2PRBA

Crystal structure of aminoglycoside acetyltransferase aac(6')-ib in complex whith coenzyme a
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
176
structure length
173
Chain Sequence
b'SVTLRLMTEHDLAMLYEWLNRSHIVEWWGARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEEETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFERTRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enzyme structural plasticity and the emergence of broad-spectrum antibiotic resistance.
pubmed doi rcsb
molecule keywords Aminoglycoside 6-N-acetyltransferase type Ib11
source organism Salmonella typhimurium
molecule tags Transferase
total genus 50
structure length 173
sequence length 176
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2007-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13523 Acetyltransf_8 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2prbA00
1WK4A 1XIXA 2G3TA 2QMLA 4XNHB 4L89A 3G3SA 4OADA 2HUZA 3G8WA 2F5IA 3QAHA 1YK3A 4E0AA 1BOBA 1YVKA 4JJXA 3JVNA 3S6FA 4PK2A 1KUYA 2FXFA 2GIVA 1B6BA 4F6AA 3DNSA 3MGDA 1CM0A 2D4OA 3R9EA 2J8NA 2PDOA 3EY5A 4K30A 1YREA 1IIDA 4BMHA 4IUSA 2G0BA 4PSXA 4UWJA 2CY2A 2Z0ZA 2G3AA 1BO4A 1YX0A 5C82A 2P6EA 4NEXA 4QVTA 1L0CA 2I79A 4B5PB 2Z10A 2CNSA 1M4IA 3GYAA 4B5OA 2I00A 2Q4YA 3SXNA 2H5MA 5F49A 2PR1A 4H89A 4FD5A 4PV6A 1M4GA 3F0AA 2Q04A 5J8CA 3BLNA 4X5KA 4CAWA 3T9YA 5EC4A 1S5KA 2EVNA 3D2PA 3BJ7A 3TO9A 4E2AA 3JUWA 4KLVA 2FT0A 2OB0A 2WPWA 4NXYA 4AVBA 4KOWA 2P6GA 4L8AA 2B4DB 1S60A 2KCWA 2P0WA 5HMNA 1M44A 4IF5A 1XF8A 1I12A 3VWEA 4KOYA 1Y7RA 4AB7A 3NE7A 4LUAA 4II9A 2A4NA 4KUAA 5JQ4A 5F46A 4KLWA 3GY9A 3TO7A 1R57A 2Z11A 4AG9A 1Q2YA 2D4PA 3IWGA 4NSQA 1VHSA 3KKWA 2B4BA 1P4NA 2OZUA 5H84A 2IL4A 3ZJ0A 1P0HA 5GCNA 4XPKA 1TIQA 3FIXA 4KUBA 3TT2A 1Z9UA 4CS0B 4JWPA 3C26A 4MHDA 2PSWA 2OH1A 3H4QA 4CAVA 4NCZA 3S6HA 3CXQA 3R95A 2PC1A 3F8KA 3PZJA 4FD7A 3V8IA 1KUVA 1Q2CA 4GS4A 3F5BA 2K5TA 2ZW4A 1GHEA 2ZW6A 1IB1E 4QBJA 1RO5A 2FE7A 1RXTA 4JLYA 4KOXA 1QSRA 3DDDA 3DR6A 4YRHA 4U9ZA 1CJWA 4AVAA 1KUXA 2ZXVA 4LX9A 3N7ZA 1V0CA 4UBRA 2EUIA 3FRMA 5EBVA 2HQYA 1YGHA 1J4JA 1XE4A 4FD6A 4MY3A 2PQ8A 1QSNA 2CNTA 1IYKA 3CXPA 1WWZA 1YLEA 2J8RA 3RYOA 3BJ8A 3K9UA 3P2HA 3TOAA 2JEVA 3UY5A 1XEBA 3D2MA 2NMTA 1I21A 1M4DA 5I0CA 2Q4VA 4YGOA 2OZHA 3FXTA 3LD2A 4M3SA 2X7BA 4AG7A 1PUAA 4QUSA 1QSMA 1NMTA 1PU9A 4KVXA 2VBQA 3S6GA 1QSOA 4YFJA 5IV0A 4M85A 5F48A 4B5PA 4J3GA 4E8OA 5ISVA 4ONUA 3I3GA 5KTAA 5H86A 3FNCA 2REEA 2O28A 1YR0A 2B5GB 1UFHA 5CNPA 3W6SA 4FD4A 2FCKA 2J8MA 4KOSA 1SQHA 4F0YA 2JDCA 1MK4A 1S7FA 2Y0MA 5F47A 3QB8A 1MJ9A 1Z4EA 4HNWB 4CAXA 3DR8A 3EC4A 4KOVA 2REFA 1Y9KA 2B4DA 5KTCA 1U6MA 4KOTA 5IB0A 2RC4A 2BL1A 4UA3A 3SHPA 3TOBA 5C88A 4KORA 2ARHA 2FS5A 2HV2A 4HNXB 4QC6A 2BEIA 4XPLA 2ZPAA 1MJBA 2PRBA 4H6UA 3CXSA 2ZW7A 4EVYA 4HKFA 4U9YA 4ORFA 4R57A 1M1DA 3EO4A 5FVJA 5HH1A 4CRZB 4OAEA 2R1IA 1VKCA 3PGPA 3B8GA 3D3SA 4Y49B 1FY7A 4DNCA 4R3LA 2QIRA 1I1DA 2FIAA 4KOUA 1N71A 4JD6A 3W91A 3DSBA 3R96A 3I9SA 3S6KA 3SXOA 1IICA 1NSLA 3E0KA 1IYLA 2Q0YA 3ZZIA 2B58A 2Q44A 2VXKA 1OZPA 5KTDA 3PP9A 1MJAA 1S3ZA 3TE4A 2FL4A 3EXNA 4JXQA 1S7KA 2DXQA 1Y9WA 4MJ8A 2VQYA 4XPDB 4U5YA 3D8PA 1Q2DA 5IX3A 3OWCA 1B87A 1K4JA 4KVOE 2AE6A 4R3KA 3TFYA 3P2FA 4OLLA 4HNYB 5DWNA 4I49A 4AVCA 3FB3A 2JDDA 3TO6A 1QSTA 3IGRA 4MY0A 4PSWA 4KVME 1XMTA 1KZFA 3FYNA 2ATRA 4ZBGA 4MI4A 1ON0A 1NE9A 2C27A 2VZZA 3TTHA 4JXRA 4XNHC 5JPHA 2CNMA 4KZTA 1YVOA 1S7NA 2VZYA 4Y49C 2GANA 4R87A 5DWMA 2GE3A 2B3UA 4UWIA 3R1KA 4NF1A 2R98A 2OZGA 2JLMA 4PK3A 5J8FA 2R8VA 2Q7BA 3WR7A 4RS2A 2AJ6A 2PR8A 4R9MA 3R9FA 2B5GA 3TCVA 3R9GA 1LRZA 4H6ZA 2ZW5A 3W6XA 2OU2A 2FSRA 2P6FA 3FBUA 3LODA 4QB9A 2VI7A 3GKRA 5E96A 2WPXA 4RI1A 4CRYB 2FIWA 3EFAA 2QECA 2BSWA 4XPDC 2R7HA 2VEZA 1Z4RA 2B3VA 3T90A 1S7LA 3VWDA 4MBUA 2BUEA
chains in the Genus database with same CATH superfamily
3SI2A 3QAYA 1WK4A 2ZENA 3A9LA 4W9YA 4C68A 4Z65A 1XIXA 4CGNA 2G3TA 2QMLA 4CGMA 4ZY2A 3ISZA 4XNHB 2EK8A 4Q38A 4A39A 4AXVA 4CYNA 5J1QA 4L89A 3G3SA 4OADA 2HUZA 2DEAA 3G8WA 2F5IA 2ZEOA 3RO0A 3QAHA 2ZEDA 2QYVA 2ZEMA 3PEIA 4R6TA 1YK3A 2EK9A 4E0AA 1BOBA 5LRGA 1YVKA 3B2YA 4JJXA 1BPNA 3JVNA 3S6FA 4MHYA 1F57A 1ELMP 4PK2A 3JRUA 4BBHA 3RBUA 3S9LA 4UEEA 1KUYA 2FXFA 1OBRA 2GIVA 5I4MA 1B6BA 3PB6X 4F6AA 3DNSA 3MGDA 1ZLHA 2ABZA 1JWQA 4JYWA 5CPAA 1CM0A 3D7FA 2D4OA 4F9UA 1Z8LA 3R9EA 3FEDA 5HVGA 2J8NA 4OC3A 5DS0A 4IHMA 2PDOA 3PBBA 3EY5A 3IWWA 3LWUA 3CPAA 4UCPA 2DF5A 4A37A 5D8NA 4K30A 1EE3P 1YREA 1IIDA 4BMHA 3N5FA 2RFHA 2G0BA 4IUSA 4PSXA 5D29A 2JBKA 4UWJA 2CY2A 1DTDA 5THWA 4NGMA 3KL9A 2Z0ZA 3CPXA 3GUXA 2G3AA 1BO4A 3NFZA 5AG7A 3PFOA 1YX0A 1CG2A 5C82A 2P6EA 4KSIA 4ZX9A 4NEXA 1LCPA 4QVTA 1L0CA 2I79A 4B5PB 2CTCA 2Z10A 5LRJA 2DPTA 5G22A 2CNSA 1YQEA 1CP7A 3WABA 2XEJA 2IJZA 2NSMA 1ZG7A 2FVGA 1M4IA 3GYAA 4B5OA 2I00A 2YNCC 2Q4YA 3SXNA 2H5MA 3FVLA 1Q7LA 4OC4A 5EMIA 5F49A 2PR1A 1ZG8A 1PYTB 2Z3PA 4FD5A 4H89A 3JTKA 4PV6A 5LYDA 2VL1A 2AFWA 1CPSA 5K8NA 1M4GA 4KSAA 1PCAA 2Q43A 3F0AA 2Q04A 5J8CA 5K8MA 3BLNA 4X5KA 4CAWA 1AUGA 2Q51A 3T9YA 5EC4A 1S5KA 1VHEA 2EVNA 2EBJA 4OKOA 3D2PA 2V8HA 3HLPA 4CGOA 2PIYA 4M6HA 3BJ7A 2V8DA 2YNDA 3TO9A 2QJ8A 4E2AA 4H2KA 3JUWA 4KLVA 1F2OA 2FT0A 2OB0A 2WPWA 4R8FA 3ISXA 4NXYA 4AVBA 4KOWA 2P6GA 4L8AA 4B6ZA 3H8EA 2B4DB 1S60A 2KCWA 2P0WA 4Q7AA 3V38A 5HMNA 1M44A 4IF5A 4UF4A 1XF8A 1I12A 1CP6A 2AFOA 2PJ8A 1KWMA 3BHXA 2PIZA 5HVFA 3KR4A 3VWEA 2YGWA 4KOYA 1Y7RA 4FAIA 3MRUA 4AB7A 3NE7A 3DGVA 4LUAA 3DLJA 4NJRA 5CBMA 8CPAA 5LRKA 2CXAA 2A4NA 2BO9A 2OR4A 2PJ4A 4KUAA 4PXDA 5JQ4A 5F46A 4KLWA 4FBEA 3GY9A 2G9DA 4A38A 3TO7A 2CTBA 4OMEA 3WC6A 3TX8A 1LAPA 4C2XA 1R57A 2Z11A 4AG9A 1Q2YA 2GREA 2D4PA 3KQXA 1LANA 3IWGA 4NSQA 1VHSA 3KKWA 1LAMA 2B4BA 3FF3A 1P4NA 2OZUA 5H84A 2IL4A 3ZJ0A 4C2ZA 1P0HA 4X8IA 3B3VA 5GCNA 4XPKA 5LYIA 1TIQA 4ZI6A 3FIXA 3RNZA 4KUBA 3TT2A 4X2TA 1Z9UA 2ZEHA 3HUVA 4CS0B 1Z2LA 4JWPA 1DE4C 3C26A 4MFQA 4MHDA 2ANPA 2OH1A 2PSWA 4MMOA 4OIWA 3H4QA 4CAVA 4MHZA 5JH9A 4NCZA 4A33A 3S6HA 3WC7A 3WC5A 3CXQA 3R95A 3D67A 2PC1A 4F9VA 3FX6A 3F8KA 1TKFA 2HC9A 3PZJA 4FD7A 3V8IA 4MHPA 5A27A 4P6YA 1KUVA 1Q2CA 3FECA 2PJ6A 4LQGA 4GS4A 3F5BA 2K5TA 2ZW4A 1GHEA 1ZO0A 5A28A 2ZW6A 1ZLIA 1IB1E 3NA6A 4QBJA 1RO5A 2FE7A 1RXTA 1YW6A 4CPAA 4RUHA 4JLYA 4KOXA 3H8FA 1QSRA 3DDDA 3DR6A 4YRHA 4ZYQA 4GM5A 4U9ZA 3B3SA 1CJWA 2XEGA 4PXBA 1IOIA 4AVAA 1KUXA 2ZXVA 4LX9A 3N7ZA 1V0CA 4UBRA 2EUIA 1XFOA 3FRMA 5EBVA 2HQYA 1YGHA 4NFRA 4Q36A 1J4JA 1XE4A 4FD6A 4UCMA 4UEFA 4PPZA 4MY3A 3PB9X 1BAVA 1QSNA 2PQ8A 2CNTA 1VIXA 1IYKA 5G20A 5LYFA 1X12A 4A32A 5F09A 1F2PA 4DJLA 2Z3NA 3CXPA 4MFZA 2CIJA 2PJ7A 1WWZA 1YLEA 2J8RA 5G1ZA 3RYOA 3BJ8A 3K9UA 1CBXA 3P2HA 3PB7X 4M6GA 3TOAA 3SI0A 4UFXA 5K8OA 2JEVA 3UY5A 1XEBA 1BPMA 3PBEA 3IO1A 5K8PA 1YSJA 2Z3LA 3D2MA 2O53A 2NMTA 4FWUA 4CGLA 4R76A 1I21A 1M4DA 2IMOA 4UIBA 1NSAA 5I0CA 1X10A 2C6PA 4UIAA 3GIUA 3IEHA 4GXHA 1Y0YA 3D4UA 2Q4VA 3TC8A 4YGOA 2Z3OA 5G21A 2OZHA 3FXTA 3LD2A 2PJ0A 1AYEA 4P4DA 3D7HA 4CYQA 2F7VA 4M3SA 2X7BA 4MCSA 2ZEPA 4AG7A 1PUAA 4C2YA 4QUSA 1XOVA 1QMUA 1QSMA 1YW4A 3FMCA 1NMTA 3KASA 1PU9A 4KVXA 2VBQA 3S6GA 2O4HA 1QSOA 4MXUA 4YFJA 5IV0A 4M85A 1VHOA 1JQGA 4J3GA 5F48A 1GYTA 4B5PA 4G1PA 4E8OA 4ONUA 3I3GA 5IB9A 5ISVA 2ZELA 3B3TA 4B12A 5KTAA 1YMEA 3SI1A 3BI0A 4NGPA 4C7IA 5H86A 2EWBA 3FNCA 4UCNA 3L2NA 2REEA 4MFJA 4C7HA 4R7MA 7CPAA 4B10A 2O28A 1CPXA 1YR0A 2B5GB 1UFHA 3B3CA 5CNPA 3I1UA 1ARLA 4NGNA 1ARMA 1ZG9A 2DPSA 2PJBA 3W6SA 4FD4A 2FCKA 2J8MA 2RB7A 4KOSA 1SQHA 4PQAA 5AG4A 4F0YA 4ZY0A 2JDCA 2V8GA 1MK4A 1S7FA 2Y0MA 4OP4A 5F47A 4A2ZA 3QB8A 3IWEA 3KI9A 1Y0RA 1MJ9A 1Z4EA 5JM6A 4HNWB 4CAXA 3DR8A 4WJBA 4MCRA 2V8VA 2C6CA 2EO8A 3EC4A 2HB6A 2POKA 4KOVA 2REFA 4NJQA 1Y9KA 2B4DA 4UFWA 4EFDA 4P4FA 5KTCA 1U6MA 3PRTA 4KOTA 5IB0A 2RC4A 3PB8X 2WUUA 4LQ6A 3VATA 3T8WA 2I3CA 4YWYA 2BL1A 4UA3A 3FEEA 2F8HA 4BD9A 5AGEA 3SHPA 3TOBA 2PJ9A 4YU9A 3LACA 5C88A 4II9A 4HPSA 4ZY1A 5ELYA 4KORA 2ARHA 4K3NA 2FS5A 2GLJA 2HV2A 3IU1A 4X3RA 1R3NA 1HDUA 6CPAA 3LMSA 4CAEA 4HNXB 4QC6A 2BOAA 2BEIA 3MN8A 4XPLA 3D68A 3KQZA 4O23A 2ZPAA 1MJBA 2PRBA 4ONWA 4H6UA 3CXSA 2ZW7A 1QQ9A 2YNCA 4HKFA 4U9YA 4EVYA 1LFWA 2XEIA 3BXMA 4ORFA 4BINA 4R57A 1M1DA 3EO4A 3VH9A 5FVJA 2C1CA 5HH1A 4CRZB 4WWVA 3S9MA 4OAEA 2R1IA 1VKCA 2YNEA 2WSAA 2WZNA 3PGPA 3B8GA 2PJ3A 3D3SA 1A2ZA 1FY7A 4Y49B 4DNCA 2PE3A 2XEFA 4P4EA 1IU8A 4A94A 4R3LA 2QIRA 1I1DA 2FIAA 3B35A 2PVWA 4KOUA 1N71A 4OC1A 3SJXA 1TKHA 4JD6A 3W91A 1Y7EA 3DSBA 3R96A 1HDQA 1XRYA 3I9SA 4A30A 4B11A 3IC1A 3S6KA 3SXOA 1IICA 1NSLA 3E0KA 1IYLA 2Q0YA 3ZZIA 2B58A 3H5ZA 2Q44A 2VXKA 2NYQA 1OZPA 3H8GA 3BI1A 5KTDA 3PP9A 1MJAA 1S3ZA 3GB0A 1AMPA 4TNUA 2BCOA 3TE4A 2AFMA 2FL4A 3EXNA 3PB4X 4JXQA 1S7KA 2J9AA 2AFUA 2Z3KA 2DXQA 1Y9WA 4MJ8A 4NGQA 3KR5A 4CYOA 4MFPA 3SJFA 2PJ2A 2VQYA 4P4IA 4U5YA 4XPDB 3D8PA 3VARA 2QVPA 1Q2DA 5IX3A 3OWCA 1B87A 1K4JA 4KVOE 1XBUA 1TKJA 2PJAA 2AE6A 1M4LA 4R3KA 4B14A 1HEEA 3TFYA 3P2FA 1Z8XA 4HNYB 4OLLA 5DWNA 2OOTA 4I49A 4AVCA 3QNVA 4TWEA 3IJ3A 4OIDA 3FB3A 2JDDA 4IAVA 1H8LA 2JEWA 5BWAB 4CYPA 3NH5A 3TO6A 4P4JA 4DYOA 1QSTA 2C6GA 3IGRA 3SJGA 1TF9A 3SJEA 3D7DA 2JBJA 4MY0A 4PSWA 1UWYA 3B7IA 2ZEGA 4OC5A 4KVME 3RZAA 3NE8A 1XMTA 4MCQA 2GU2A 3CZXA 2IQ6A 2PJ5A 1KZFA 4M6IA 3FYNA 4P10A 2ATRA 4MFLA 4KSFA 4JZ0A 4ZBGA 4MI4A 4MCPA 1CX8A 3KHZA 4UEZA 3NH8A 2PCUA 3KGQA 1ON0A 4PXEA 5JGFA 1NE9A 2C27A 2VZZA 4NGSA 3TTHA 4JXRA 4OC0A 4XNHC 3WT4A 4F0XA 5JPHA 2AFXA 2CNMA 1YVOA 4KZTA 1S7NA 2VZYA 1FT7A 4CGPA 1IOFA 2PRQA 3IFEA 4Y49C 3FJUA 2GANA 4FUUA 4R87A 5DWMA 5LYLA 2GE3A 2B3UA 2GLFA 3B3WA 3PFEA 4UWIA 5AG6A 2AFZA 3R1KA 4P45A 4NF1A 2R98A 2AFSA 4IK2A 2OZGA 4NGTA 1TF8A 4EWTA 2Q4ZA 2JLMA 1XJOA 2GFQA 3KZWA 4PK3A 5J8FA 2R8VA 2PJCA 2ZEFA 2PJ1A 2Q7BA 4DUKA 3WR7A 1VGYA 2AJ6A 1IGBA 2PR8A 4R9MA 4RS2A 3R9FA 4CAFA 1BLLE 1IY7A 1Z5RA 2B5GA 1ELLP 2ZEEA 3FH4A 3K9TA 3R9GA 3TCVA 1LRZA 4H6ZA 4EMEA 2ZW5A 3W6XA 3S9NA 2OU2A 1TXRA 2WYRA 2Q7SA 3NH4A 3CT9A 2FSRA 3D7GA 2P6FA 3FBUA 3K2KA 3LODA 4OC2A 4UFVA 2PVVA 4MHNA 4QB9A 4MRIA 1FNOA 2V77A 4RN7A 5AG5A 2ZOGA 1LOKA 2VI7A 3D66A 3GKRA 5E96A 3KHXA 4A95A 2WPXA 1YLOA 4P44A 4RI1A 4CRYB 5HVHA 3RAMA 3CDXA 1XMBA 2FIWA 3EFAA 3V7ZA 2QECA 2BSWA 3IU2A 5HXDA 4XPDC 1RTQA 2ZOFA 4NGRA 3IIBA 4KS9A 4ZGYB 2R7HA 4ZX8A 2VEZA 4P4BA 1Z4RA 4F8ZA 2B3VA 2ODFA 3T90A 1S7LA 3VWDA 2Z3MA 1Z8WA 1Z8TA 4A31A 4MBUA 4PXCA 2CF4A 3GLJA 4MFKA 4B13A 2BUEA 1R43A
chains in the Genus database with same CATH topology
1WK4A 3A9LA 4C68A 1XIXA 4CGNA 2G3TA 2QMLA 4CGMA 4CYNA 4XNHB 4Q38A 4L89A 3G3SA 4OADA 2HUZA 3G8WA 2F5IA 3QAHA 1YK3A 4E0AA 1BOBA 1YVKA 4JJXA 3JVNA 3S6FA 4PK2A 4BBHA 1KUYA 2FXFA 2GIVA 1B6BA 4F6AA 3DNSA 3MGDA 1CM0A 2D4OA 3R9EA 2J8NA 2PDOA 3EY5A 4UCPA 4K30A 1YREA 1IIDA 4BMHA 4IUSA 2G0BA 4PSXA 4UWJA 2CY2A 2Z0ZA 2G3AA 1BO4A 5AG7A 1YX0A 5C82A 2P6EA 4NEXA 4QVTA 1L0CA 2I79A 4B5PB 2Z10A 2DPTA 5G22A 2CNSA 1M4IA 3GYAA 4B5OA 2I00A 2YNCC 2Q4YA 3SXNA 2H5MA 5F49A 2PR1A 4H89A 2Z3PA 4FD5A 3JTKA 4PV6A 1M4GA 4KSAA 3F0AA 2Q04A 5J8CA 3BLNA 4X5KA 4CAWA 3T9YA 5EC4A 1S5KA 2EVNA 4CGOA 3D2PA 3BJ7A 2YNDA 3TO9A 4E2AA 3JUWA 4KLVA 2FT0A 2OB0A 2WPWA 4NXYA 4AVBA 4KOWA 2P6GA 4L8AA 2B4DB 1S60A 2KCWA 2P0WA 5HMNA 1M44A 4IF5A 1XF8A 1I12A 3VWEA 2YGWA 4KOYA 1Y7RA 4AB7A 3NE7A 4LUAA 4II9A 2CXAA 2A4NA 4KUAA 5JQ4A 5F46A 4KLWA 3GY9A 3TO7A 4C2XA 1R57A 2Z11A 4AG9A 1Q2YA 2D4PA 3IWGA 4NSQA 1VHSA 3KKWA 2B4BA 1P4NA 2OZUA 5H84A 2IL4A 3ZJ0A 4C2ZA 1P0HA 5GCNA 4XPKA 1TIQA 3FIXA 4KUBA 3TT2A 1Z9UA 4CS0B 4JWPA 4MFQA 3C26A 4MHDA 2PSWA 2OH1A 3H4QA 4CAVA 4NCZA 4A33A 3S6HA 3CXQA 3R95A 2PC1A 3F8KA 3PZJA 4FD7A 3V8IA 5A27A 1KUVA 1Q2CA 4GS4A 3F5BA 2K5TA 2ZW4A 1GHEA 1ZO0A 5A28A 2ZW6A 1IB1E 4QBJA 1RO5A 2FE7A 1RXTA 4JLYA 4KOXA 1QSRA 3DDDA 3DR6A 4YRHA 4U9ZA 1CJWA 4AVAA 1KUXA 2ZXVA 4LX9A 3N7ZA 1V0CA 4UBRA 2EUIA 3FRMA 5EBVA 2HQYA 1YGHA 4Q36A 1J4JA 1XE4A 4FD6A 4UCMA 4MY3A 2PQ8A 1QSNA 2CNTA 1IYKA 5G20A 4A32A 2Z3NA 3CXPA 4MFZA 1WWZA 1YLEA 2J8RA 5G1ZA 3RYOA 3BJ8A 3K9UA 3P2HA 3TOAA 4UFXA 2JEVA 3UY5A 1XEBA 2Z3LA 3D2MA 2NMTA 4CGLA 1I21A 1M4DA 5I0CA 2Q4VA 4YGOA 2Z3OA 5G21A 2OZHA 3FXTA 3LD2A 4CYQA 4M3SA 2X7BA 4AG7A 1PUAA 4C2YA 4QUSA 1QSMA 1NMTA 1PU9A 4KVXA 2VBQA 3S6GA 1QSOA 4YFJA 5IV0A 4M85A 5F48A 4B5PA 4J3GA 4E8OA 5ISVA 4ONUA 3I3GA 4B12A 5KTAA 4C7IA 5H86A 3FNCA 4UCNA 2REEA 4MFJA 4C7HA 4B10A 2O28A 1YR0A 2B5GB 1UFHA 5CNPA 2DPSA 3W6SA 4FD4A 2FCKA 2J8MA 4KOSA 1SQHA 5AG4A 4F0YA 2JDCA 1MK4A 1S7FA 2Y0MA 5F47A 4A2ZA 3QB8A 3IWEA 1MJ9A 1Z4EA 4HNWB 4CAXA 3DR8A 3EC4A 4KOVA 2REFA 1Y9KA 2B4DA 4UFWA 5KTCA 1U6MA 4KOTA 5IB0A 2RC4A 2WUUA 2BL1A 4UA3A 5AGEA 3SHPA 3TOBA 5C88A 4KORA 2ARHA 2FS5A 3IU1A 2HV2A 4CAEA 4HNXB 4QC6A 2BEIA 4XPLA 2ZPAA 1MJBA 2PRBA 4H6UA 3CXSA 2ZW7A 2YNCA 4EVYA 4HKFA 4U9YA 4ORFA 4R57A 1M1DA 3EO4A 5FVJA 5HH1A 4CRZB 4OAEA 2R1IA 1VKCA 2YNEA 2WSAA 3PGPA 3B8GA 3D3SA 4Y49B 1FY7A 4DNCA 4R3LA 2QIRA 1I1DA 2FIAA 4KOUA 1N71A 4JD6A 3W91A 3DSBA 3R96A 3I9SA 4A30A 4B11A 3S6KA 3SXOA 1IICA 1NSLA 3E0KA 1IYLA 2Q0YA 3ZZIA 2B58A 3H5ZA 2Q44A 2VXKA 1OZPA 5KTDA 3PP9A 1MJAA 1S3ZA 3TE4A 2FL4A 3EXNA 4JXQA 1S7KA 2Z3KA 2DXQA 1Y9WA 4MJ8A 4CYOA 4MFPA 2VQYA 4XPDB 4U5YA 3D8PA 1Q2DA 5IX3A 3OWCA 1B87A 1K4JA 4KVOE 2AE6A 4R3KA 4B14A 3TFYA 3P2FA 4OLLA 4HNYB 5DWNA 4I49A 4AVCA 3FB3A 2JDDA 5BWAB 4CYPA 3TO6A 1QSTA 3IGRA 4MY0A 4PSWA 4KVME 1XMTA 1KZFA 3FYNA 2ATRA 4MFLA 4KSFA 4ZBGA 4MI4A 1ON0A 1NE9A 2C27A 2VZZA 3TTHA 4JXRA 4XNHC 5JPHA 4F0XA 2CNMA 4KZTA 1YVOA 4CGPA 1S7NA 2VZYA 4Y49C 2GANA 4R87A 5DWMA 2GE3A 2B3UA 4UWIA 5AG6A 3R1KA 4NF1A 2R98A 2OZGA 2JLMA 4PK3A 5J8FA 2R8VA 2Q7BA 3WR7A 4RS2A 2AJ6A 2PR8A 4R9MA 3R9FA 4CAFA 2B5GA 3TCVA 3R9GA 1LRZA 4H6ZA 2ZW5A 3W6XA 2OU2A 2FSRA 2P6FA 3FBUA 3LODA 4UFVA 4QB9A 5AG5A 3GKRA 2VI7A 5E96A 4A95A 2WPXA 4RI1A 4CRYB 2FIWA 3EFAA 2QECA 2BSWA 3IU2A 4XPDC 4KS9A 4ZGYB 2R7HA 2VEZA 1Z4RA 2B3VA 3T90A 1S7LA 3VWDA 2Z3MA 4A31A 4MBUA 4MFKA 4B13A 2BUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WK4 A;  1XIX A;  2G3T A;  2QML A;  4XNH B;  4L89 A;  3G3S A;  4OAD A;  2HUZ A;  3G8W A;  2F5I A;  3QAH A;  1YK3 A;  4E0A A;  1BOB A;  1YVK A;  4JJX A;  3JVN A;  3S6F A;  4PK2 A;  1KUY A;  2FXF A;  2GIV A;  1B6B A;  4F6A A;  3DNS A;  3MGD A;  1CM0 A;  2D4O A;  3R9E A;  2J8N A;  2PDO A;  3EY5 A;  4K30 A;  1YRE A;  1IID A;  4BMH A;  4IUS A;  2G0B A;  4PSX A;  4UWJ A;  2CY2 A;  2Z0Z A;  2G3A A;  1BO4 A;  1YX0 A;  5C82 A;  2P6E A;  4NEX A;  4QVT A;  1L0C A;  2I79 A;  4B5P B;  2Z10 A;  2CNS A;  1M4I A;  3GYA A;  4B5O A;  2I00 A;  2Q4Y A;  3SXN A;  2H5M A;  5F49 A;  2PR1 A;  4H89 A;  4FD5 A;  4PV6 A;  1M4G A;  3F0A A;  2Q04 A;  5J8C A;  3BLN A;  4X5K A;  4CAW A;  3T9Y A;  5EC4 A;  1S5K A;  2EVN A;  3D2P A;  3BJ7 A;  3TO9 A;  4E2A A;  3JUW A;  4KLV A;  2FT0 A;  2OB0 A;  2WPW A;  4NXY A;  4AVB A;  4KOW A;  2P6G A;  4L8A A;  2B4D B;  1S60 A;  2KCW A;  2P0W A;  5HMN A;  1M44 A;  4IF5 A;  1XF8 A;  1I12 A;  3VWE A;  4KOY A;  1Y7R A;  4AB7 A;  3NE7 A;  4LUA A;  4II9 A;  2A4N A;  4KUA A;  5JQ4 A;  5F46 A;  4KLW A;  3GY9 A;  3TO7 A;  1R57 A;  2Z11 A;  4AG9 A;  1Q2Y A;  2D4P A;  3IWG A;  4NSQ A;  1VHS A;  3KKW A;  2B4B A;  1P4N A;  2OZU A;  5H84 A;  2IL4 A;  3ZJ0 A;  1P0H A;  5GCN A;  4XPK A;  1TIQ A;  3FIX A;  4KUB A;  3TT2 A;  1Z9U A;  4CS0 B;  4JWP A;  3C26 A;  4MHD A;  2PSW A;  2OH1 A;  3H4Q A;  4CAV A;  4NCZ A;  3S6H A;  3CXQ A;  3R95 A;  2PC1 A;  3F8K A;  3PZJ A;  4FD7 A;  3V8I A;  1KUV A;  1Q2C A;  4GS4 A;  3F5B A;  2K5T A;  2ZW4 A;  1GHE A;  2ZW6 A;  1IB1 E;  4QBJ A;  1RO5 A;  2FE7 A;  1RXT A;  4JLY A;  4KOX A;  1QSR A;  3DDD A;  3DR6 A;  4YRH A;  4U9Z A;  1CJW A;  4AVA A;  1KUX A;  2ZXV A;  4LX9 A;  3N7Z A;  1V0C A;  4UBR A;  2EUI A;  3FRM A;  5EBV A;  2HQY A;  1YGH A;  1J4J A;  1XE4 A;  4FD6 A;  4MY3 A;  2PQ8 A;  1QSN A;  2CNT A;  1IYK A;  3CXP A;  1WWZ A;  1YLE A;  2J8R A;  3RYO A;  3BJ8 A;  3K9U A;  3P2H A;  3TOA A;  2JEV A;  3UY5 A;  1XEB A;  3D2M A;  2NMT A;  1I21 A;  1M4D A;  5I0C A;  2Q4V A;  4YGO A;  2OZH A;  3FXT A;  3LD2 A;  4M3S A;  2X7B A;  4AG7 A;  1PUA A;  4QUS A;  1QSM A;  1NMT A;  1PU9 A;  4KVX A;  2VBQ A;  3S6G A;  1QSO A;  4YFJ A;  5IV0 A;  4M85 A;  5F48 A;  4B5P A;  4J3G A;  4E8O A;  5ISV A;  4ONU A;  3I3G A;  5KTA A;  5H86 A;  3FNC A;  2REE A;  2O28 A;  1YR0 A;  2B5G B;  1UFH A;  5CNP A;  3W6S A;  4FD4 A;  2FCK A;  2J8M A;  4KOS A;  1SQH A;  4F0Y A;  2JDC A;  1MK4 A;  1S7F A;  2Y0M A;  5F47 A;  3QB8 A;  1MJ9 A;  1Z4E A;  4HNW B;  4CAX A;  3DR8 A;  3EC4 A;  4KOV A;  2REF A;  1Y9K A;  2B4D A;  5KTC A;  1U6M A;  4KOT A;  5IB0 A;  2RC4 A;  2BL1 A;  4UA3 A;  3SHP A;  3TOB A;  5C88 A;  4KOR A;  2ARH A;  2FS5 A;  2HV2 A;  4HNX B;  4QC6 A;  2BEI A;  4XPL A;  2ZPA A;  1MJB A;  2PRB A;  4H6U A;  3CXS A;  2ZW7 A;  4EVY A;  4HKF A;  4U9Y A;  4ORF A;  4R57 A;  1M1D A;  3EO4 A;  5FVJ A;  5HH1 A;  4CRZ B;  4OAE A;  2R1I A;  1VKC A;  3PGP A;  3B8G A;  3D3S A;  4Y49 B;  1FY7 A;  4DNC A;  4R3L A;  2QIR A;  1I1D A;  2FIA A;  4KOU A;  1N71 A;  4JD6 A;  3W91 A;  3DSB A;  3R96 A;  3I9S A;  3S6K A;  3SXO A;  1IIC A;  1NSL A;  3E0K A;  1IYL A;  2Q0Y A;  3ZZI A;  2B58 A;  2Q44 A;  2VXK A;  1OZP A;  5KTD A;  3PP9 A;  1MJA A;  1S3Z A;  3TE4 A;  2FL4 A;  3EXN A;  4JXQ A;  1S7K A;  2DXQ A;  1Y9W A;  4MJ8 A;  2VQY A;  4XPD B;  4U5Y A;  3D8P A;  1Q2D A;  5IX3 A;  3OWC A;  1B87 A;  1K4J A;  4KVO E;  2AE6 A;  4R3K A;  3TFY A;  3P2F A;  4OLL A;  4HNY B;  5DWN A;  4I49 A;  4AVC A;  3FB3 A;  2JDD A;  3TO6 A;  1QST A;  3IGR A;  4MY0 A;  4PSW A;  4KVM E;  1XMT A;  1KZF A;  3FYN A;  2ATR A;  4ZBG A;  4MI4 A;  1ON0 A;  1NE9 A;  2C27 A;  2VZZ A;  3TTH A;  4JXR A;  4XNH C;  5JPH A;  2CNM A;  4KZT A;  1YVO A;  1S7N A;  2VZY A;  4Y49 C;  2GAN A;  4R87 A;  5DWM A;  2GE3 A;  2B3U A;  4UWI A;  3R1K A;  4NF1 A;  2R98 A;  2OZG A;  2JLM A;  4PK3 A;  5J8F A;  2R8V A;  2Q7B A;  3WR7 A;  4RS2 A;  2AJ6 A;  2PR8 A;  4R9M A;  3R9F A;  2B5G A;  3TCV A;  3R9G A;  1LRZ A;  4H6Z A;  2ZW5 A;  3W6X A;  2OU2 A;  2FSR A;  2P6F A;  3FBU A;  3LOD A;  4QB9 A;  2VI7 A;  3GKR A;  5E96 A;  2WPX A;  4RI1 A;  4CRY B;  2FIW A;  3EFA A;  2QEC A;  2BSW A;  4XPD C;  2R7H A;  2VEZ A;  1Z4R A;  2B3V A;  3T90 A;  1S7L A;  3VWD A;  4MBU A;  2BUE A; 
#chains in the Genus database with same CATH topology
 3SI2 A;  3QAY A;  1WK4 A;  2ZEN A;  3A9L A;  4W9Y A;  4C68 A;  4Z65 A;  1XIX A;  4CGN A;  2G3T A;  2QML A;  4CGM A;  4ZY2 A;  3ISZ A;  4XNH B;  2EK8 A;  4Q38 A;  4A39 A;  4AXV A;  4CYN A;  5J1Q A;  4L89 A;  3G3S A;  4OAD A;  2HUZ A;  2DEA A;  3G8W A;  2F5I A;  2ZEO A;  3RO0 A;  3QAH A;  2ZED A;  2QYV A;  2ZEM A;  3PEI A;  4R6T A;  1YK3 A;  2EK9 A;  4E0A A;  1BOB A;  5LRG A;  1YVK A;  3B2Y A;  4JJX A;  1BPN A;  3JVN A;  3S6F A;  4MHY A;  1F57 A;  1ELM P;  4PK2 A;  3JRU A;  4BBH A;  3RBU A;  3S9L A;  4UEE A;  1KUY A;  2FXF A;  1OBR A;  2GIV A;  5I4M A;  1B6B A;  3PB6 X;  4F6A A;  3DNS A;  3MGD A;  1ZLH A;  2ABZ A;  1JWQ A;  4JYW A;  5CPA A;  1CM0 A;  3D7F A;  2D4O A;  4F9U A;  1Z8L A;  3R9E A;  3FED A;  5HVG A;  2J8N A;  4OC3 A;  5DS0 A;  4IHM A;  2PDO A;  3PBB A;  3EY5 A;  3IWW A;  3LWU A;  3CPA A;  4UCP A;  2DF5 A;  4A37 A;  5D8N A;  4K30 A;  1EE3 P;  1YRE A;  1IID A;  4BMH A;  3N5F A;  2RFH A;  2G0B A;  4IUS A;  4PSX A;  5D29 A;  2JBK A;  4UWJ A;  2CY2 A;  1DTD A;  5THW A;  4NGM A;  3KL9 A;  2Z0Z A;  3CPX A;  3GUX A;  2G3A A;  1BO4 A;  3NFZ A;  5AG7 A;  3PFO A;  1YX0 A;  1CG2 A;  5C82 A;  2P6E A;  4KSI A;  4ZX9 A;  4NEX A;  1LCP A;  4QVT A;  1L0C A;  2I79 A;  4B5P B;  2CTC A;  2Z10 A;  5LRJ A;  2DPT A;  5G22 A;  2CNS A;  1YQE A;  1CP7 A;  3WAB A;  2XEJ A;  2IJZ A;  2NSM A;  1ZG7 A;  2FVG A;  1M4I A;  3GYA A;  4B5O A;  2I00 A;  2YNC C;  2Q4Y A;  3SXN A;  2H5M A;  3FVL A;  1Q7L A;  4OC4 A;  5EMI A;  5F49 A;  2PR1 A;  1ZG8 A;  1PYT B;  2Z3P A;  4FD5 A;  4H89 A;  3JTK A;  4PV6 A;  5LYD A;  2VL1 A;  2AFW A;  1CPS A;  5K8N A;  1M4G A;  4KSA A;  1PCA A;  2Q43 A;  3F0A A;  2Q04 A;  5J8C A;  5K8M A;  3BLN A;  4X5K A;  4CAW A;  1AUG A;  2Q51 A;  3T9Y A;  5EC4 A;  1S5K A;  1VHE A;  2EVN A;  2EBJ A;  4OKO A;  3D2P A;  2V8H A;  3HLP A;  4CGO A;  2PIY A;  4M6H A;  3BJ7 A;  2V8D A;  2YND A;  3TO9 A;  2QJ8 A;  4E2A A;  4H2K A;  3JUW A;  4KLV A;  1F2O A;  2FT0 A;  2OB0 A;  2WPW A;  4R8F A;  3ISX A;  4NXY A;  4AVB A;  4KOW A;  2P6G A;  4L8A A;  4B6Z A;  3H8E A;  2B4D B;  1S60 A;  2KCW A;  2P0W A;  4Q7A A;  3V38 A;  5HMN A;  1M44 A;  4IF5 A;  4UF4 A;  1XF8 A;  1I12 A;  1CP6 A;  2AFO A;  2PJ8 A;  1KWM A;  3BHX A;  2PIZ A;  5HVF A;  3KR4 A;  3VWE A;  2YGW A;  4KOY A;  1Y7R A;  4FAI A;  3MRU A;  4AB7 A;  3NE7 A;  3DGV A;  4LUA A;  3DLJ A;  4NJR A;  5CBM A;  8CPA A;  5LRK A;  2CXA A;  2A4N A;  2BO9 A;  2OR4 A;  2PJ4 A;  4KUA A;  4PXD A;  5JQ4 A;  5F46 A;  4KLW A;  4FBE A;  3GY9 A;  2G9D A;  4A38 A;  3TO7 A;  2CTB A;  4OME A;  3WC6 A;  3TX8 A;  1LAP A;  4C2X A;  1R57 A;  2Z11 A;  4AG9 A;  1Q2Y A;  2GRE A;  2D4P A;  3KQX A;  1LAN A;  3IWG A;  4NSQ A;  1VHS A;  3KKW A;  1LAM A;  2B4B A;  3FF3 A;  1P4N A;  2OZU A;  5H84 A;  2IL4 A;  3ZJ0 A;  4C2Z A;  1P0H A;  4X8I A;  3B3V A;  5GCN A;  4XPK A;  5LYI A;  1TIQ A;  4ZI6 A;  3FIX A;  3RNZ A;  4KUB A;  3TT2 A;  4X2T A;  1Z9U A;  2ZEH A;  3HUV A;  4CS0 B;  1Z2L A;  4JWP A;  1DE4 C;  3C26 A;  4MFQ A;  4MHD A;  2ANP A;  2OH1 A;  2PSW A;  4MMO A;  4OIW A;  3H4Q A;  4CAV A;  4MHZ A;  5JH9 A;  4NCZ A;  4A33 A;  3S6H A;  3WC7 A;  3WC5 A;  3CXQ A;  3R95 A;  3D67 A;  2PC1 A;  4F9V A;  3FX6 A;  3F8K A;  1TKF A;  2HC9 A;  3PZJ A;  4FD7 A;  3V8I A;  4MHP A;  5A27 A;  4P6Y A;  1KUV A;  1Q2C A;  3FEC A;  2PJ6 A;  4LQG A;  4GS4 A;  3F5B A;  2K5T A;  2ZW4 A;  1GHE A;  1ZO0 A;  5A28 A;  2ZW6 A;  1ZLI A;  1IB1 E;  3NA6 A;  4QBJ A;  1RO5 A;  2FE7 A;  1RXT A;  1YW6 A;  4CPA A;  4RUH A;  4JLY A;  4KOX A;  3H8F A;  1QSR A;  3DDD A;  3DR6 A;  4YRH A;  4ZYQ A;  4GM5 A;  4U9Z A;  3B3S A;  1CJW A;  2XEG A;  4PXB A;  1IOI A;  4AVA A;  1KUX A;  2ZXV A;  4LX9 A;  3N7Z A;  1V0C A;  4UBR A;  2EUI A;  1XFO A;  3FRM A;  5EBV A;  2HQY A;  1YGH A;  4NFR A;  4Q36 A;  1J4J A;  1XE4 A;  4FD6 A;  4UCM A;  4UEF A;  4PPZ A;  4MY3 A;  3PB9 X;  1BAV A;  1QSN A;  2PQ8 A;  2CNT A;  1VIX A;  1IYK A;  5G20 A;  5LYF A;  1X12 A;  4A32 A;  5F09 A;  1F2P A;  4DJL A;  2Z3N A;  3CXP A;  4MFZ A;  2CIJ A;  2PJ7 A;  1WWZ A;  1YLE A;  2J8R A;  5G1Z A;  3RYO A;  3BJ8 A;  3K9U A;  1CBX A;  3P2H A;  3PB7 X;  4M6G A;  3TOA A;  3SI0 A;  4UFX A;  5K8O A;  2JEV A;  3UY5 A;  1XEB A;  1BPM A;  3PBE A;  3IO1 A;  5K8P A;  1YSJ A;  2Z3L A;  3D2M A;  2O53 A;  2NMT A;  4FWU A;  4CGL A;  4R76 A;  1I21 A;  1M4D A;  2IMO A;  4UIB A;  1NSA A;  5I0C A;  1X10 A;  2C6P A;  4UIA A;  3GIU A;  3IEH A;  4GXH A;  1Y0Y A;  3D4U A;  2Q4V A;  3TC8 A;  4YGO A;  2Z3O A;  5G21 A;  2OZH A;  3FXT A;  3LD2 A;  2PJ0 A;  1AYE A;  4P4D A;  3D7H A;  4CYQ A;  2F7V A;  4M3S A;  2X7B A;  4MCS A;  2ZEP A;  4AG7 A;  1PUA A;  4C2Y A;  4QUS A;  1XOV A;  1QMU A;  1QSM A;  1YW4 A;  3FMC A;  1NMT A;  3KAS A;  1PU9 A;  4KVX A;  2VBQ A;  3S6G A;  2O4H A;  1QSO A;  4MXU A;  4YFJ A;  5IV0 A;  4M85 A;  1VHO A;  1JQG A;  4J3G A;  5F48 A;  1GYT A;  4B5P A;  4G1P A;  4E8O A;  4ONU A;  3I3G A;  5IB9 A;  5ISV A;  2ZEL A;  3B3T A;  4B12 A;  5KTA A;  1YME A;  3SI1 A;  3BI0 A;  4NGP A;  4C7I A;  5H86 A;  2EWB A;  3FNC A;  4UCN A;  3L2N A;  2REE A;  4MFJ A;  4C7H A;  4R7M A;  7CPA A;  4B10 A;  2O28 A;  1CPX A;  1YR0 A;  2B5G B;  1UFH A;  3B3C A;  5CNP A;  3I1U A;  1ARL A;  4NGN A;  1ARM A;  1ZG9 A;  2DPS A;  2PJB A;  3W6S A;  4FD4 A;  2FCK A;  2J8M A;  2RB7 A;  4KOS A;  1SQH A;  4PQA A;  5AG4 A;  4F0Y A;  4ZY0 A;  2JDC A;  2V8G A;  1MK4 A;  1S7F A;  2Y0M A;  4OP4 A;  5F47 A;  4A2Z A;  3QB8 A;  3IWE A;  3KI9 A;  1Y0R A;  1MJ9 A;  1Z4E A;  5JM6 A;  4HNW B;  4CAX A;  3DR8 A;  4WJB A;  4MCR A;  2V8V A;  2C6C A;  2EO8 A;  3EC4 A;  2HB6 A;  2POK A;  4KOV A;  2REF A;  4NJQ A;  1Y9K A;  2B4D A;  4UFW A;  4EFD A;  4P4F A;  5KTC A;  1U6M A;  3PRT A;  4KOT A;  5IB0 A;  2RC4 A;  3PB8 X;  2WUU A;  4LQ6 A;  3VAT A;  3T8W A;  2I3C A;  4YWY A;  2BL1 A;  4UA3 A;  3FEE A;  2F8H A;  4BD9 A;  5AGE A;  3SHP A;  3TOB A;  2PJ9 A;  4YU9 A;  3LAC A;  5C88 A;  4II9 A;  4HPS A;  4ZY1 A;  5ELY A;  4KOR A;  2ARH A;  4K3N A;  2FS5 A;  2GLJ A;  2HV2 A;  3IU1 A;  4X3R A;  1R3N A;  1HDU A;  6CPA A;  3LMS A;  4CAE A;  4HNX B;  4QC6 A;  2BOA A;  2BEI A;  3MN8 A;  4XPL A;  3D68 A;  3KQZ A;  4O23 A;  2ZPA A;  1MJB A;  2PRB A;  4ONW A;  4H6U A;  3CXS A;  2ZW7 A;  1QQ9 A;  2YNC A;  4HKF A;  4U9Y A;  4EVY A;  1LFW A;  2XEI A;  3BXM A;  4ORF A;  4BIN A;  4R57 A;  1M1D A;  3EO4 A;  3VH9 A;  5FVJ A;  2C1C A;  5HH1 A;  4CRZ B;  4WWV A;  3S9M A;  4OAE A;  2R1I A;  1VKC A;  2YNE A;  2WSA A;  2WZN A;  3PGP A;  3B8G A;  2PJ3 A;  3D3S A;  1A2Z A;  1FY7 A;  4Y49 B;  4DNC A;  2PE3 A;  2XEF A;  4P4E A;  1IU8 A;  4A94 A;  4R3L A;  2QIR A;  1I1D A;  2FIA A;  3B35 A;  2PVW A;  4KOU A;  1N71 A;  4OC1 A;  3SJX A;  1TKH A;  4JD6 A;  3W91 A;  1Y7E A;  3DSB A;  3R96 A;  1HDQ A;  1XRY A;  3I9S A;  4A30 A;  4B11 A;  3IC1 A;  3S6K A;  3SXO A;  1IIC A;  1NSL A;  3E0K A;  1IYL A;  2Q0Y A;  3ZZI A;  2B58 A;  3H5Z A;  2Q44 A;  2VXK A;  2NYQ A;  1OZP A;  3H8G A;  3BI1 A;  5KTD A;  3PP9 A;  1MJA A;  1S3Z A;  3GB0 A;  1AMP A;  4TNU A;  2BCO A;  3TE4 A;  2AFM A;  2FL4 A;  3EXN A;  3PB4 X;  4JXQ A;  1S7K A;  2J9A A;  2AFU A;  2Z3K A;  2DXQ A;  1Y9W A;  4MJ8 A;  4NGQ A;  3KR5 A;  4CYO A;  4MFP A;  3SJF A;  2PJ2 A;  2VQY A;  4P4I A;  4U5Y A;  4XPD B;  3D8P A;  3VAR A;  2QVP A;  1Q2D A;  5IX3 A;  3OWC A;  1B87 A;  1K4J A;  4KVO E;  1XBU A;  1TKJ A;  2PJA A;  2AE6 A;  1M4L A;  4R3K A;  4B14 A;  1HEE A;  3TFY A;  3P2F A;  1Z8X A;  4HNY B;  4OLL A;  5DWN A;  2OOT A;  4I49 A;  4AVC A;  3QNV A;  4TWE A;  3IJ3 A;  4OID A;  3FB3 A;  2JDD A;  4IAV A;  1H8L A;  2JEW A;  5BWA B;  4CYP A;  3NH5 A;  3TO6 A;  4P4J A;  4DYO A;  1QST A;  2C6G A;  3IGR A;  3SJG A;  1TF9 A;  3SJE A;  3D7D A;  2JBJ A;  4MY0 A;  4PSW A;  1UWY A;  3B7I A;  2ZEG A;  4OC5 A;  4KVM E;  3RZA A;  3NE8 A;  1XMT A;  4MCQ A;  2GU2 A;  3CZX A;  2IQ6 A;  2PJ5 A;  1KZF A;  4M6I A;  3FYN A;  4P10 A;  2ATR A;  4MFL A;  4KSF A;  4JZ0 A;  4ZBG A;  4MI4 A;  4MCP A;  1CX8 A;  3KHZ A;  4UEZ A;  3NH8 A;  2PCU A;  3KGQ A;  1ON0 A;  4PXE A;  5JGF A;  1NE9 A;  2C27 A;  2VZZ A;  4NGS A;  3TTH A;  4JXR A;  4OC0 A;  4XNH C;  3WT4 A;  4F0X A;  5JPH A;  2AFX A;  2CNM A;  1YVO A;  4KZT A;  1S7N A;  2VZY A;  1FT7 A;  4CGP A;  1IOF A;  2PRQ A;  3IFE A;  4Y49 C;  3FJU A;  2GAN A;  4FUU A;  4R87 A;  5DWM A;  5LYL A;  2GE3 A;  2B3U A;  2GLF A;  3B3W A;  3PFE A;  4UWI A;  5AG6 A;  2AFZ A;  3R1K A;  4P45 A;  4NF1 A;  2R98 A;  2AFS A;  4IK2 A;  2OZG A;  4NGT A;  1TF8 A;  4EWT A;  2Q4Z A;  2JLM A;  1XJO A;  2GFQ A;  3KZW A;  4PK3 A;  5J8F A;  2R8V A;  2PJC A;  2ZEF A;  2PJ1 A;  2Q7B A;  4DUK A;  3WR7 A;  1VGY A;  2AJ6 A;  1IGB A;  2PR8 A;  4R9M A;  4RS2 A;  3R9F A;  4CAF A;  1BLL E;  1IY7 A;  1Z5R A;  2B5G A;  1ELL P;  2ZEE A;  3FH4 A;  3K9T A;  3R9G A;  3TCV A;  1LRZ A;  4H6Z A;  4EME A;  2ZW5 A;  3W6X A;  3S9N A;  2OU2 A;  1TXR A;  2WYR A;  2Q7S A;  3NH4 A;  3CT9 A;  2FSR A;  3D7G A;  2P6F A;  3FBU A;  3K2K A;  3LOD A;  4OC2 A;  4UFV A;  2PVV A;  4MHN A;  4QB9 A;  4MRI A;  1FNO A;  2V77 A;  4RN7 A;  5AG5 A;  2ZOG A;  1LOK A;  2VI7 A;  3D66 A;  3GKR A;  5E96 A;  3KHX A;  4A95 A;  2WPX A;  1YLO A;  4P44 A;  4RI1 A;  4CRY B;  5HVH A;  3RAM A;  3CDX A;  1XMB A;  2FIW A;  3EFA A;  3V7Z A;  2QEC A;  2BSW A;  3IU2 A;  5HXD A;  4XPD C;  1RTQ A;  2ZOF A;  4NGR A;  3IIB A;  4KS9 A;  4ZGY B;  2R7H A;  4ZX8 A;  2VEZ A;  4P4B A;  1Z4R A;  4F8Z A;  2B3V A;  2ODF A;  3T90 A;  1S7L A;  3VWD A;  2Z3M A;  1Z8W A;  1Z8T A;  4A31 A;  4MBU A;  4PXC A;  2CF4 A;  3GLJ A;  4MFK A;  4B13 A;  2BUE A;  1R43 A; 
#chains in the Genus database with same CATH homology
 1WK4 A;  3A9L A;  4C68 A;  1XIX A;  4CGN A;  2G3T A;  2QML A;  4CGM A;  4CYN A;  4XNH B;  4Q38 A;  4L89 A;  3G3S A;  4OAD A;  2HUZ A;  3G8W A;  2F5I A;  3QAH A;  1YK3 A;  4E0A A;  1BOB A;  1YVK A;  4JJX A;  3JVN A;  3S6F A;  4PK2 A;  4BBH A;  1KUY A;  2FXF A;  2GIV A;  1B6B A;  4F6A A;  3DNS A;  3MGD A;  1CM0 A;  2D4O A;  3R9E A;  2J8N A;  2PDO A;  3EY5 A;  4UCP A;  4K30 A;  1YRE A;  1IID A;  4BMH A;  4IUS A;  2G0B A;  4PSX A;  4UWJ A;  2CY2 A;  2Z0Z A;  2G3A A;  1BO4 A;  5AG7 A;  1YX0 A;  5C82 A;  2P6E A;  4NEX A;  4QVT A;  1L0C A;  2I79 A;  4B5P B;  2Z10 A;  2DPT A;  5G22 A;  2CNS A;  1M4I A;  3GYA A;  4B5O A;  2I00 A;  2YNC C;  2Q4Y A;  3SXN A;  2H5M A;  5F49 A;  2PR1 A;  4H89 A;  2Z3P A;  4FD5 A;  3JTK A;  4PV6 A;  1M4G A;  4KSA A;  3F0A A;  2Q04 A;  5J8C A;  3BLN A;  4X5K A;  4CAW A;  3T9Y A;  5EC4 A;  1S5K A;  2EVN A;  4CGO A;  3D2P A;  3BJ7 A;  2YND A;  3TO9 A;  4E2A A;  3JUW A;  4KLV A;  2FT0 A;  2OB0 A;  2WPW A;  4NXY A;  4AVB A;  4KOW A;  2P6G A;  4L8A A;  2B4D B;  1S60 A;  2KCW A;  2P0W A;  5HMN A;  1M44 A;  4IF5 A;  1XF8 A;  1I12 A;  3VWE A;  2YGW A;  4KOY A;  1Y7R A;  4AB7 A;  3NE7 A;  4LUA A;  4II9 A;  2CXA A;  2A4N A;  4KUA A;  5JQ4 A;  5F46 A;  4KLW A;  3GY9 A;  3TO7 A;  4C2X A;  1R57 A;  2Z11 A;  4AG9 A;  1Q2Y A;  2D4P A;  3IWG A;  4NSQ A;  1VHS A;  3KKW A;  2B4B A;  1P4N A;  2OZU A;  5H84 A;  2IL4 A;  3ZJ0 A;  4C2Z A;  1P0H A;  5GCN A;  4XPK A;  1TIQ A;  3FIX A;  4KUB A;  3TT2 A;  1Z9U A;  4CS0 B;  4JWP A;  4MFQ A;  3C26 A;  4MHD A;  2PSW A;  2OH1 A;  3H4Q A;  4CAV A;  4NCZ A;  4A33 A;  3S6H A;  3CXQ A;  3R95 A;  2PC1 A;  3F8K A;  3PZJ A;  4FD7 A;  3V8I A;  5A27 A;  1KUV A;  1Q2C A;  4GS4 A;  3F5B A;  2K5T A;  2ZW4 A;  1GHE A;  1ZO0 A;  5A28 A;  2ZW6 A;  1IB1 E;  4QBJ A;  1RO5 A;  2FE7 A;  1RXT A;  4JLY A;  4KOX A;  1QSR A;  3DDD A;  3DR6 A;  4YRH A;  4U9Z A;  1CJW A;  4AVA A;  1KUX A;  2ZXV A;  4LX9 A;  3N7Z A;  1V0C A;  4UBR A;  2EUI A;  3FRM A;  5EBV A;  2HQY A;  1YGH A;  4Q36 A;  1J4J A;  1XE4 A;  4FD6 A;  4UCM A;  4MY3 A;  2PQ8 A;  1QSN A;  2CNT A;  1IYK A;  5G20 A;  4A32 A;  2Z3N A;  3CXP A;  4MFZ A;  1WWZ A;  1YLE A;  2J8R A;  5G1Z A;  3RYO A;  3BJ8 A;  3K9U A;  3P2H A;  3TOA A;  4UFX A;  2JEV A;  3UY5 A;  1XEB A;  2Z3L A;  3D2M A;  2NMT A;  4CGL A;  1I21 A;  1M4D A;  5I0C A;  2Q4V A;  4YGO A;  2Z3O A;  5G21 A;  2OZH A;  3FXT A;  3LD2 A;  4CYQ A;  4M3S A;  2X7B A;  4AG7 A;  1PUA A;  4C2Y A;  4QUS A;  1QSM A;  1NMT A;  1PU9 A;  4KVX A;  2VBQ A;  3S6G A;  1QSO A;  4YFJ A;  5IV0 A;  4M85 A;  5F48 A;  4B5P A;  4J3G A;  4E8O A;  5ISV A;  4ONU A;  3I3G A;  4B12 A;  5KTA A;  4C7I A;  5H86 A;  3FNC A;  4UCN A;  2REE A;  4MFJ A;  4C7H A;  4B10 A;  2O28 A;  1YR0 A;  2B5G B;  1UFH A;  5CNP A;  2DPS A;  3W6S A;  4FD4 A;  2FCK A;  2J8M A;  4KOS A;  1SQH A;  5AG4 A;  4F0Y A;  2JDC A;  1MK4 A;  1S7F A;  2Y0M A;  5F47 A;  4A2Z A;  3QB8 A;  3IWE A;  1MJ9 A;  1Z4E A;  4HNW B;  4CAX A;  3DR8 A;  3EC4 A;  4KOV A;  2REF A;  1Y9K A;  2B4D A;  4UFW A;  5KTC A;  1U6M A;  4KOT A;  5IB0 A;  2RC4 A;  2WUU A;  2BL1 A;  4UA3 A;  5AGE A;  3SHP A;  3TOB A;  5C88 A;  4KOR A;  2ARH A;  2FS5 A;  3IU1 A;  2HV2 A;  4CAE A;  4HNX B;  4QC6 A;  2BEI A;  4XPL A;  2ZPA A;  1MJB A;  2PRB A;  4H6U A;  3CXS A;  2ZW7 A;  2YNC A;  4EVY A;  4HKF A;  4U9Y A;  4ORF A;  4R57 A;  1M1D A;  3EO4 A;  5FVJ A;  5HH1 A;  4CRZ B;  4OAE A;  2R1I A;  1VKC A;  2YNE A;  2WSA A;  3PGP A;  3B8G A;  3D3S A;  4Y49 B;  1FY7 A;  4DNC A;  4R3L A;  2QIR A;  1I1D A;  2FIA A;  4KOU A;  1N71 A;  4JD6 A;  3W91 A;  3DSB A;  3R96 A;  3I9S A;  4A30 A;  4B11 A;  3S6K A;  3SXO A;  1IIC A;  1NSL A;  3E0K A;  1IYL A;  2Q0Y A;  3ZZI A;  2B58 A;  3H5Z A;  2Q44 A;  2VXK A;  1OZP A;  5KTD A;  3PP9 A;  1MJA A;  1S3Z A;  3TE4 A;  2FL4 A;  3EXN A;  4JXQ A;  1S7K A;  2Z3K A;  2DXQ A;  1Y9W A;  4MJ8 A;  4CYO A;  4MFP A;  2VQY A;  4XPD B;  4U5Y A;  3D8P A;  1Q2D A;  5IX3 A;  3OWC A;  1B87 A;  1K4J A;  4KVO E;  2AE6 A;  4R3K A;  4B14 A;  3TFY A;  3P2F A;  4OLL A;  4HNY B;  5DWN A;  4I49 A;  4AVC A;  3FB3 A;  2JDD A;  5BWA B;  4CYP A;  3TO6 A;  1QST A;  3IGR A;  4MY0 A;  4PSW A;  4KVM E;  1XMT A;  1KZF A;  3FYN A;  2ATR A;  4MFL A;  4KSF A;  4ZBG A;  4MI4 A;  1ON0 A;  1NE9 A;  2C27 A;  2VZZ A;  3TTH A;  4JXR A;  4XNH C;  5JPH A;  4F0X A;  2CNM A;  4KZT A;  1YVO A;  4CGP A;  1S7N A;  2VZY A;  4Y49 C;  2GAN A;  4R87 A;  5DWM A;  2GE3 A;  2B3U A;  4UWI A;  5AG6 A;  3R1K A;  4NF1 A;  2R98 A;  2OZG A;  2JLM A;  4PK3 A;  5J8F A;  2R8V A;  2Q7B A;  3WR7 A;  4RS2 A;  2AJ6 A;  2PR8 A;  4R9M A;  3R9F A;  4CAF A;  2B5G A;  3TCV A;  3R9G A;  1LRZ A;  4H6Z A;  2ZW5 A;  3W6X A;  2OU2 A;  2FSR A;  2P6F A;  3FBU A;  3LOD A;  4UFV A;  4QB9 A;  5AG5 A;  3GKR A;  2VI7 A;  5E96 A;  4A95 A;  2WPX A;  4RI1 A;  4CRY B;  2FIW A;  3EFA A;  2QEC A;  2BSW A;  3IU2 A;  4XPD C;  4KS9 A;  4ZGY B;  2R7H A;  2VEZ A;  1Z4R A;  2B3V A;  3T90 A;  1S7L A;  3VWD A;  2Z3M A;  4A31 A;  4MBU A;  4MFK A;  4B13 A;  2BUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...