4B5P A;  5F46 A;  3R9F A;  4UWJ A;  1IID A;  4KLV A;  2A4N A;  3EO4 A;  4X5K A;  3DNS A;  4UBR A;  3F8K A;  2FE7 A;  4JLY A;  4KOX A;  2ZW4 A;  3PP9 A;  2B5G A;  3MGD A;  2B3V A;  2Q04 A;  1IYK A;  2GIV A;  4YFJ A;  2OZG A;  1S7F A;  4KUB A;  2NMT A;  5H86 A;  2O28 A;  2AE6 A;  3I9S A;  3FIX A;  2CNT A;  1XIX A;  4PSW A;  4AB7 A;  4B5P B;  1Z4R A;  2Q0Y A;  2ZPA A;  3FXT A;  4II9 A;  4Y49 C;  2R7H A;  1L0C A;  4R87 A;  2GAN A;  4YRH A;  3TCV A;  2HV2 A;  4QUS A;  2REE A;  1S7L A;  1S5K A;  2VBQ A;  3K9U A;  4KOT A;  1YGH A;  4AG9 A;  1IIC A;  4FD6 A;  2JEV A;  1V0C A;  4ONU A;  3TO7 A;  2VEZ A;  4RS2 A;  4R9M A;  2P6E A;  4OLL A;  2K5T A;  1YX0 A;  1I12 A;  3SHP A;  1M1D A;  4M85 A;  3TE4 A;  4U9Y A;  5KTD A;  1CJW A;  4E8O A;  4NXY A;  3W6S A;  1I1D A;  2JLM A;  2B58 A;  5E96 A;  4EVY A;  4XPL A;  1YK3 A;  1Q2D A;  3LD2 A;  4MHD A;  2ZXV A;  5H84 A;  1KUY A;  2B4B A;  2OZH A;  2FT0 A;  2HQY A;  1RO5 A;  3I3G A;  4OAD A;  1NMT A;  4L8A A;  4DNC A;  4HNX B;  2F5I A;  2ZW5 A;  4AVC A;  3DSB A;  4NEX A;  1M4G A;  4MBU A;  3CXQ A;  3TOA A;  2Z0Z A;  1QSN A;  4KVM E;  2Y0M A;  1S60 A;  4KVO E;  2ZW7 A;  2RC4 A;  4JD6 A;  3C26 A;  3BJ8 A;  2FIW A;  5F47 A;  1M4I A;  4QVT A;  4J3G A;  5J8C A;  1RXT A;  1Y9W A;  3F5B A;  3TOB A;  3TO9 A;  1Q2C A;  4XNH B;  2G0B A;  2EVN A;  2CNS A;  2R8V A;  2JDC A;  4MI4 A;  2PDO A;  2FXF A;  5KTA A;  4KOW A;  2VXK A;  5I0C A;  5IX3 A;  4JWP A;  4KUA A;  4YGO A;  2Z11 A;  1TIQ A;  3WR7 A;  3F0A A;  3EFA A;  1FY7 A;  2BL1 A;  5JPH A;  3E0K A;  4AG7 A;  4NF1 A;  2VZZ A;  1QST A;  4JJX A;  2AJ6 A;  2P0W A;  4XPD C;  3FYN A;  4PK3 A;  2Q44 A;  2OH1 A;  3TT2 A;  1QSO A;  1LRZ A;  5F48 A;  3FB3 A;  1CM0 A;  1VHS A;  2OU2 A;  3FRM A;  4U9Z A;  2CNM A;  2G3A A;  3UY5 A;  1P0H A;  1K4J A;  2D4O A;  3R95 A;  4XPK A;  3RYO A;  3PGP A;  2FIA A;  2EUI A;  4JXR A;  1NE9 A;  2PR1 A;  4E0A A;  1MJA A;  1B87 A;  3VWD A;  4AVB A;  1MJ9 A;  1J4J A;  2FL4 A;  3TO6 A;  4QB9 A;  3D2M A;  2Q4V A;  2QIR A;  3D3S A;  4KOV A;  5C82 A;  2PR8 A;  3JUW A;  3ZZI A;  1Y9K A;  4H6U A;  4UA3 A;  4HKF A;  3FNC A;  1Z4E A;  2OB0 A;  4KOR A;  1S3Z A;  3VWE A;  3TTH A;  1OZP A;  3W6X A;  4H89 A;  4IUS A;  2P6F A;  3LOD A;  1PUA A;  5KTC A;  4IF5 A;  2BSW A;  2PRB A;  4Y49 B;  4XNH C;  1KUV A;  3S6K A;  1XMT A;  4FD5 A;  4M3S A;  4MY0 A;  2VQY A;  5C88 A;  4KZT A;  4NCZ A;  3OWC A;  1GHE A;  2FSR A;  3R9E A;  3GYA A;  2REF A;  3S6F A;  2B4D B;  2WPX A;  4E2A A;  4MJ8 A;  1PU9 A;  2Q7B A;  4BMH A;  3SXO A;  1XE4 A;  2PQ8 A;  2I00 A;  4RI1 A;  1WK4 A;  4K30 A;  4F0Y A;  2J8N A;  3T90 A;  2PSW A;  4CAW A;  2HUZ A;  2FCK A;  3EY5 A;  2VI7 A;  4KLW A;  1YRE A;  3QAH A;  2B3U A;  4PSX A;  2J8R A;  3BJ7 A;  1KUX A;  2Q4Y A;  3S6G A;  1IB1 E;  3TFY A;  1NSL A;  3W91 A;  4ORF A;  4FD4 A; 
#chains in the Genus database with same CATH topology
 1LAM A;  4KVX A;  1TF8 A;  1ZG7 A;  2ZEL A;  4MRI A;  5DS0 A;  3CXP A;  4B14 A;  4NGR A;  5LRK A;  4Q7A A;  3LAC A;  1UFH A;  4LQG A;  3CXS A;  5IV0 A;  2Q43 A;  4GS4 A;  5CBM A;  4F9U A;  2CIJ A;  3FVL A;  4B5O A;  4FBE A;  5FVJ A;  5J8F A;  1UWY A;  4F6A A;  2PVV A;  4UEE A;  5AG7 A;  1BO4 A;  4LQ6 A;  3FH4 A;  2XEJ A;  4KOU A;  4NSQ A;  3EC4 A;  5EBV A;  3NE7 A;  1H8L A;  1ZO0 A;  2PIZ A;  1XBU A;  1Z8T A;  4MY3 A;  1M44 A;  1Z8L A;  4ZI6 A;  1YSJ A;  3H5Z A;  4IHM A;  4OME A;  3D4U A;  3H4Q A;  1N71 A;  1QMU A;  3P2H A;  2P6G A;  3R9G A;  1HEE A;  1MK4 A;  2ZEP A;  3R1K A;  2V77 A;  4QBJ A;  2G3T A;  1FT7 A;  4Q36 A;  5D8N A;  1P4N A;  3G3S A;  3VAT A;  1X10 A;  2WPW A;  4WJB A;  4MCP A;  2POK A;  2ATR A;  3BHX A;  3RNZ A;  4DJL A;  1WWZ A;  2I79 A;  3GB0 A;  1M4D A;  2PJ9 A;  3D8P A;  2EK9 A;  2B5G B;  2KCW A;  4NJR A;  3IGR A;  2V8V A;  3PB9 X;  1S7K A;  1YVK A;  4H6Z A;  5DWN A;  4PK2 A;  4M6G A;  3IC1 A;  1Z9U A;  5AG4 A;  3GKR A;  1CG2 A;  4AVA A;  2ARH A;  2IQ6 A;  3HUV A;  4UCM A;  3MRU A;  3T8W A;  3DR8 A;  3N7Z A;  3ISZ A;  3ZJ0 A;  4PQA A;  1F2O A;  2C6P A;  4CGO A;  1KWM A;  1VKC A;  4KSA A;  4UCP A;  4PXD A;  5F49 A;  3V8I A;  4B13 A;  1QSM A;  2B4D A;  5GCN A;  4ZGY B;  4UIB A;  2H5M A;  4LX9 A;  2XEF A;  3S6H A;  2V8D A;  1SQH A;  4O23 A;  4R3L A;  3T9Y A;  3EXN A;  2PJC A;  3QB8 A;  2D4P A;  2RB7 A;  4HNY B;  4R57 A;  2PC1 A;  3R96 A;  3B3C A;  3IJ3 A;  4XPD B;  3WC5 A;  3S9L A;  2R1I A;  4L89 A;  4KSF A;  1MJB A;  4BBH A;  2PJ3 A;  1QSR A;  2OZU A;  3KR4 A;  2IMO A;  1IU8 A;  4R3K A;  1BPN A;  1U6M A;  4YWY A;  5HH1 A;  1LOK A;  3PZJ A;  2J8M A;  2PVW A;  2PJ0 A;  4HNW B;  4QC6 A;  2Z10 A;  1ON0 A;  3KKW A;  2QML A;  4KOY A;  5JQ4 A;  1I21 A;  5IB0 A;  3D68 A;  4CRY B;  2FS5 A;  3FBU A;  3IWG A;  3G8W A;  1Q2Y A;  1YQE A;  2PIY A;  2CY2 A;  2VZY A;  3B8G A;  3BLN A;  3KHZ A;  1S7N A;  4UFV A;  4JYW A;  5EC4 A;  3B3W A;  5G22 A;  3VH9 A;  3DDD A;  2DPS A;  2R98 A;  4GM5 A;  1ELL P;  3D2P A;  4UWI A;  2ODF A;  2DEA A;  2JDD A;  3DR6 A;  1Y7R A;  4IAV A;  4CS0 B;  3P2F A;  3RBU A;  1FNO A;  2YNC C;  4BIN A;  1YLE A;  4I49 A;  3GY9 A;  5ISV A;  1AYE A;  1AUG A;  1CP7 A;  4CAV A;  4CGM A;  2QJ8 A;  1TKH A;  2GE3 A;  2C27 A;  1TKJ A;  1Y7E A;  4X2T A;  4EFD A;  1XFO A;  4CAX A;  1BOB A;  3SXN A;  1YR0 A;  1ZLI A;  4OAE A;  4ZY1 A;  2ZW6 A;  3JVN A;  4PV6 A;  3D7G A;  4UEZ A;  5ELY A;  4ZBG A;  2IL4 A;  1R57 A;  3WC7 A;  4U5Y A;  1B6B A;  5DWM A;  3SJG A;  2PJ8 A;  4CRZ B;  2CTC A;  4P4E A;  5HMN A;  1IYL A;  2PJ6 A;  1VGY A;  4FD7 A;  3PB7 X;  4FAI A;  3K9T A;  3B7I A;  4LUA A;  1YVO A;  5F09 A;  3JTK A;  2DXQ A;  3PBE A;  2X7B A;  2FVG A;  4OC4 A;  5CNP A;  2QEC A;  4C2Y A;  3LWU A;  4KOS A;  1VIX A;  2BEI A;  1KZF A;  2BUE A;  1XF8 A;  3CPA A;  4JXQ A;  4NGM A;  1XEB A;  4B5P A;  5F46 A;  1R43 A;  3R9F A;  4UWJ A;  1IID A;  4KLV A;  2Z3L A;  2ABZ A;  2A4N A;  2ZEM A;  3EO4 A;  4X5K A;  3DNS A;  1YME A;  4M6I A;  4M6H A;  4ONW A;  4OC1 A;  4UBR A;  3F8K A;  2FE7 A;  2ZED A;  4TNU A;  4ZY0 A;  4CGN A;  4JLY A;  4KOX A;  3PB8 X;  4CYO A;  2ZW4 A;  4MFQ A;  1TXR A;  2PJ2 A;  2ZEF A;  3PP9 A;  2B5G A;  3MGD A;  2B3V A;  4CGL A;  1JWQ A;  3V38 A;  3NH8 A;  5I4M A;  2Q04 A;  3D66 A;  2GFQ A;  1IYK A;  1PCA A;  2GIV A;  2OZG A;  4YFJ A;  1LAP A;  2EK8 A;  1S7F A;  3PFO A;  4KUB A;  2CF4 A;  2NMT A;  5H86 A;  2O28 A;  3CDX A;  5JGF A;  2ZOG A;  2AE6 A;  3I9S A;  3FJU A;  4A37 A;  2PCU A;  4WWV A;  3FIX A;  1GYT A;  4HPS A;  2CNT A;  1XIX A;  4PSW A;  4OC3 A;  4MMO A;  3KHX A;  4MFL A;  3SI0 A;  3S9N A;  4AB7 A;  4A38 A;  4NJQ A;  4B5P B;  2PRQ A;  1Z4R A;  2Q0Y A;  2ZPA A;  3FXT A;  2Z3P A;  4II9 A;  4Y49 C;  3IFE A;  1CPX A;  2R7H A;  5BWA B;  5K8M A;  5JH9 A;  1L0C A;  4MCR A;  4R87 A;  4R7M A;  2GAN A;  4YRH A;  3TCV A;  2HV2 A;  1TF9 A;  4QUS A;  4ZYQ A;  5LYF A;  2REE A;  1S7L A;  1S5K A;  2VBQ A;  2PJA A;  3FMC A;  3IO1 A;  4DYO A;  3K9U A;  4CAF A;  3NFZ A;  4OC2 A;  1R3N A;  4KOT A;  1YGH A;  2EWB A;  4AG9 A;  2Z3M A;  1IIC A;  4FD6 A;  2JEV A;  4IK2 A;  2AFW A;  3D7F A;  1V0C A;  4ONU A;  4Z65 A;  3TO7 A;  2VEZ A;  2NSM A;  2PJ4 A;  4RS2 A;  4TWE A;  1A2Z A;  3WC6 A;  4C2X A;  1YW4 A;  4G1P A;  4R9M A;  2P6E A;  3K2K A;  4OC0 A;  4MHN A;  4OLL A;  2YND A;  2K5T A;  1YX0 A;  1I12 A;  2BOA A;  5LRJ A;  3SHP A;  1M1D A;  3LMS A;  4R8F A;  3DLJ A;  1ARL A;  2WSA A;  3VAR A;  1EE3 P;  4M85 A;  5LYD A;  4U9Y A;  3TE4 A;  5KTD A;  4FWU A;  1CJW A;  3D7D A;  4E8O A;  1Z2L A;  4NGQ A;  1BAV A;  5G1Z A;  4F9V A;  4NXY A;  3W6S A;  2ZOF A;  4R6T A;  1I1D A;  2F8H A;  1PYT B;  2Z3N A;  2JLM A;  2B58 A;  4NGP A;  5E96 A;  3IWW A;  4F8Z A;  4EVY A;  4XPL A;  3SJX A;  4P4F A;  2ANP A;  5K8O A;  4OID A;  1YK3 A;  4EWT A;  1Q2D A;  4MHP A;  5LRG A;  3LD2 A;  4MHD A;  2ZXV A;  3FEC A;  3BI1 A;  1Z8X A;  5H84 A;  2C1C A;  1ZLH A;  2ZEN A;  4BD9 A;  2GLJ A;  3KQZ A;  1KUY A;  4A2Z A;  2B4B A;  3H8F A;  3BXM A;  3PEI A;  2OZH A;  2FT0 A;  3H8G A;  1IGB A;  2HQY A;  2OOT A;  4CAE A;  4PXB A;  1RO5 A;  1QQ9 A;  2Z3K A;  4OIW A;  3KI9 A;  3RAM A;  4R76 A;  5AGE A;  5G20 A;  4A95 A;  2BO9 A;  3I3G A;  2AFM A;  3QAY A;  4OAD A;  4YU9 A;  4UFW A;  1NMT A;  4L8A A;  2JBJ A;  5CPA A;  2PJB A;  1OBR A;  4DNC A;  4P4D A;  4NGN A;  1LFW A;  2F5I A;  4HNX B;  2ZW5 A;  3FEE A;  4AVC A;  4A32 A;  3DSB A;  4NEX A;  3NA6 A;  1DE4 C;  1M4G A;  4NGT A;  4MBU A;  2I3C A;  3CXQ A;  3GUX A;  4PXE A;  5LYI A;  4MHZ A;  3D7H A;  3TOA A;  2Z0Z A;  4UCN A;  1QSN A;  4KVM E;  4MCQ A;  2Y0M A;  1S60 A;  4KVO E;  2ZW7 A;  2RC4 A;  4JD6 A;  5AG5 A;  3MN8 A;  5A27 A;  3C26 A;  3BJ8 A;  1HDQ A;  2FIW A;  2EO8 A;  3I1U A;  4P4J A;  4CYP A;  5K8P A;  1ZG9 A;  5F47 A;  3CPX A;  4UFX A;  1M4I A;  4P4I A;  4QVT A;  2ZEO A;  2AFS A;  3B35 A;  4MXU A;  3JRU A;  5K8N A;  4J3G A;  4FUU A;  5J8C A;  4A30 A;  2Q4Z A;  4PPZ A;  1RXT A;  1Z8W A;  3D67 A;  5HVF A;  1YLO A;  4EME A;  1Y9W A;  3F5B A;  5A28 A;  3TC8 A;  3TOB A;  3TO9 A;  4P10 A;  4X3R A;  1Q2C A;  4XNH B;  2G0B A;  3PFE A;  2EVN A;  2CNS A;  4CYQ A;  4MFJ A;  4C68 A;  2R8V A;  2JDC A;  4A33 A;  3IU2 A;  4MI4 A;  5HVH A;  2PDO A;  2V8G A;  4JZ0 A;  2Z3O A;  2FXF A;  5KTA A;  1TKF A;  4B12 A;  4KOW A;  2CTB A;  1LAN A;  3B2Y A;  3PB6 X;  2VXK A;  2ZEH A;  3PB4 X;  5I0C A;  5IX3 A;  4JWP A;  4KUA A;  4YGO A;  2Z11 A;  1TIQ A;  3IWE A;  1JQG A;  5THW A;  3WT4 A;  3WR7 A;  4B10 A;  3SI1 A;  3F0A A;  4W9Y A;  3EFA A;  2XEG A;  1FY7 A;  2AFO A;  2BL1 A;  2AFX A;  4CGP A;  5AG6 A;  2J9A A;  4B6Z A;  5JPH A;  3E0K A;  1YW6 A;  3CT9 A;  4AG7 A;  4NF1 A;  4C7H A;  3IEH A;  5EMI A;  4CYN A;  2VZZ A;  2OR4 A;  1QST A;  2AFZ A;  2GRE A;  2G9D A;  4JJX A;  2AJ6 A;  2P0W A;  4XPD C;  2GLF A;  2V8H A;  3FYN A;  4PK3 A;  2Q44 A;  1LCP A;  2OH1 A;  4PXC A;  1CPS A;  1QSO A;  1LRZ A;  1Y0R A;  5F48 A;  3TT2 A;  3FB3 A;  2Q7S A;  4UEF A;  1CM0 A;  1VHS A;  2OU2 A;  3FRM A;  3KL9 A;  3SJE A;  2HB6 A;  4F0X A;  4U9Z A;  2WYR A;  3KAS A;  5HVG A;  2CXA A;  5HXD A;  2CNM A;  1HDU A;  1VHO A;  2GU2 A;  2G3A A;  2F7V A;  3KQX A;  3RO0 A;  4OC5 A;  3UY5 A;  4B11 A;  1CP6 A;  3NE8 A;  1F2P A;  2PE3 A;  1P0H A;  3BI0 A;  3DGV A;  4Q38 A;  4ZX8 A;  1K4J A;  2D4O A;  1BLL E;  4XPK A;  3R95 A;  3RYO A;  4UIA A;  3PGP A;  4A39 A;  4MFK A;  2FIA A;  4DUK A;  2EUI A;  2AFU A;  3QNV A;  4JXR A;  1NE9 A;  3NH4 A;  4NFR A;  1ARM A;  2PR1 A;  4K3N A;  2O4H A;  4E0A A;  1MJA A;  1Q7L A;  3PRT A;  1ELM P;  4OKO A;  1AMP A;  1B87 A;  3VWD A;  4AVB A;  3SJF A;  4MFZ A;  3V7Z A;  1MJ9 A;  2PJ5 A;  1J4J A;  2FL4 A;  3TO6 A;  4MFP A;  2BCO A;  2YNE A;  4QB9 A;  5LYL A;  3WAB A;  3D2M A;  4C7I A;  3KR5 A;  2Q4V A;  2QIR A;  1ZG8 A;  3D3S A;  4KOV A;  1CX8 A;  3KGQ A;  4NGS A;  5C82 A;  2PR8 A;  2RFH A;  4P6Y A;  3JUW A;  3IU1 A;  2C6G A;  3ZZI A;  4UF4 A;  1Y9K A;  4H6U A;  2XEI A;  3SI2 A;  4UA3 A;  4HKF A;  3FNC A;  1Z4E A;  2QVP A;  2WZN A;  2OB0 A;  4KOR A;  3IIB A;  1IOI A;  1S3Z A;  3VWE A;  3TTH A;  3S9M A;  6CPA A;  1OZP A;  3W6X A;  4H89 A;  4IUS A;  2YGW A;  2P6F A;  1IY7 A;  1F57 A;  3LOD A;  1PUA A;  4AXV A;  4IF5 A;  5KTC A;  2BSW A;  2PRB A;  4Y49 B;  3N5F A;  4XNH C;  3A9L A;  1KUV A;  4A31 A;  3TX8 A;  7CPA A;  4C2Z A;  3S6K A;  1XMT A;  4RUH A;  4FD5 A;  4M3S A;  4MY0 A;  2VQY A;  2ZEG A;  5C88 A;  5JM6 A;  4MHY A;  5D29 A;  4KZT A;  1Z5R A;  1RTQ A;  2JBK A;  3ISX A;  3L2N A;  4NCZ A;  5IB9 A;  4MCS A;  3OWC A;  2IJZ A;  2JEW A;  3GLJ A;  4KS9 A;  1GHE A;  2FSR A;  4X8I A;  2HC9 A;  3R9E A;  3GYA A;  3PBB A;  2REF A;  4ZY2 A;  3S6F A;  2B4D B;  2WPX A;  5G21 A;  4P44 A;  4E2A A;  4MJ8 A;  3GIU A;  1PU9 A;  2Q7B A;  2ZEE A;  1XOV A;  4BMH A;  3SXO A;  2DF5 A;  3B3V A;  4P4B A;  1XE4 A;  2NYQ A;  2PQ8 A;  1M4L A;  2I00 A;  2YNC A;  4RI1 A;  3HLP A;  2DPT A;  4ZX9 A;  1DTD A;  1WK4 A;  1VHE A;  4K30 A;  4A94 A;  3CZX A;  4F0Y A;  2J8N A;  3T90 A;  2VL1 A;  2PSW A;  4CAW A;  3FED A;  2HUZ A;  2FCK A;  2Q51 A;  3EY5 A;  1NSA A;  2VI7 A;  4KLW A;  1YRE A;  3QAH A;  1X12 A;  2EBJ A;  4H2K A;  2B3U A;  4PSX A;  2J8R A;  3BJ7 A;  1KUX A;  3FX6 A;  1CBX A;  2C6C A;  2QYV A;  3NH5 A;  2Q4Y A;  8CPA A;  3B3T A;  3H8E A;  1BPM A;  1XMB A;  2PJ1 A;  4OP4 A;  3B3S A;  3S6G A;  1IOF A;  1IB1 E;  2WUU A;  1Y0Y A;  4CPA A;  1NSL A;  3TFY A;  3W91 A;  5J1Q A;  3KZW A;  1XRY A;  1XJO A;  3FF3 A;  4KSI A;  3RZA A;  2PJ7 A;  4ORF A;  4RN7 A;  2O53 A;  4GXH A;  4FD4 A;  4P45 A; 
#chains in the Genus database with same CATH homology
 4KVX A;  3CXP A;  4B14 A;  1UFH A;  3CXS A;  5IV0 A;  4GS4 A;  4B5O A;  5FVJ A;  5J8F A;  4F6A A;  5AG7 A;  1BO4 A;  4KOU A;  4NSQ A;  3EC4 A;  5EBV A;  3NE7 A;  1ZO0 A;  4MY3 A;  1M44 A;  3H5Z A;  3H4Q A;  1N71 A;  3P2H A;  2P6G A;  3R9G A;  1MK4 A;  3R1K A;  4QBJ A;  2G3T A;  4Q36 A;  1P4N A;  3G3S A;  2WPW A;  2ATR A;  1WWZ A;  2I79 A;  1M4D A;  3D8P A;  2B5G B;  2KCW A;  3IGR A;  1S7K A;  1YVK A;  4H6Z A;  5DWN A;  4PK2 A;  5AG4 A;  1Z9U A;  3GKR A;  4AVA A;  2ARH A;  4UCM A;  3DR8 A;  3N7Z A;  3ZJ0 A;  4CGO A;  1VKC A;  4KSA A;  4UCP A;  5F49 A;  3V8I A;  4ZGY B;  4B13 A;  1QSM A;  2B4D A;  5GCN A;  2H5M A;  4LX9 A;  3S6H A;  1SQH A;  4R3L A;  3T9Y A;  3EXN A;  3QB8 A;  2D4P A;  4HNY B;  4R57 A;  3R96 A;  2PC1 A;  4XPD B;  2R1I A;  4L89 A;  4KSF A;  1MJB A;  4BBH A;  1QSR A;  2OZU A;  4R3K A;  1U6M A;  5HH1 A;  3PZJ A;  2J8M A;  4HNW B;  4QC6 A;  2Z10 A;  3KKW A;  1ON0 A;  2QML A;  4KOY A;  5JQ4 A;  1I21 A;  5IB0 A;  4CRY B;  2FS5 A;  3FBU A;  3IWG A;  3G8W A;  1Q2Y A;  3B8G A;  2CY2 A;  2VZY A;  3BLN A;  4UFV A;  5EC4 A;  1S7N A;  5G22 A;  3DDD A;  2DPS A;  2R98 A;  3D2P A;  4UWI A;  3DR6 A;  2JDD A;  4CS0 B;  1Y7R A;  3P2F A;  2YNC C;  5ISV A;  1YLE A;  4I49 A;  3GY9 A;  4CAV A;  4CGM A;  2GE3 A;  2C27 A;  4CAX A;  1BOB A;  3SXN A;  1YR0 A;  4OAE A;  2ZW6 A;  3JVN A;  4PV6 A;  4ZBG A;  2IL4 A;  1R57 A;  4U5Y A;  1B6B A;  5DWM A;  4CRZ B;  5HMN A;  1IYL A;  4FD7 A;  4LUA A;  1YVO A;  3JTK A;  2DXQ A;  2X7B A;  5CNP A;  2QEC A;  4C2Y A;  4KOS A;  2BEI A;  4JXQ A;  1KZF A;  2BUE A;  1XF8 A;  1XEB A;  4B5P A;  5F46 A;  3R9F A;  4UWJ A;  1IID A;  4KLV A;  2Z3L A;  2A4N A;  3EO4 A;  4X5K A;  3DNS A;  4UBR A;  3F8K A;  2FE7 A;  4CGN A;  4JLY A;  4KOX A;  4CYO A;  2ZW4 A;  4MFQ A;  3PP9 A;  2B5G A;  3MGD A;  2B3V A;  4CGL A;  2Q04 A;  1IYK A;  2GIV A;  4YFJ A;  2OZG A;  1S7F A;  4KUB A;  2NMT A;  5H86 A;  2O28 A;  2AE6 A;  3I9S A;  3FIX A;  2CNT A;  1XIX A;  4PSW A;  4MFL A;  4AB7 A;  4B5P B;  1Z4R A;  2Q0Y A;  2ZPA A;  3FXT A;  2Z3P A;  4II9 A;  4Y49 C;  2R7H A;  5BWA B;  1L0C A;  4R87 A;  2GAN A;  4YRH A;  3TCV A;  2HV2 A;  4QUS A;  2REE A;  1S7L A;  1S5K A;  2VBQ A;  3K9U A;  4CAF A;  4KOT A;  1YGH A;  4AG9 A;  2Z3M A;  1IIC A;  4FD6 A;  2JEV A;  1V0C A;  4ONU A;  3TO7 A;  2VEZ A;  4RS2 A;  4C2X A;  4R9M A;  2P6E A;  4OLL A;  2YND A;  2K5T A;  1YX0 A;  1I12 A;  3SHP A;  1M1D A;  2WSA A;  4M85 A;  3TE4 A;  4U9Y A;  5KTD A;  1CJW A;  4E8O A;  5G1Z A;  4NXY A;  3W6S A;  1I1D A;  2Z3N A;  2JLM A;  2B58 A;  5E96 A;  4EVY A;  4XPL A;  1YK3 A;  1Q2D A;  3LD2 A;  4MHD A;  2ZXV A;  5H84 A;  1KUY A;  4A2Z A;  2B4B A;  2OZH A;  2FT0 A;  2HQY A;  4CAE A;  1RO5 A;  2Z3K A;  5AGE A;  5G20 A;  4A95 A;  3I3G A;  4OAD A;  4UFW A;  1NMT A;  4L8A A;  4DNC A;  4HNX B;  2F5I A;  2ZW5 A;  4AVC A;  4A32 A;  3DSB A;  4NEX A;  1M4G A;  4MBU A;  3CXQ A;  3TOA A;  2Z0Z A;  4UCN A;  1QSN A;  4KVM E;  2Y0M A;  1S60 A;  4KVO E;  2ZW7 A;  2RC4 A;  4JD6 A;  5AG5 A;  5A27 A;  3C26 A;  3BJ8 A;  2FIW A;  4CYP A;  5F47 A;  4UFX A;  1M4I A;  4QVT A;  4J3G A;  5J8C A;  4A30 A;  1RXT A;  1Y9W A;  3F5B A;  5A28 A;  3TOB A;  3TO9 A;  1Q2C A;  4XNH B;  2G0B A;  2EVN A;  2CNS A;  4CYQ A;  4MFJ A;  4C68 A;  2R8V A;  2JDC A;  4A33 A;  3IU2 A;  4MI4 A;  2PDO A;  2Z3O A;  2FXF A;  5KTA A;  4B12 A;  4KOW A;  2VXK A;  5I0C A;  5IX3 A;  4JWP A;  4KUA A;  4YGO A;  2Z11 A;  1TIQ A;  3IWE A;  3WR7 A;  3F0A A;  3EFA A;  1FY7 A;  2BL1 A;  4CGP A;  5AG6 A;  5JPH A;  3E0K A;  4AG7 A;  4NF1 A;  4C7H A;  4CYN A;  2VZZ A;  1QST A;  4JJX A;  2AJ6 A;  2P0W A;  4XPD C;  3FYN A;  4PK3 A;  2Q44 A;  2OH1 A;  3TT2 A;  1QSO A;  1LRZ A;  5F48 A;  3FB3 A;  1CM0 A;  1VHS A;  2OU2 A;  3FRM A;  4F0X A;  4U9Z A;  2CXA A;  2CNM A;  2G3A A;  3UY5 A;  4B11 A;  1P0H A;  4Q38 A;  1K4J A;  2D4O A;  3R95 A;  4XPK A;  3RYO A;  3PGP A;  4MFK A;  2FIA A;  2EUI A;  4JXR A;  1NE9 A;  2PR1 A;  4E0A A;  1MJA A;  1B87 A;  3VWD A;  4AVB A;  4MFZ A;  1MJ9 A;  1J4J A;  2FL4 A;  3TO6 A;  4MFP A;  2YNE A;  4QB9 A;  3D2M A;  4C7I A;  2Q4V A;  2QIR A;  3D3S A;  4KOV A;  5C82 A;  2PR8 A;  3JUW A;  3IU1 A;  3ZZI A;  1Y9K A;  4H6U A;  4UA3 A;  4HKF A;  3FNC A;  1Z4E A;  2OB0 A;  4KOR A;  1S3Z A;  3VWE A;  3TTH A;  1OZP A;  3W6X A;  4H89 A;  4IUS A;  2YGW A;  2P6F A;  3LOD A;  1PUA A;  5KTC A;  4IF5 A;  2BSW A;  2PRB A;  4Y49 B;  4XNH C;  3A9L A;  1KUV A;  4A31 A;  4C2Z A;  3S6K A;  1XMT A;  4FD5 A;  4M3S A;  4MY0 A;  2VQY A;  5C88 A;  4KZT A;  4NCZ A;  3OWC A;  4KS9 A;  1GHE A;  2FSR A;  3R9E A;  3GYA A;  2REF A;  3S6F A;  2B4D B;  2WPX A;  5G21 A;  4E2A A;  4MJ8 A;  1PU9 A;  2Q7B A;  4BMH A;  3SXO A;  1XE4 A;  2PQ8 A;  4B10 A;  2I00 A;  2YNC A;  4RI1 A;  2DPT A;  1WK4 A;  4K30 A;  4F0Y A;  2J8N A;  3T90 A;  2PSW A;  4CAW A;  2HUZ A;  2FCK A;  3EY5 A;  2VI7 A;  4KLW A;  1YRE A;  3QAH A;  2B3U A;  4PSX A;  2J8R A;  3BJ7 A;  1KUX A;  2Q4Y A;  3S6G A;  1IB1 E;  2WUU A;  3TFY A;  1NSL A;  3W91 A;  4ORF A;  4FD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...