2PRBA

Crystal structure of aminoglycoside acetyltransferase aac(6')-ib in complex whith coenzyme a
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
176
structure length
173
Chain Sequence
b'SVTLRLMTEHDLAMLYEWLNRSHIVEWWGARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEEETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFERTRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside 6-N-acetyltransferase type Ib11
molecule tags Transferase
source organism Salmonella typhimurium
publication title Enzyme structural plasticity and the emergence of broad-spectrum antibiotic resistance.
pubmed doi rcsb
total genus 50
structure length 173
sequence length 176
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2007-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13523 Acetyltransf_8 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2prbA00
3S6GA 5IX3A 4R87A 2IL4A 2JEVA 2B4DA 3P2FA 4OLLA 3EC4A 3CXQA 4B5PA 3QAHA 4FD7A 5EBVA 4XNHB 1CJWA 5HH1A 2G0BA 2VQYA 3GKRA 1IICA 2J8MA 2PC1A 1WK4A 2VI7A 4H6ZA 1QSOA 4KVXA 5F49A 1S5KA 4UWIA 4YFJA 3FNCA 4NXYA 1CM0A 1N71A 2C27A 1QSRA 1M4DA 1V0CA 1S7FA 1LRZA 2Q7BA 3TO9A 1KUXA 4M3SA 3SXOA 4R3KA 2KCWA 3R9EA 2B3UA 1QSNA 4XNHC 1ON0A 3I3GA 2BUEA 1QSMA 3VWEA 4I49A 3F0AA 1VKCA 1Q2DA 3V8IA 1VHSA 1YGHA 3E0KA 3D8PA 4PK3A 4E8OA 2JDDA 3R95A 5J8FA 1Z4RA 5KTCA 3K9UA 3TTHA 4EVYA 2FT0A 3I9SA 5H84A 4R57A 1S7NA 1GHEA 4KVME 4AB7A 1BOBA 3RYOA 1OZPA 2BSWA 2H5MA 4QVTA 3CXPA 3CXSA 2G3TA 2CNTA 3FYNA 4XPLA 3S6HA 4U9YA 4Y49C 2B3VA 4B5PB 4JJXA 1YVKA 2Z10A 5I0CA 1TIQA 4ONUA 4Y49B 4MBUA 3JVNA 3DR6A 2R8VA 4PSXA 2GANA 3W6XA 4JLYA 2R7HA 1Y9KA 3IGRA 3PP9A 4LUAA 4AVCA 4F0YA 4NEXA 4LX9A 3FIXA 1FY7A 2Q04A 4HKFA 2ZW6A 4FD6A 4U5YA 3KKWA 4K30A 5C82A 3FXTA 2OZUA 2Q4YA 3UY5A 2OU2A 4KUBA 2VBQA 3EY5A 4YGOA 2ZXVA 1M44A 1UFHA 3VWDA 1XEBA 2P6GA 3ZJ0A 2OZGA 2EUIA 2ARHA 3JUWA 4KZTA 1S7LA 4BMHA 4NCZA 3WR7A 4PK2A 4PSWA 2FSRA 1YX0A 2OB0A 5F47A 3LODA 4AVAA 4NF1A 5EC4A 2FCKA 5IB0A 3D2MA 3G3SA 4R3LA 3ZZIA 5JPHA 4QUSA 2K5TA 2HUZA 4L8AA 5F46A 1KUYA 5JQ4A 2VXKA 2I00A 1S60A 4NSQA 3C26A 4AG7A 1PU9A 2PR8A 4M85A 1J4JA 3R96A 1Y7RA 2VZYA 3S6KA 4QC6A 4UBRA 2Q4VA 2ZPAA 3MGDA 1YR0A 1I1DA 3OWCA 1YREA 4XPKA 4GS4A 1YLEA 1YK3A 3F8KA 5IV0A 4MHDA 2PSWA 2FE7A 3FBUA 3W91A 4KOYA 4XPDC 3D2PA 2VEZA 4KOWA 2OH1A 1KUVA 2A4NA 4JXRA 4E0AA 2QMLA 5ISVA 5H86A 1I12A 2FS5A 3S6FA 3H4QA 2JDCA 4ORFA 3GY9A 5GCNA 4X5KA 1Y9WA 1P4NA 4L89A 2Q44A 3TOAA 2J8RA 1MJAA 4B5OA 3LD2A 2FXFA 3TT2A 5J8CA 4II9A 4AG9A 2Q0YA 2OZHA 2FIWA 2ZW5A 4KLVA 4KOUA 1Q2CA 1Q2YA 2R1IA 3TE4A 4RI1A 5E96A 2Z11A 2CNSA 1RXTA 3GYAA 2D4OA 4MJ8A 2FL4A 3TCVA 4ZBGA 3T90A 2BL1A 4JXQA 2HV2A 2RC4A 4CRZB 4HNYB 4AVBA 2REFA 1IB1E 4KORA 4JD6A 4DNCA 4KOTA 4U9ZA 3NE7A 3PGPA 4IUSA 3R9FA 2Z0ZA 5DWNA 1XMTA 3DNSA 2CY2A 3F5BA 3G8WA 3W6SA 2PRBA 4F6AA 2AE6A 2J8NA 5KTAA 5KTDA 1L0CA 3R1KA 4R9MA 4OAEA 4H89A 1MJBA 3EO4A 1XF8A 2ATRA 3D3SA 1B6BA 1I21A 3B8GA 4KVOE 4YRHA 3SHPA 2GE3A 4KOSA 2REEA 4IF5A 1MJ9A 2PR1A 1BO4A 2FIAA 2P6EA 2X7BA 2ZW7A 4CAVA 3DR8A 1IYKA 4HNWB 3R9GA 4JWPA 2B58A 2Y0MA 2P6FA 4QBJA 1PUAA 3DSBA 3EXNA 4MI4A 3DDDA 1IYLA 4CRYB 2R98A 1B87A 2CNMA 5FVJA 2D4PA 3FRMA 4FD4A 2EVNA 1R57A 2O28A 3TOBA 1RO5A 4KUAA 1K4JA 4UA3A 3QB8A 4MY3A 2PDOA 4RS2A 2JLMA 4FD5A 4E2AA 2B4BA 3IWGA 3PZJA 1P0HA 3BJ8A 3P2HA 2GIVA 1M4GA 4CAXA 2G3AA 4MY0A 1SQHA 4PV6A 1S7KA 1M4IA 4KOXA 4OADA 5C88A 3SXNA 1NSLA 3TO6A 5DWMA 1S3ZA 1WWZA 4HNXB 5CNPA 3EFAA 2DXQA 3T9YA 2WPWA 1QSTA 2NMTA 3BLNA 2B5GA 5HMNA 3N7ZA 3TO7A 3TFYA 4J3GA 1NE9A 5F48A 1XE4A 1NMTA 2QIRA 2F5IA 4KOVA 1U6MA 3BJ7A 1Z4EA 1MK4A 2P0WA 1IIDA 1Z9UA 2VZZA 2B5GB 4CAWA 4CS0B 2QECA 2B4DB 2ZW4A 1M1DA 4QB9A 1YVOA 2HQYA 1KZFA 2WPXA 4KLWA 2BEIA 2I79A 2PQ8A 2AJ6A 4XPDB 1XIXA 4H6UA 3FB3A 4UWJA
chains in the Genus database with same CATH superfamily
3IEHA 1ZG9A 4NGRA 3S6GA 5IX3A 2RB7A 3SI1A 4R87A 2IL4A 2JEVA 4K3NA 3WT4A 3TC8A 1TKJA 4IHMA 2B4DA 3P2FA 4OLLA 2PIZA 5BWAB 3EC4A 3CXQA 4B5PA 3QAHA 4FD7A 4ZYQA 2JBJA 5EBVA 2NSMA 1CJWA 2PVVA 2G0BA 4XNHB 1CP6A 2VQYA 3GKRA 5HH1A 1IICA 5LYFA 2AFOA 1NSAA 2VL1A 2PJ1A 4KSFA 1IOIA 2J8MA 2PC1A 1WK4A 4C7IA 2QYVA 2VI7A 1QSOA 4H6ZA 2CXAA 2Z3MA 4KVXA 4C2ZA 2ZOFA 5G20A 3FH4A 5F49A 4PPZA 5JM6A 1S5KA 2ZOGA 1LANA 1TXRA 4OIDA 4UWIA 3PEIA 4PQAA 4YFJA 3GIUA 3PRTA 4ONWA 1ELLP 3FNCA 2ANPA 1F2PA 4NXYA 2IJZA 1CM0A 8CPAA 1YSJA 1XBUA 1N71A 5THWA 4EWTA 2C27A 1QSRA 2C6PA 2QVPA 3KASA 1M4DA 4R6TA 2GU2A 1LAMA 4OP4A 1V0CA 1S7FA 1CPXA 3IIBA 2C1CA 2DPTA 1LRZA 3RO0A 2Q7BA 3LACA 3PFOA 3TO9A 1KUXA 4M3SA 3SXOA 4DJLA 3CPAA 4IK2A 4R3KA 2KCWA 3R9EA 2B3UA 1QSNA 2ZELA 4XNHC 3B2YA 3WABA 1YW4A 4KSAA 3T8WA 3WR7A 1ON0A 1TKHA 3I3GA 4ZX8A 2AFUA 5HVFA 4A32A 2DPSA 2BUEA 4NFRA 4BINA 1QSMA 3VWEA 5K8OA 4M6IA 3FJUA 1Z8TA 4NGQA 4A31A 3BHXA 3LWUA 4B10A 4OMEA 4I49A 3F0AA 1IU8A 1VKCA 1Q2DA 3KQXA 1VHSA 1YGHA 3V8IA 5A28A 2BO9A 2PJ8A 3E0KA 3D8PA 4PK3A 4E8OA 1CG2A 2JDDA 5G1ZA 2Q4ZA 3R95A 4CAFA 1Z4RA 1VHOA 5J8FA 3K9UA 3TTHA 4EVYA 4F8ZA 1X10A 3IJ3A 2FT0A 2Q51A 3I9SA 3PB8X 5AG6A 4WWVA 5H84A 5K8NA 4R57A 4PXDA 4RUHA 1S7NA 1GHEA 4KVME 4A39A 4AB7A 1BOBA 3RYOA 4A95A 5G21A 3KHXA 1OZPA 2BSWA 2ZEHA 4Q38A 1CP7A 4MCSA 3KHZA 2PRQA 4P4IA 3NA6A 1LCPA 3RAMA 2H5MA 1YW6A 1QQ9A 2WYRA 4QVTA 3SI2A 2ZENA 2PE3A 3CXPA 1A2ZA 3CXSA 2G3TA 3WC7A 2CNTA 3FECA 3FYNA 4NGPA 2I3CA 3ISZA 1ARLA 4P4FA 4XPLA 3S6HA 1BAVA 2XEFA 4KSIA 4NGMA 3VATA 4U9YA 4Y49C 4DUKA 1ZLIA 4HPSA 2B3VA 5DS0A 4B5PB 4JJXA 1YVKA 4A38A 2BCOA 2Z10A 2ZEDA 4NGNA 5I0CA 1TIQA 1BPNA 3RZAA 4MHNA 4ONUA 4B13A 1Z5RA 4MBUA 4Y49B 2Q43A 3JVNA 3RNZA 2F8HA 3DR6A 2R8VA 4PSXA 2GANA 3W6XA 4H2KA 2DF5A 2PJBA 4JLYA 2R7HA 1Y9KA 3IGRA 3PP9A 3KR5A 4LUAA 3PB9X 2RFHA 5EMIA 4AVCA 4F0YA 3CDXA 4NEXA 1Z2LA 2PJ0A 3DGVA 3LMSA 4LX9A 3FIXA 4PXEA 1FY7A 3KGQA 5CPAA 4A94A 2Q04A 1XRYA 4HKFA 5G22A 2ZW6A 1LAPA 4MCQA 4CGMA 3PB6X 4FD6A 4OC5A 4U5YA 3KKWA 4K30A 2OOTA 3B3VA 4NGTA 5C82A 3FXTA 2OZUA 7CPAA 2Q4YA 2FVGA 3UY5A 2OU2A 4KUBA 2VBQA 3EY5A 5I4MA 4YGOA 2ZXVA 4C68A 4UCNA 2PJ7A 1M44A 1FT7A 4OC2A 1UFHA 3VWDA 4FBEA 1XEBA 2P6GA 3GLJA 5JGFA 3SJXA 3ZJ0A 2YGWA 2OZGA 2EUIA 4UCPA 4MRIA 2ARHA 3JUWA 4P10A 1YLOA 4KZTA 3D4UA 4F9VA 1S7LA 2YNCC 4BMHA 3KZWA 4OC4A 4P4DA 2EO8A 4NCZA 1LFWA 1Y7EA 3D7HA 2V77A 4PK2A 3IU1A 2FSRA 3NH5A 1YX0A 2OB0A 4PSWA 2O53A 3LODA 4UEFA 5F47A 4AVAA 4NF1A 5EC4A 2FCKA 2NYQA 2G9DA 1IOFA 2IMOA 5IB0A 3D2MA 3G3SA 4R3LA 3ZZIA 5JPHA 2PCUA 1F2OA 3NFZA 3ISXA 2K5TA 4QUSA 5IB9A 2HUZA 2PJ3A 4L8AA 5F46A 1JWQA 1KUYA 4A33A 2HC9A 1XJOA 4JYWA 5JQ4A 2VXKA 1AUGA 1Z8WA 3GB0A 3A9LA 3BI0A 4AXVA 2I00A 3SJGA 3FMCA 4R8FA 1S60A 4NSQA 4O23A 3C26A 5HVGA 4FUUA 4AG7A 3N5FA 1PU9A 5JH9A 2PR8A 1OBRA 4UIBA 2EBJA 3QNVA 3H8FA 2YNCA 4M85A 3QAYA 4P44A 1J4JA 3I1UA 3R96A 2C6CA 1FNOA 1Y7RA 2VZYA 3S6KA 3D67A 3D68A 1AMPA 2ZEMA 3FEEA 4QC6A 1XMBA 4UBRA 2GLJA 1DE4C 3IWEA 2WUUA 1ZLHA 3B3CA 2Q4VA 2ZPAA 2V8GA 3IU2A 3MGDA 2C6GA 5J1QA 3FEDA 4LQGA 5K8PA 1YR0A 1I1DA 3OWCA 2V8HA 2CF4A 5A27A 4CGLA 2OR4A 2V8DA 3HUVA 1YREA 4UFWA 4XPKA 4OC0A 3VH9A 4UF4A 4X8IA 2ZEOA 4GS4A 3PBBA 2YNEA 1YLEA 1YQEA 1YK3A 2F7VA 2PVWA 3F8KA 4MFJA 5IV0A 2PSWA 4MHDA 4P6YA 1ZO0A 1ELMP 2POKA 4G1PA 2FE7A 3FBUA 4CPAA 3W91A 4KOYA 4XPDC 3D2PA 2VEZA 2ZEEA 4KOWA 3FF3A 2PIYA 2OH1A 1KUVA 3JTKA 1CX8A 2A4NA 4C2XA 4JXRA 4E0AA 2QMLA 2DEAA 3B35A 5ISVA 1TF9A 4OC3A 5H86A 1I12A 4CYOA 4NJQA 4X2TA 2FS5A 3S6FA 2AFZA 3H4QA 4MCRA 4A37A 2JDCA 1ZG7A 1Y0YA 4ORFA 3GY9A 5GCNA 4UFVA 1Y9WA 1P4NA 3KR4A 3H8EA 3PB7X 4L89A 4X5KA 2Q44A 3TOAA 4Z65A 2J8RA 1MJAA 1HDUA 4B5OA 2ODFA 2Z3OA 3LD2A 2FXFA 5AGEA 3TT2A 5J8CA 4II9A 4AG9A 2Q0YA 2Z3LA 2OZHA 2FIWA 4GM5A 4EFDA 5LYIA 4P4JA 5AG5A 2BOAA 2ZW5A 5K8MA 4KLVA 4KOUA 1Q2CA 1Q2YA 3KQZA 2R1IA 1HDQA 3TE4A 4UFXA 4RI1A 5E96A 2PJCA 2Z11A 2CNSA 1RXTA 1CBXA 3GYAA 3IFEA 5LYLA 2D4OA 4MJ8A 1R3NA 2Q7SA 4MXUA 2FL4A 5HXDA 3BXMA 3TCVA 4B6ZA 4MHPA 4FWUA 4ZBGA 2PJ4A 2BL1A 4JXQA 2HV2A 2RC4A 3SI0A 3T90A 4CRZB 3NE8A 4HNYB 4AVBA 1BLLE 2REFA 4OIWA 1IB1E 1KWMA 4KS9A 4KORA 3IWWA 4JD6A 4FAIA 3CT9A 3D7DA 1ZG8A 2O4HA 5LYDA 4DNCA 4ZY0A 5LRGA 4KOTA 4U9ZA 4A2ZA 3NE7A 1Y0RA 2GREA 3PGPA 5AG7A 4IUSA 5ELYA 2XEIA 3R9FA 2CIJA 4BD9A 2Z0ZA 5DWNA 1XMTA 2XEGA 3DNSA 4JZ0A 3PB4X 1F57A 2CY2A 3F5BA 3G8WA 3CZXA 3FX6A 6CPAA 3W6SA 2Z3KA 2AFWA 2PRBA 2Z3NA 3DLJA 4CAEA 1PCAA 4F6AA 2AE6A 2J8NA 5KTAA 2V8VA 3B3WA 5KTDA 1L0CA 3H5ZA 3R1KA 4OAEA 4R9MA 3S9LA 2PJAA 4H89A 4CGPA 3B3SA 1MJBA 3EO4A 3MN8A 4TNUA 4ZY1A 1XF8A 4OC1A 4DYOA 2WZNA 2ATRA 2CTBA 4YWYA 3S9MA 4CGOA 3D3SA 4GXHA 1B6BA 1I21A 4WJBA 1TF8A 1VHEA 3B8GA 3CPXA 3B3TA 4KVOE 4YRHA 1X12A 4MFPA 4MFZA 4Q36A 3SHPA 2GE3A 1PYTB 4KOSA 3PFEA 2REEA 4IF5A 1MJ9A 1M4LA 2ZEFA 2PR1A 1BO4A 2FIAA 3JRUA 4P4EA 2P6EA 4TWEA 2X7BA 4F0XA 4MFLA 4ZX9A 2ZW7A 4CAVA 4CYQA 2Z3PA 1IYKA 1DTDA 3DR8A 4HNWB 3R9GA 3L2NA 1IY7A 4JWPA 2B58A 5D29A 2Y0MA 3NH8A 2P6FA 4QBJA 4ZGYB 1PUAA 3DSBA 4ZI6A 1EE3P 3EXNA 4MI4A 1XFOA 3DDDA 3V7ZA 3KI9A 4B14A 1IYLA 2EK8A 4C7HA 3TX8A 3H8GA 4C2YA 4CRYB 3S9NA 3K2KA 2R98A 1B87A 2WSAA 2CNMA 3D7FA 5FVJA 2D4PA 2ABZA 5AG4A 3FRMA 4FD4A 2EVNA 1R57A 4PXBA 1IGBA 3HLPA 2O28A 4UCMA 4F9UA 2HB6A 3IC1A 3TOBA 2QJ8A 1LOKA 1QMUA 4IAVA 1RO5A 3D66A 4KUAA 1K4JA 4UA3A 3MRUA 2ZEGA 4B11A 3D7GA 5F09A 3FVLA 3QB8A 4MY3A 4BBHA 2PDOA 4RS2A 3B7IA 2JLMA 4P4BA 4FD5A 3VARA 4E2AA 2PJ6A 2B4BA 3IWGA 1P0HA 3P2HA 3BJ8A 3PZJA 4MHYA 2JBKA 3RBUA 1VIXA 5CBMA 2GIVA 1M4GA 5HVHA 4CAXA 2G3AA 2XEJA 1RTQA 4MY0A 5D8NA 1GYTA 2AFXA 1SQHA 4PV6A 4YU9A 1S7KA 1M4IA 4UEZA 2GFQA 4KOXA 4OADA 5C88A 2ZEPA 3WC5A 3SXNA 1NSLA 4Q7AA 2PJ9A 3TO6A 2YNDA 1R43A 2GLFA 3NH4A 4UEEA 4MCPA 5DWMA 1S3ZA 1WWZA 2JEWA 4HNXB 5CNPA 3EFAA 3SJEA 4MFKA 1TKFA 5LRKA 1VGYA 2DXQA 2WPWA 3T9YA 1QSTA 2NMTA 4OKOA 4RN7A 3BLNA 2B5GA 4CYNA 5HMNA 1Z8XA 4ZY2A 3N7ZA 1BPMA 2PJ5A 3TO7A 4CYPA 3TFYA 1CPSA 4W9YA 4J3GA 4EMEA 1NE9A 4X3RA 5F48A 1H8LA 3V38A 1XE4A 1NMTA 3WC6A 2QIRA 4UIAA 2F5IA 4KOVA 1U6MA 3BJ7A 4M6GA 1Z4EA 4LQ6A 2EWBA 3GUXA 2CTCA 4MHZA 1MK4A 2P0WA 1IIDA 1Z9UA 2IQ6A 4R76A 1ARMA 4MFQA 5KTCA 4MMOA 4P45A 2VZZA 4NJRA 2B5GB 4NGSA 4CAWA 1AYEA 4CS0B 3PBEA 2QECA 2B4DB 2ZW4A 1HEEA 1M1DA 4QB9A 1XOVA 4B12A 1JQGA 5LRJA 1YVOA 2HQYA 4PXCA 4CGNA 1YMEA 3KL9A 1KZFA 2EK9A 4R7MA 2AFMA 2WPXA 4M6HA 4KLWA 2AFSA 1Z8LA 1Q7LA 2BEIA 2I79A 2PQ8A 2AJ6A 4XPDB 3BI1A 2PJ2A 1XIXA 1UWYA 2J9AA 3IO1A 3SJFA 4H6UA 3FB3A 4A30A 3K9TA 4UWJA
chains in the Genus database with same CATH topology
3S6GA 5IX3A 4R87A 2IL4A 2JEVA 2B4DA 3P2FA 4OLLA 5BWAB 3EC4A 3CXQA 4B5PA 3QAHA 4FD7A 5EBVA 4XNHB 1CJWA 5HH1A 2G0BA 2VQYA 3GKRA 1IICA 4KSFA 2J8MA 2PC1A 1WK4A 4C7IA 2VI7A 4H6ZA 1QSOA 2CXAA 2Z3MA 4KVXA 4C2ZA 5G20A 5F49A 1S5KA 4UWIA 4YFJA 3FNCA 4NXYA 1CM0A 1N71A 2C27A 1QSRA 1M4DA 1V0CA 1S7FA 2DPTA 1LRZA 2Q7BA 3TO9A 1KUXA 4M3SA 3SXOA 4R3KA 2KCWA 3R9EA 2B3UA 1QSNA 4XNHC 4KSAA 1ON0A 3I3GA 4A32A 2DPSA 2BUEA 1QSMA 3VWEA 4A31A 4B10A 4I49A 3F0AA 1VKCA 1Q2DA 3V8IA 1VHSA 1YGHA 5A28A 3E0KA 3D8PA 4PK3A 4E8OA 2JDDA 5G1ZA 3R95A 4CAFA 5J8FA 1Z4RA 5KTCA 3K9UA 3TTHA 4EVYA 2FT0A 3I9SA 5AG6A 5H84A 4R57A 1S7NA 1GHEA 4KVME 4AB7A 1BOBA 3RYOA 4A95A 5G21A 1OZPA 2BSWA 4Q38A 2H5MA 4QVTA 3CXPA 3CXSA 2G3TA 2CNTA 3FYNA 4XPLA 3S6HA 4U9YA 4Y49C 2B3VA 4B5PB 4JJXA 1YVKA 2Z10A 5I0CA 1TIQA 4ONUA 4B13A 4Y49B 4MBUA 3JVNA 3DR6A 2R8VA 4PSXA 2GANA 3W6XA 4JLYA 2R7HA 1Y9KA 3IGRA 3PP9A 4LUAA 4AVCA 4F0YA 4NEXA 4LX9A 3FIXA 1FY7A 2Q04A 4HKFA 5G22A 2ZW6A 4CGMA 4FD6A 4U5YA 3KKWA 4K30A 5C82A 3FXTA 2OZUA 2Q4YA 3UY5A 2OU2A 4KUBA 2VBQA 3EY5A 4YGOA 2ZXVA 4C68A 4UCNA 1M44A 1UFHA 3VWDA 1XEBA 2P6GA 3ZJ0A 2YGWA 2OZGA 2EUIA 4UCPA 2ARHA 3JUWA 4KZTA 1S7LA 2YNCC 4BMHA 4NCZA 3WR7A 4PK2A 4PSWA 3IU1A 2FSRA 1YX0A 2OB0A 5F47A 3LODA 4AVAA 4NF1A 5EC4A 2FCKA 5IB0A 3D2MA 3G3SA 4R3LA 3ZZIA 5JPHA 4QUSA 2K5TA 2HUZA 4L8AA 5F46A 1KUYA 4A33A 5JQ4A 2VXKA 3A9LA 2I00A 1S60A 4NSQA 3C26A 4AG7A 1PU9A 2PR8A 2YNCA 4M85A 1J4JA 3R96A 1Y7RA 2VZYA 3S6KA 4QC6A 4UBRA 3IWEA 2WUUA 2Q4VA 2ZPAA 3IU2A 3MGDA 1YR0A 1I1DA 3OWCA 5A27A 4CGLA 1YREA 4UFWA 4XPKA 4GS4A 2YNEA 1YLEA 1YK3A 3F8KA 4MFJA 5IV0A 4MHDA 2PSWA 1ZO0A 2FE7A 3FBUA 3W91A 4KOYA 4XPDC 3D2PA 2VEZA 4KOWA 2OH1A 1KUVA 3JTKA 2A4NA 4C2XA 4JXRA 4E0AA 2QMLA 5ISVA 5H86A 1I12A 4CYOA 2FS5A 3S6FA 3H4QA 2JDCA 4ORFA 3GY9A 5GCNA 4UFVA 1Y9WA 1P4NA 4L89A 4X5KA 2Q44A 3TOAA 2J8RA 1MJAA 4B5OA 2Z3OA 3LD2A 2FXFA 5AGEA 3TT2A 5J8CA 4II9A 4AG9A 2Q0YA 2Z3LA 2OZHA 2FIWA 5AG5A 2ZW5A 4KLVA 4KOUA 1Q2CA 1Q2YA 2R1IA 3TE4A 4UFXA 4RI1A 5E96A 2Z11A 2CNSA 1RXTA 3GYAA 2D4OA 4MJ8A 2FL4A 3TCVA 4ZBGA 3T90A 2BL1A 4JXQA 2HV2A 2RC4A 4CRZB 4HNYB 4AVBA 2REFA 1IB1E 4KS9A 4KORA 4JD6A 4DNCA 4KOTA 4U9ZA 4A2ZA 3NE7A 3PGPA 5AG7A 4IUSA 3R9FA 2Z0ZA 5DWNA 1XMTA 3DNSA 2CY2A 3F5BA 3G8WA 3W6SA 2Z3KA 2PRBA 2Z3NA 4CAEA 4F6AA 2AE6A 2J8NA 5KTAA 5KTDA 1L0CA 3H5ZA 3R1KA 4OAEA 4R9MA 4H89A 4CGPA 1MJBA 3EO4A 1XF8A 2ATRA 4CGOA 3D3SA 1B6BA 1I21A 3B8GA 4KVOE 4YRHA 4MFPA 4MFZA 4Q36A 3SHPA 2GE3A 4KOSA 2REEA 4IF5A 1MJ9A 2PR1A 1BO4A 2FIAA 2P6EA 2X7BA 4F0XA 4MFLA 4CYQA 2ZW7A 4CAVA 2Z3PA 1IYKA 3DR8A 4HNWB 3R9GA 4JWPA 2B58A 2Y0MA 2P6FA 4QBJA 4ZGYB 1PUAA 3DSBA 3EXNA 4MI4A 3DDDA 4B14A 1IYLA 4C7HA 4C2YA 4CRYB 2R98A 1B87A 2WSAA 2CNMA 5AG4A 5FVJA 2D4PA 3FRMA 4FD4A 2EVNA 1R57A 4UCMA 2O28A 3TOBA 1RO5A 4KUAA 1K4JA 4UA3A 4B11A 3QB8A 4MY3A 4BBHA 2PDOA 4RS2A 2JLMA 4FD5A 4E2AA 2B4BA 3IWGA 3PZJA 1P0HA 3BJ8A 3P2HA 2GIVA 1M4GA 4CAXA 2G3AA 4MY0A 1SQHA 4PV6A 1S7KA 1M4IA 4KOXA 4OADA 5C88A 3SXNA 1NSLA 3TO6A 2YNDA 5DWMA 1S3ZA 1WWZA 4HNXB 5CNPA 3EFAA 4MFKA 2DXQA 3T9YA 2WPWA 1QSTA 2NMTA 3BLNA 2B5GA 4CYNA 5HMNA 3N7ZA 3TO7A 4CYPA 3TFYA 4J3GA 1NE9A 5F48A 1XE4A 1NMTA 2QIRA 2F5IA 4KOVA 1U6MA 3BJ7A 1Z4EA 1MK4A 2P0WA 1IIDA 1Z9UA 4MFQA 2VZZA 2B5GB 4CAWA 4CS0B 2QECA 2B4DB 2ZW4A 1M1DA 4QB9A 4B12A 1YVOA 2HQYA 4CGNA 1KZFA 2WPXA 4KLWA 2BEIA 2I79A 2PQ8A 2AJ6A 4XPDB 1XIXA 4H6UA 3FB3A 4A30A 4UWJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S6G A;  5IX3 A;  4R87 A;  2IL4 A;  2JEV A;  2B4D A;  3P2F A;  4OLL A;  3EC4 A;  3CXQ A;  4B5P A;  3QAH A;  4FD7 A;  5EBV A;  4XNH B;  1CJW A;  5HH1 A;  2G0B A;  2VQY A;  3GKR A;  1IIC A;  2J8M A;  2PC1 A;  1WK4 A;  2VI7 A;  4H6Z A;  1QSO A;  4KVX A;  5F49 A;  1S5K A;  4UWI A;  4YFJ A;  3FNC A;  4NXY A;  1CM0 A;  1N71 A;  2C27 A;  1QSR A;  1M4D A;  1V0C A;  1S7F A;  1LRZ A;  2Q7B A;  3TO9 A;  1KUX A;  4M3S A;  3SXO A;  4R3K A;  2KCW A;  3R9E A;  2B3U A;  1QSN A;  4XNH C;  1ON0 A;  3I3G A;  2BUE A;  1QSM A;  3VWE A;  4I49 A;  3F0A A;  1VKC A;  1Q2D A;  3V8I A;  1VHS A;  1YGH A;  3E0K A;  3D8P A;  4PK3 A;  4E8O A;  2JDD A;  3R95 A;  5J8F A;  1Z4R A;  5KTC A;  3K9U A;  3TTH A;  4EVY A;  2FT0 A;  3I9S A;  5H84 A;  4R57 A;  1S7N A;  1GHE A;  4KVM E;  4AB7 A;  1BOB A;  3RYO A;  1OZP A;  2BSW A;  2H5M A;  4QVT A;  3CXP A;  3CXS A;  2G3T A;  2CNT A;  3FYN A;  4XPL A;  3S6H A;  4U9Y A;  4Y49 C;  2B3V A;  4B5P B;  4JJX A;  1YVK A;  2Z10 A;  5I0C A;  1TIQ A;  4ONU A;  4Y49 B;  4MBU A;  3JVN A;  3DR6 A;  2R8V A;  4PSX A;  2GAN A;  3W6X A;  4JLY A;  2R7H A;  1Y9K A;  3IGR A;  3PP9 A;  4LUA A;  4AVC A;  4F0Y A;  4NEX A;  4LX9 A;  3FIX A;  1FY7 A;  2Q04 A;  4HKF A;  2ZW6 A;  4FD6 A;  4U5Y A;  3KKW A;  4K30 A;  5C82 A;  3FXT A;  2OZU A;  2Q4Y A;  3UY5 A;  2OU2 A;  4KUB A;  2VBQ A;  3EY5 A;  4YGO A;  2ZXV A;  1M44 A;  1UFH A;  3VWD A;  1XEB A;  2P6G A;  3ZJ0 A;  2OZG A;  2EUI A;  2ARH A;  3JUW A;  4KZT A;  1S7L A;  4BMH A;  4NCZ A;  3WR7 A;  4PK2 A;  4PSW A;  2FSR A;  1YX0 A;  2OB0 A;  5F47 A;  3LOD A;  4AVA A;  4NF1 A;  5EC4 A;  2FCK A;  5IB0 A;  3D2M A;  3G3S A;  4R3L A;  3ZZI A;  5JPH A;  4QUS A;  2K5T A;  2HUZ A;  4L8A A;  5F46 A;  1KUY A;  5JQ4 A;  2VXK A;  2I00 A;  1S60 A;  4NSQ A;  3C26 A;  4AG7 A;  1PU9 A;  2PR8 A;  4M85 A;  1J4J A;  3R96 A;  1Y7R A;  2VZY A;  3S6K A;  4QC6 A;  4UBR A;  2Q4V A;  2ZPA A;  3MGD A;  1YR0 A;  1I1D A;  3OWC A;  1YRE A;  4XPK A;  4GS4 A;  1YLE A;  1YK3 A;  3F8K A;  5IV0 A;  4MHD A;  2PSW A;  2FE7 A;  3FBU A;  3W91 A;  4KOY A;  4XPD C;  3D2P A;  2VEZ A;  4KOW A;  2OH1 A;  1KUV A;  2A4N A;  4JXR A;  4E0A A;  2QML A;  5ISV A;  5H86 A;  1I12 A;  2FS5 A;  3S6F A;  3H4Q A;  2JDC A;  4ORF A;  3GY9 A;  5GCN A;  4X5K A;  1Y9W A;  1P4N A;  4L89 A;  2Q44 A;  3TOA A;  2J8R A;  1MJA A;  4B5O A;  3LD2 A;  2FXF A;  3TT2 A;  5J8C A;  4II9 A;  4AG9 A;  2Q0Y A;  2OZH A;  2FIW A;  2ZW5 A;  4KLV A;  4KOU A;  1Q2C A;  1Q2Y A;  2R1I A;  3TE4 A;  4RI1 A;  5E96 A;  2Z11 A;  2CNS A;  1RXT A;  3GYA A;  2D4O A;  4MJ8 A;  2FL4 A;  3TCV A;  4ZBG A;  3T90 A;  2BL1 A;  4JXQ A;  2HV2 A;  2RC4 A;  4CRZ B;  4HNY B;  4AVB A;  2REF A;  1IB1 E;  4KOR A;  4JD6 A;  4DNC A;  4KOT A;  4U9Z A;  3NE7 A;  3PGP A;  4IUS A;  3R9F A;  2Z0Z A;  5DWN A;  1XMT A;  3DNS A;  2CY2 A;  3F5B A;  3G8W A;  3W6S A;  2PRB A;  4F6A A;  2AE6 A;  2J8N A;  5KTA A;  5KTD A;  1L0C A;  3R1K A;  4R9M A;  4OAE A;  4H89 A;  1MJB A;  3EO4 A;  1XF8 A;  2ATR A;  3D3S A;  1B6B A;  1I21 A;  3B8G A;  4KVO E;  4YRH A;  3SHP A;  2GE3 A;  4KOS A;  2REE A;  4IF5 A;  1MJ9 A;  2PR1 A;  1BO4 A;  2FIA A;  2P6E A;  2X7B A;  2ZW7 A;  4CAV A;  3DR8 A;  1IYK A;  4HNW B;  3R9G A;  4JWP A;  2B58 A;  2Y0M A;  2P6F A;  4QBJ A;  1PUA A;  3DSB A;  3EXN A;  4MI4 A;  3DDD A;  1IYL A;  4CRY B;  2R98 A;  1B87 A;  2CNM A;  5FVJ A;  2D4P A;  3FRM A;  4FD4 A;  2EVN A;  1R57 A;  2O28 A;  3TOB A;  1RO5 A;  4KUA A;  1K4J A;  4UA3 A;  3QB8 A;  4MY3 A;  2PDO A;  4RS2 A;  2JLM A;  4FD5 A;  4E2A A;  2B4B A;  3IWG A;  3PZJ A;  1P0H A;  3BJ8 A;  3P2H A;  2GIV A;  1M4G A;  4CAX A;  2G3A A;  4MY0 A;  1SQH A;  4PV6 A;  1S7K A;  1M4I A;  4KOX A;  4OAD A;  5C88 A;  3SXN A;  1NSL A;  3TO6 A;  5DWM A;  1S3Z A;  1WWZ A;  4HNX B;  5CNP A;  3EFA A;  2DXQ A;  3T9Y A;  2WPW A;  1QST A;  2NMT A;  3BLN A;  2B5G A;  5HMN A;  3N7Z A;  3TO7 A;  3TFY A;  4J3G A;  1NE9 A;  5F48 A;  1XE4 A;  1NMT A;  2QIR A;  2F5I A;  4KOV A;  1U6M A;  3BJ7 A;  1Z4E A;  1MK4 A;  2P0W A;  1IID A;  1Z9U A;  2VZZ A;  2B5G B;  4CAW A;  4CS0 B;  2QEC A;  2B4D B;  2ZW4 A;  1M1D A;  4QB9 A;  1YVO A;  2HQY A;  1KZF A;  2WPX A;  4KLW A;  2BEI A;  2I79 A;  2PQ8 A;  2AJ6 A;  4XPD B;  1XIX A;  4H6U A;  3FB3 A;  4UWJ A; 
#chains in the Genus database with same CATH topology
 3IEH A;  1ZG9 A;  4NGR A;  3S6G A;  5IX3 A;  2RB7 A;  3SI1 A;  4R87 A;  2IL4 A;  2JEV A;  4K3N A;  3WT4 A;  3TC8 A;  1TKJ A;  4IHM A;  2B4D A;  3P2F A;  4OLL A;  2PIZ A;  5BWA B;  3EC4 A;  3CXQ A;  4B5P A;  3QAH A;  4FD7 A;  4ZYQ A;  2JBJ A;  5EBV A;  2NSM A;  1CJW A;  2PVV A;  2G0B A;  4XNH B;  1CP6 A;  2VQY A;  3GKR A;  5HH1 A;  1IIC A;  5LYF A;  2AFO A;  1NSA A;  2VL1 A;  2PJ1 A;  4KSF A;  1IOI A;  2J8M A;  2PC1 A;  1WK4 A;  4C7I A;  2QYV A;  2VI7 A;  1QSO A;  4H6Z A;  2CXA A;  2Z3M A;  4KVX A;  4C2Z A;  2ZOF A;  5G20 A;  3FH4 A;  5F49 A;  4PPZ A;  5JM6 A;  1S5K A;  2ZOG A;  1LAN A;  1TXR A;  4OID A;  4UWI A;  3PEI A;  4PQA A;  4YFJ A;  3GIU A;  3PRT A;  4ONW A;  1ELL P;  3FNC A;  2ANP A;  1F2P A;  4NXY A;  2IJZ A;  1CM0 A;  8CPA A;  1YSJ A;  1XBU A;  1N71 A;  5THW A;  4EWT A;  2C27 A;  1QSR A;  2C6P A;  2QVP A;  3KAS A;  1M4D A;  4R6T A;  2GU2 A;  1LAM A;  4OP4 A;  1V0C A;  1S7F A;  1CPX A;  3IIB A;  2C1C A;  2DPT A;  1LRZ A;  3RO0 A;  2Q7B A;  3LAC A;  3PFO A;  3TO9 A;  1KUX A;  4M3S A;  3SXO A;  4DJL A;  3CPA A;  4IK2 A;  4R3K A;  2KCW A;  3R9E A;  2B3U A;  1QSN A;  2ZEL A;  4XNH C;  3B2Y A;  3WAB A;  1YW4 A;  4KSA A;  3T8W A;  3WR7 A;  1ON0 A;  1TKH A;  3I3G A;  4ZX8 A;  2AFU A;  5HVF A;  4A32 A;  2DPS A;  2BUE A;  4NFR A;  4BIN A;  1QSM A;  3VWE A;  5K8O A;  4M6I A;  3FJU A;  1Z8T A;  4NGQ A;  4A31 A;  3BHX A;  3LWU A;  4B10 A;  4OME A;  4I49 A;  3F0A A;  1IU8 A;  1VKC A;  1Q2D A;  3KQX A;  1VHS A;  1YGH A;  3V8I A;  5A28 A;  2BO9 A;  2PJ8 A;  3E0K A;  3D8P A;  4PK3 A;  4E8O A;  1CG2 A;  2JDD A;  5G1Z A;  2Q4Z A;  3R95 A;  4CAF A;  1Z4R A;  1VHO A;  5J8F A;  3K9U A;  3TTH A;  4EVY A;  4F8Z A;  1X10 A;  3IJ3 A;  2FT0 A;  2Q51 A;  3I9S A;  3PB8 X;  5AG6 A;  4WWV A;  5H84 A;  5K8N A;  4R57 A;  4PXD A;  4RUH A;  1S7N A;  1GHE A;  4KVM E;  4A39 A;  4AB7 A;  1BOB A;  3RYO A;  4A95 A;  5G21 A;  3KHX A;  1OZP A;  2BSW A;  2ZEH A;  4Q38 A;  1CP7 A;  4MCS A;  3KHZ A;  2PRQ A;  4P4I A;  3NA6 A;  1LCP A;  3RAM A;  2H5M A;  1YW6 A;  1QQ9 A;  2WYR A;  4QVT A;  3SI2 A;  2ZEN A;  2PE3 A;  3CXP A;  1A2Z A;  3CXS A;  2G3T A;  3WC7 A;  2CNT A;  3FEC A;  3FYN A;  4NGP A;  2I3C A;  3ISZ A;  1ARL A;  4P4F A;  4XPL A;  3S6H A;  1BAV A;  2XEF A;  4KSI A;  4NGM A;  3VAT A;  4U9Y A;  4Y49 C;  4DUK A;  1ZLI A;  4HPS A;  2B3V A;  5DS0 A;  4B5P B;  4JJX A;  1YVK A;  4A38 A;  2BCO A;  2Z10 A;  2ZED A;  4NGN A;  5I0C A;  1TIQ A;  1BPN A;  3RZA A;  4MHN A;  4ONU A;  4B13 A;  1Z5R A;  4MBU A;  4Y49 B;  2Q43 A;  3JVN A;  3RNZ A;  2F8H A;  3DR6 A;  2R8V A;  4PSX A;  2GAN A;  3W6X A;  4H2K A;  2DF5 A;  2PJB A;  4JLY A;  2R7H A;  1Y9K A;  3IGR A;  3PP9 A;  3KR5 A;  4LUA A;  3PB9 X;  2RFH A;  5EMI A;  4AVC A;  4F0Y A;  3CDX A;  4NEX A;  1Z2L A;  2PJ0 A;  3DGV A;  3LMS A;  4LX9 A;  3FIX A;  4PXE A;  1FY7 A;  3KGQ A;  5CPA A;  4A94 A;  2Q04 A;  1XRY A;  4HKF A;  5G22 A;  2ZW6 A;  1LAP A;  4MCQ A;  4CGM A;  3PB6 X;  4FD6 A;  4OC5 A;  4U5Y A;  3KKW A;  4K30 A;  2OOT A;  3B3V A;  4NGT A;  5C82 A;  3FXT A;  2OZU A;  7CPA A;  2Q4Y A;  2FVG A;  3UY5 A;  2OU2 A;  4KUB A;  2VBQ A;  3EY5 A;  5I4M A;  4YGO A;  2ZXV A;  4C68 A;  4UCN A;  2PJ7 A;  1M44 A;  1FT7 A;  4OC2 A;  1UFH A;  3VWD A;  4FBE A;  1XEB A;  2P6G A;  3GLJ A;  5JGF A;  3SJX A;  3ZJ0 A;  2YGW A;  2OZG A;  2EUI A;  4UCP A;  4MRI A;  2ARH A;  3JUW A;  4P10 A;  1YLO A;  4KZT A;  3D4U A;  4F9V A;  1S7L A;  2YNC C;  4BMH A;  3KZW A;  4OC4 A;  4P4D A;  2EO8 A;  4NCZ A;  1LFW A;  1Y7E A;  3D7H A;  2V77 A;  4PK2 A;  3IU1 A;  2FSR A;  3NH5 A;  1YX0 A;  2OB0 A;  4PSW A;  2O53 A;  3LOD A;  4UEF A;  5F47 A;  4AVA A;  4NF1 A;  5EC4 A;  2FCK A;  2NYQ A;  2G9D A;  1IOF A;  2IMO A;  5IB0 A;  3D2M A;  3G3S A;  4R3L A;  3ZZI A;  5JPH A;  2PCU A;  1F2O A;  3NFZ A;  3ISX A;  2K5T A;  4QUS A;  5IB9 A;  2HUZ A;  2PJ3 A;  4L8A A;  5F46 A;  1JWQ A;  1KUY A;  4A33 A;  2HC9 A;  1XJO A;  4JYW A;  5JQ4 A;  2VXK A;  1AUG A;  1Z8W A;  3GB0 A;  3A9L A;  3BI0 A;  4AXV A;  2I00 A;  3SJG A;  3FMC A;  4R8F A;  1S60 A;  4NSQ A;  4O23 A;  3C26 A;  5HVG A;  4FUU A;  4AG7 A;  3N5F A;  1PU9 A;  5JH9 A;  2PR8 A;  1OBR A;  4UIB A;  2EBJ A;  3QNV A;  3H8F A;  2YNC A;  4M85 A;  3QAY A;  4P44 A;  1J4J A;  3I1U A;  3R96 A;  2C6C A;  1FNO A;  1Y7R A;  2VZY A;  3S6K A;  3D67 A;  3D68 A;  1AMP A;  2ZEM A;  3FEE A;  4QC6 A;  1XMB A;  4UBR A;  2GLJ A;  1DE4 C;  3IWE A;  2WUU A;  1ZLH A;  3B3C A;  2Q4V A;  2ZPA A;  2V8G A;  3IU2 A;  3MGD A;  2C6G A;  5J1Q A;  3FED A;  4LQG A;  5K8P A;  1YR0 A;  1I1D A;  3OWC A;  2V8H A;  2CF4 A;  5A27 A;  4CGL A;  2OR4 A;  2V8D A;  3HUV A;  1YRE A;  4UFW A;  4XPK A;  4OC0 A;  3VH9 A;  4UF4 A;  4X8I A;  2ZEO A;  4GS4 A;  3PBB A;  2YNE A;  1YLE A;  1YQE A;  1YK3 A;  2F7V A;  2PVW A;  3F8K A;  4MFJ A;  5IV0 A;  2PSW A;  4MHD A;  4P6Y A;  1ZO0 A;  1ELM P;  2POK A;  4G1P A;  2FE7 A;  3FBU A;  4CPA A;  3W91 A;  4KOY A;  4XPD C;  3D2P A;  2VEZ A;  2ZEE A;  4KOW A;  3FF3 A;  2PIY A;  2OH1 A;  1KUV A;  3JTK A;  1CX8 A;  2A4N A;  4C2X A;  4JXR A;  4E0A A;  2QML A;  2DEA A;  3B35 A;  5ISV A;  1TF9 A;  4OC3 A;  5H86 A;  1I12 A;  4CYO A;  4NJQ A;  4X2T A;  2FS5 A;  3S6F A;  2AFZ A;  3H4Q A;  4MCR A;  4A37 A;  2JDC A;  1ZG7 A;  1Y0Y A;  4ORF A;  3GY9 A;  5GCN A;  4UFV A;  1Y9W A;  1P4N A;  3KR4 A;  3H8E A;  3PB7 X;  4L89 A;  4X5K A;  2Q44 A;  3TOA A;  4Z65 A;  2J8R A;  1MJA A;  1HDU A;  4B5O A;  2ODF A;  2Z3O A;  3LD2 A;  2FXF A;  5AGE A;  3TT2 A;  5J8C A;  4II9 A;  4AG9 A;  2Q0Y A;  2Z3L A;  2OZH A;  2FIW A;  4GM5 A;  4EFD A;  5LYI A;  4P4J A;  5AG5 A;  2BOA A;  2ZW5 A;  5K8M A;  4KLV A;  4KOU A;  1Q2C A;  1Q2Y A;  3KQZ A;  2R1I A;  1HDQ A;  3TE4 A;  4UFX A;  4RI1 A;  5E96 A;  2PJC A;  2Z11 A;  2CNS A;  1RXT A;  1CBX A;  3GYA A;  3IFE A;  5LYL A;  2D4O A;  4MJ8 A;  1R3N A;  2Q7S A;  4MXU A;  2FL4 A;  5HXD A;  3BXM A;  3TCV A;  4B6Z A;  4MHP A;  4FWU A;  4ZBG A;  2PJ4 A;  2BL1 A;  4JXQ A;  2HV2 A;  2RC4 A;  3SI0 A;  3T90 A;  4CRZ B;  3NE8 A;  4HNY B;  4AVB A;  1BLL E;  2REF A;  4OIW A;  1IB1 E;  1KWM A;  4KS9 A;  4KOR A;  3IWW A;  4JD6 A;  4FAI A;  3CT9 A;  3D7D A;  1ZG8 A;  2O4H A;  5LYD A;  4DNC A;  4ZY0 A;  5LRG A;  4KOT A;  4U9Z A;  4A2Z A;  3NE7 A;  1Y0R A;  2GRE A;  3PGP A;  5AG7 A;  4IUS A;  5ELY A;  2XEI A;  3R9F A;  2CIJ A;  4BD9 A;  2Z0Z A;  5DWN A;  1XMT A;  2XEG A;  3DNS A;  4JZ0 A;  3PB4 X;  1F57 A;  2CY2 A;  3F5B A;  3G8W A;  3CZX A;  3FX6 A;  6CPA A;  3W6S A;  2Z3K A;  2AFW A;  2PRB A;  2Z3N A;  3DLJ A;  4CAE A;  1PCA A;  4F6A A;  2AE6 A;  2J8N A;  5KTA A;  2V8V A;  3B3W A;  5KTD A;  1L0C A;  3H5Z A;  3R1K A;  4OAE A;  4R9M A;  3S9L A;  2PJA A;  4H89 A;  4CGP A;  3B3S A;  1MJB A;  3EO4 A;  3MN8 A;  4TNU A;  4ZY1 A;  1XF8 A;  4OC1 A;  4DYO A;  2WZN A;  2ATR A;  2CTB A;  4YWY A;  3S9M A;  4CGO A;  3D3S A;  4GXH A;  1B6B A;  1I21 A;  4WJB A;  1TF8 A;  1VHE A;  3B8G A;  3CPX A;  3B3T A;  4KVO E;  4YRH A;  1X12 A;  4MFP A;  4MFZ A;  4Q36 A;  3SHP A;  2GE3 A;  1PYT B;  4KOS A;  3PFE A;  2REE A;  4IF5 A;  1MJ9 A;  1M4L A;  2ZEF A;  2PR1 A;  1BO4 A;  2FIA A;  3JRU A;  4P4E A;  2P6E A;  4TWE A;  2X7B A;  4F0X A;  4MFL A;  4ZX9 A;  2ZW7 A;  4CAV A;  4CYQ A;  2Z3P A;  1IYK A;  1DTD A;  3DR8 A;  4HNW B;  3R9G A;  3L2N A;  1IY7 A;  4JWP A;  2B58 A;  5D29 A;  2Y0M A;  3NH8 A;  2P6F A;  4QBJ A;  4ZGY B;  1PUA A;  3DSB A;  4ZI6 A;  1EE3 P;  3EXN A;  4MI4 A;  1XFO A;  3DDD A;  3V7Z A;  3KI9 A;  4B14 A;  1IYL A;  2EK8 A;  4C7H A;  3TX8 A;  3H8G A;  4C2Y A;  4CRY B;  3S9N A;  3K2K A;  2R98 A;  1B87 A;  2WSA A;  2CNM A;  3D7F A;  5FVJ A;  2D4P A;  2ABZ A;  5AG4 A;  3FRM A;  4FD4 A;  2EVN A;  1R57 A;  4PXB A;  1IGB A;  3HLP A;  2O28 A;  4UCM A;  4F9U A;  2HB6 A;  3IC1 A;  3TOB A;  2QJ8 A;  1LOK A;  1QMU A;  4IAV A;  1RO5 A;  3D66 A;  4KUA A;  1K4J A;  4UA3 A;  3MRU A;  2ZEG A;  4B11 A;  3D7G A;  5F09 A;  3FVL A;  3QB8 A;  4MY3 A;  4BBH A;  2PDO A;  4RS2 A;  3B7I A;  2JLM A;  4P4B A;  4FD5 A;  3VAR A;  4E2A A;  2PJ6 A;  2B4B A;  3IWG A;  1P0H A;  3P2H A;  3BJ8 A;  3PZJ A;  4MHY A;  2JBK A;  3RBU A;  1VIX A;  5CBM A;  2GIV A;  1M4G A;  5HVH A;  4CAX A;  2G3A A;  2XEJ A;  1RTQ A;  4MY0 A;  5D8N A;  1GYT A;  2AFX A;  1SQH A;  4PV6 A;  4YU9 A;  1S7K A;  1M4I A;  4UEZ A;  2GFQ A;  4KOX A;  4OAD A;  5C88 A;  2ZEP A;  3WC5 A;  3SXN A;  1NSL A;  4Q7A A;  2PJ9 A;  3TO6 A;  2YND A;  1R43 A;  2GLF A;  3NH4 A;  4UEE A;  4MCP A;  5DWM A;  1S3Z A;  1WWZ A;  2JEW A;  4HNX B;  5CNP A;  3EFA A;  3SJE A;  4MFK A;  1TKF A;  5LRK A;  1VGY A;  2DXQ A;  2WPW A;  3T9Y A;  1QST A;  2NMT A;  4OKO A;  4RN7 A;  3BLN A;  2B5G A;  4CYN A;  5HMN A;  1Z8X A;  4ZY2 A;  3N7Z A;  1BPM A;  2PJ5 A;  3TO7 A;  4CYP A;  3TFY A;  1CPS A;  4W9Y A;  4J3G A;  4EME A;  1NE9 A;  4X3R A;  5F48 A;  1H8L A;  3V38 A;  1XE4 A;  1NMT A;  3WC6 A;  2QIR A;  4UIA A;  2F5I A;  4KOV A;  1U6M A;  3BJ7 A;  4M6G A;  1Z4E A;  4LQ6 A;  2EWB A;  3GUX A;  2CTC A;  4MHZ A;  1MK4 A;  2P0W A;  1IID A;  1Z9U A;  2IQ6 A;  4R76 A;  1ARM A;  4MFQ A;  5KTC A;  4MMO A;  4P45 A;  2VZZ A;  4NJR A;  2B5G B;  4NGS A;  4CAW A;  1AYE A;  4CS0 B;  3PBE A;  2QEC A;  2B4D B;  2ZW4 A;  1HEE A;  1M1D A;  4QB9 A;  1XOV A;  4B12 A;  1JQG A;  5LRJ A;  1YVO A;  2HQY A;  4PXC A;  4CGN A;  1YME A;  3KL9 A;  1KZF A;  2EK9 A;  4R7M A;  2AFM A;  2WPX A;  4M6H A;  4KLW A;  2AFS A;  1Z8L A;  1Q7L A;  2BEI A;  2I79 A;  2PQ8 A;  2AJ6 A;  4XPD B;  3BI1 A;  2PJ2 A;  1XIX A;  1UWY A;  2J9A A;  3IO1 A;  3SJF A;  4H6U A;  3FB3 A;  4A30 A;  3K9T A;  4UWJ A; 
#chains in the Genus database with same CATH homology
 3S6G A;  5IX3 A;  4R87 A;  2IL4 A;  2JEV A;  2B4D A;  3P2F A;  4OLL A;  5BWA B;  3EC4 A;  3CXQ A;  4B5P A;  3QAH A;  4FD7 A;  5EBV A;  4XNH B;  1CJW A;  5HH1 A;  2G0B A;  2VQY A;  3GKR A;  1IIC A;  4KSF A;  2J8M A;  2PC1 A;  1WK4 A;  4C7I A;  2VI7 A;  4H6Z A;  1QSO A;  2CXA A;  2Z3M A;  4KVX A;  4C2Z A;  5G20 A;  5F49 A;  1S5K A;  4UWI A;  4YFJ A;  3FNC A;  4NXY A;  1CM0 A;  1N71 A;  2C27 A;  1QSR A;  1M4D A;  1V0C A;  1S7F A;  2DPT A;  1LRZ A;  2Q7B A;  3TO9 A;  1KUX A;  4M3S A;  3SXO A;  4R3K A;  2KCW A;  3R9E A;  2B3U A;  1QSN A;  4XNH C;  4KSA A;  1ON0 A;  3I3G A;  4A32 A;  2DPS A;  2BUE A;  1QSM A;  3VWE A;  4A31 A;  4B10 A;  4I49 A;  3F0A A;  1VKC A;  1Q2D A;  3V8I A;  1VHS A;  1YGH A;  5A28 A;  3E0K A;  3D8P A;  4PK3 A;  4E8O A;  2JDD A;  5G1Z A;  3R95 A;  4CAF A;  5J8F A;  1Z4R A;  5KTC A;  3K9U A;  3TTH A;  4EVY A;  2FT0 A;  3I9S A;  5AG6 A;  5H84 A;  4R57 A;  1S7N A;  1GHE A;  4KVM E;  4AB7 A;  1BOB A;  3RYO A;  4A95 A;  5G21 A;  1OZP A;  2BSW A;  4Q38 A;  2H5M A;  4QVT A;  3CXP A;  3CXS A;  2G3T A;  2CNT A;  3FYN A;  4XPL A;  3S6H A;  4U9Y A;  4Y49 C;  2B3V A;  4B5P B;  4JJX A;  1YVK A;  2Z10 A;  5I0C A;  1TIQ A;  4ONU A;  4B13 A;  4Y49 B;  4MBU A;  3JVN A;  3DR6 A;  2R8V A;  4PSX A;  2GAN A;  3W6X A;  4JLY A;  2R7H A;  1Y9K A;  3IGR A;  3PP9 A;  4LUA A;  4AVC A;  4F0Y A;  4NEX A;  4LX9 A;  3FIX A;  1FY7 A;  2Q04 A;  4HKF A;  5G22 A;  2ZW6 A;  4CGM A;  4FD6 A;  4U5Y A;  3KKW A;  4K30 A;  5C82 A;  3FXT A;  2OZU A;  2Q4Y A;  3UY5 A;  2OU2 A;  4KUB A;  2VBQ A;  3EY5 A;  4YGO A;  2ZXV A;  4C68 A;  4UCN A;  1M44 A;  1UFH A;  3VWD A;  1XEB A;  2P6G A;  3ZJ0 A;  2YGW A;  2OZG A;  2EUI A;  4UCP A;  2ARH A;  3JUW A;  4KZT A;  1S7L A;  2YNC C;  4BMH A;  4NCZ A;  3WR7 A;  4PK2 A;  4PSW A;  3IU1 A;  2FSR A;  1YX0 A;  2OB0 A;  5F47 A;  3LOD A;  4AVA A;  4NF1 A;  5EC4 A;  2FCK A;  5IB0 A;  3D2M A;  3G3S A;  4R3L A;  3ZZI A;  5JPH A;  4QUS A;  2K5T A;  2HUZ A;  4L8A A;  5F46 A;  1KUY A;  4A33 A;  5JQ4 A;  2VXK A;  3A9L A;  2I00 A;  1S60 A;  4NSQ A;  3C26 A;  4AG7 A;  1PU9 A;  2PR8 A;  2YNC A;  4M85 A;  1J4J A;  3R96 A;  1Y7R A;  2VZY A;  3S6K A;  4QC6 A;  4UBR A;  3IWE A;  2WUU A;  2Q4V A;  2ZPA A;  3IU2 A;  3MGD A;  1YR0 A;  1I1D A;  3OWC A;  5A27 A;  4CGL A;  1YRE A;  4UFW A;  4XPK A;  4GS4 A;  2YNE A;  1YLE A;  1YK3 A;  3F8K A;  4MFJ A;  5IV0 A;  4MHD A;  2PSW A;  1ZO0 A;  2FE7 A;  3FBU A;  3W91 A;  4KOY A;  4XPD C;  3D2P A;  2VEZ A;  4KOW A;  2OH1 A;  1KUV A;  3JTK A;  2A4N A;  4C2X A;  4JXR A;  4E0A A;  2QML A;  5ISV A;  5H86 A;  1I12 A;  4CYO A;  2FS5 A;  3S6F A;  3H4Q A;  2JDC A;  4ORF A;  3GY9 A;  5GCN A;  4UFV A;  1Y9W A;  1P4N A;  4L89 A;  4X5K A;  2Q44 A;  3TOA A;  2J8R A;  1MJA A;  4B5O A;  2Z3O A;  3LD2 A;  2FXF A;  5AGE A;  3TT2 A;  5J8C A;  4II9 A;  4AG9 A;  2Q0Y A;  2Z3L A;  2OZH A;  2FIW A;  5AG5 A;  2ZW5 A;  4KLV A;  4KOU A;  1Q2C A;  1Q2Y A;  2R1I A;  3TE4 A;  4UFX A;  4RI1 A;  5E96 A;  2Z11 A;  2CNS A;  1RXT A;  3GYA A;  2D4O A;  4MJ8 A;  2FL4 A;  3TCV A;  4ZBG A;  3T90 A;  2BL1 A;  4JXQ A;  2HV2 A;  2RC4 A;  4CRZ B;  4HNY B;  4AVB A;  2REF A;  1IB1 E;  4KS9 A;  4KOR A;  4JD6 A;  4DNC A;  4KOT A;  4U9Z A;  4A2Z A;  3NE7 A;  3PGP A;  5AG7 A;  4IUS A;  3R9F A;  2Z0Z A;  5DWN A;  1XMT A;  3DNS A;  2CY2 A;  3F5B A;  3G8W A;  3W6S A;  2Z3K A;  2PRB A;  2Z3N A;  4CAE A;  4F6A A;  2AE6 A;  2J8N A;  5KTA A;  5KTD A;  1L0C A;  3H5Z A;  3R1K A;  4OAE A;  4R9M A;  4H89 A;  4CGP A;  1MJB A;  3EO4 A;  1XF8 A;  2ATR A;  4CGO A;  3D3S A;  1B6B A;  1I21 A;  3B8G A;  4KVO E;  4YRH A;  4MFP A;  4MFZ A;  4Q36 A;  3SHP A;  2GE3 A;  4KOS A;  2REE A;  4IF5 A;  1MJ9 A;  2PR1 A;  1BO4 A;  2FIA A;  2P6E A;  2X7B A;  4F0X A;  4MFL A;  4CYQ A;  2ZW7 A;  4CAV A;  2Z3P A;  1IYK A;  3DR8 A;  4HNW B;  3R9G A;  4JWP A;  2B58 A;  2Y0M A;  2P6F A;  4QBJ A;  4ZGY B;  1PUA A;  3DSB A;  3EXN A;  4MI4 A;  3DDD A;  4B14 A;  1IYL A;  4C7H A;  4C2Y A;  4CRY B;  2R98 A;  1B87 A;  2WSA A;  2CNM A;  5AG4 A;  5FVJ A;  2D4P A;  3FRM A;  4FD4 A;  2EVN A;  1R57 A;  4UCM A;  2O28 A;  3TOB A;  1RO5 A;  4KUA A;  1K4J A;  4UA3 A;  4B11 A;  3QB8 A;  4MY3 A;  4BBH A;  2PDO A;  4RS2 A;  2JLM A;  4FD5 A;  4E2A A;  2B4B A;  3IWG A;  3PZJ A;  1P0H A;  3BJ8 A;  3P2H A;  2GIV A;  1M4G A;  4CAX A;  2G3A A;  4MY0 A;  1SQH A;  4PV6 A;  1S7K A;  1M4I A;  4KOX A;  4OAD A;  5C88 A;  3SXN A;  1NSL A;  3TO6 A;  2YND A;  5DWM A;  1S3Z A;  1WWZ A;  4HNX B;  5CNP A;  3EFA A;  4MFK A;  2DXQ A;  3T9Y A;  2WPW A;  1QST A;  2NMT A;  3BLN A;  2B5G A;  4CYN A;  5HMN A;  3N7Z A;  3TO7 A;  4CYP A;  3TFY A;  4J3G A;  1NE9 A;  5F48 A;  1XE4 A;  1NMT A;  2QIR A;  2F5I A;  4KOV A;  1U6M A;  3BJ7 A;  1Z4E A;  1MK4 A;  2P0W A;  1IID A;  1Z9U A;  4MFQ A;  2VZZ A;  2B5G B;  4CAW A;  4CS0 B;  2QEC A;  2B4D B;  2ZW4 A;  1M1D A;  4QB9 A;  4B12 A;  1YVO A;  2HQY A;  4CGN A;  1KZF A;  2WPX A;  4KLW A;  2BEI A;  2I79 A;  2PQ8 A;  2AJ6 A;  4XPD B;  1XIX A;  4H6U A;  3FB3 A;  4A30 A;  4UWJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...