2PRFA

Three dimensional solution structure of acanthamoeba profilin i
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
125
structure length
125
Chain Sequence
SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGQTLASAFNNADPIRASGFDLAGVHYVTLRADDRSIYGKKGSAGVITVKTSKSILVGVYNEKIQPGTAANVVEKLADYLIGQGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional solution structure of Acanthamoeba profilin-I.
pubmed doi rcsb
source organism Acanthamoeba sp.
molecule tags Actin-binding
molecule keywords PROFILIN IA
total genus 11
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1994-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 2prfA00
1SZVA 1J3WA 1CQAA 4X1MA 2JKFA 1FIKA 1Z09A 4ESPA 3LEQA 1K0KA 4FTXA 3T1RA 1CF0A 2ACGA 3CPTA 3T1XA 1D1JA 3L9KA 1PRQA 1VETB 5FDSA 1G5UA 1SKOA 2E8JA 3CPTB 3MSHA 3CHWP 5EVEA 3UB5P 3D9YA 3L7HA 1ACFA 5EV0A 5FEGA 4QWOA 3MS6A 4X25A 5FEFA 3T1SA 1YPRA 2PAVP 1HLUP 2VK3A 5EM1A 1CJFA 1PFLA 2JKGA 1VEUA 2V8CA 4X1LA 1FILA 1PNEA 5EM0A 3KYEA 3NECA 3DAVA 1F2KA 2ZL1B 4FUWA 2HZ5A 2PBDP 2B95A 2BTFP 3U4LP 1VETA 1SKOB 2ZL1A 1AWIA 2PRFA 1Y4OA 3NULA 3LGOA 1VEUB 1A0KA 2V8FA 3T1QB 4D60A 3T12B
chains in the Genus database with same CATH superfamily
1KGEA 2Y2LA 4WZ5A 2Q9NA 1TDLA 1W63Q 1S1ZA 3LO7A 1G68A 1S0WA 2P74A 3FWLA 4HY8A 4I3IA 4JF6A 1IKIA 3KSFA 5CHJA 3IF6B 4DN0A 2BTFP 3OBFA 1FCMA 1DP6A 2IWDA 3KSGA 3F1OB 4X1MA 3HREA 3E4OA 3ZQ5A 3UMDA 2PU4A 4JXGA 1ODVA 1DJAA 2W3GA 3ULFA 3NECA 1TDGA 3WS0A 3NOPC 2BG1A 3HVFA 2HGVA 3HJKA 3NULA 3IHAA 5EOOA 4EEUA 2W27A 1ERQA 3NBLA 2EX8A 1O07A 3JYIA 2OWHA 3LIAA 4LLOB 4BLMA 3DWZA 4WZ4A 4YOFA 5FASA 3ZGAB 3IHBA 5A93A 1TS6A 4QHCA 3OC2A 1BSGA 4QY5A 1Y4OA 4KQRA 3TSGA 4Q0JA 2IWCA 3NHQA 4GD8A 3N8LA 2XFTA 1STZA 4KG5A 1KE3A 1IYPA 2CC1A 4LV1A 4R1GA 1P9WA 2J3TD 5GHYA 5CHUA 3G4PA 3UE3A 3WS4A 4OONA 3JVVA 1FILA 1NJ4A 4GZBA 1ES5A 3MQOA 3DTEA 5CGSA 4ESPA 2ZQCA 4FTXA 4S2OA 1E4DA 1D1JA 2JKRI 4C6YA 4DJ3A 1LL5A 3S7QA 4ETZA 5DKKA 2K2NA 2ZMAA 3AGFA 2R78A 1MWRA 2Y59A 2V1AA 5HD5A 3PBNA 5CX7A 2QMIA 4CLCE 3LI9A 5FI6A 2QYBA 4I39A 2A2LA 4UQIM 3MXRA 3H9WA 5FQQA 4E6XA 2UV0E 3B42A 3Q1FA 2VLGA 2WKIA 3BFDA 3LIEA 2Y4AA 1L0GA 5K5BA 1I2SA 3SZTA 4Q8IA 4EBLA 1NXYA 3U2AA 2D01A 4EESA 2DNSA 2O9CA 3FV7A 5TR7A 1GHIA 3T1QB 2W3EA 3NOTC 4NKPA 3W2ZA 1XJ4A 4WEJA 3I7JA 3C30A 4G3WA 4S2NA 5A91A 5F1FA 3T4OA 4JXWA 4K0XA 4NXFA 5F5YA 4EU0A 1LL8A 1D7EA 3R7WB 3W4PA 3R4KA 3AGEA 1O7EA 4IBXA 3BECA 3SW1A 1K38A 3PYPA 2WAEA 1I2WA 3HL9A 2WYXA 4RX3A 2PAVP 4WZ5C 3UB9A 5CXWA 5HARA 3UDFA 1IYSA 5G4YA 4D2OA 3H7WB 5KZHA 4OQHA 5L8MA 3S7OA 3WRZA 2PHYA 4E3MA 1XJ2A 4BQMA 5HX9A 1HTZA 2QHKA 2XR0A 2JN7A 1SCWA 5TFQA 3SH8A 2I9VA 1TS8A 2V0UA 5C5KA 4KZ4A 4FH4A 3C7UA 4BBTA 2XH9A 3QP5A 3UPOA 3IH8A 1ZHHB 4WF0A 4X56A 5F69A 2LB5A 1XFQA 3IBJA 1QMEA 2X71A 1S1YA 3UE0A 4HJ6A 1XGJA 1OPXA 3ZNYA 4E3LA 5A92A 1NWZA 3VFFA 4WMCD 2FFFB 3IXDA 1F2KA 1L3LA 4DDYA 2O9BA 2A3UA 5DVAA 1KGFA 1H5XA 1ERMA 4Y15A 5DKLA 1J9MA 1RP5A 3UDIA 3LEQA 3NDEA 4MBHA 4P6ZS 1C3BA 5TBMB 2ZQ9A 1E25A 4JKTA 5FEFA 5DFXA 3BQAA 2W3FA 2XLNA 1NY0A 4FUWA 3NY4A 1YQSA 1FCOA 4F94A 1KVMA 3BW6A 4P6BA 1CF0A 4ARZB 3VP1A 3HLGA 2IWBA 4KENB 3CAXA 2XF3A 5TBMA 1OJGA 4H8RA 3RXXA 3O87A 5GLCA 2ZQDA 2WAFA 3H7WA 4E3JA 3D3OA 3W4QA 4I38A 5AVEA 2NUTC 3DTMA 1K6RA 1K54A 1ZG6A 4IHQA 3BFGA 4HESA 1JWVA 2E8JA 3SS5A 4QWOA 3N6IA 5I5LA 4DE0A 2V1BA 5E2FA 2HF6A 3F1PA 1XX2A 4KZBA 2A49A 3LIBA 3EOIA 1NRJA 1AXBA 2EXAA 1P9RA 3KO6A 3CMZA 5EVIB 4XT2B 1K55C 2QPNA 4HH2A 3G31A 5F6AA 5J4EA 3TE8A 1XP4A 4IUKA 1MZUA 1SHVA 5L2FA 3M6HA 5EVIC 3EEHA 3CJMA 1KVLA 1UGUA 4P6ZM 3S7PA 4JF5A 2V0WA 2K7SA 4EWFA 2JKTM 4II7A 4PPRA 3HLFA 1V9YA 3RFBA 2XSSA 4EXOA 4B88A 4GDBA 5U47A 1GSVA 5HFOA 4L9FA 2XA7S 1W63M 4RA7A 4K91A 1BULA 4CLCA 2WZZA 5J7EA 2ZMVA 3EGXC 1CEGA 1XJ3A 3UDXA 2XD5A 5FA7A 3A3JA 3VOLA 2OWJA 2ZM8A 3HUOA 1Y28A 3C38A 4YNRA 1KDSA 4IVKA 1YSPA 1FSWA 3HLWA 3LR3A 1K25A 4OP5A 4MNRA 2DMWA 5IU1A 3RTYA 1VEUB 1LI9A 5DJUA 4WYYA 2JKTI 3T4TA 2M7UA 4KUOA 1YKDA 4G3KA 5LBRA 4RX2A 3MXQA 3LYXA 3N4IA 1K6SA 5FSRA 5EVEA 2Y2GA 4F3LB 5DTKA 2OOLA 4ARZA 3MMHA 2V9AA 1YMXA 1NYYA 2KDKA 1L2SA 2V1ZA 3S4XA 3PXPA 2O0YA 4M4XA 1W5DA 4XT2A 2B5RA 5HZHA 1P97A 3BFFA 1X0OA 1L0EA 1W7FA 1EROA 3MFXA 4EBNA 4RQ9A 3WRTA 2G2WA 2O9AA 3JVUA 2AVXA 4EUZA 4BL3A 4DMZA 1ONGA 1BLPA 2W1TA 2G7UA 5DF8A 5TJJA 2WKHA 1NZOA 4CQHA 2J3WA 4YWZA 1BUEA 5J8XA 1XGIA 1K56D 1ZTUA 2YKHA 3TG9A 4GCZA 3MZDA 1DRMA 5DJTA 2HDSA 5JYOA 1JWPA 3FC7A 2ZC6B 3BRMA 4BENA 5A90A 1U60A 1YLWA 4BJPA 2J80A 2LB9A 4P87A 3O3VA 2A24A 5KSHA 4GN2A 1SKOB 2M7VA 1AWIA 1WYBA 4R4RA 2HP5A 3LUQA 3NOUC 4X69A 2XK1A 4S2NC 3UB8A 1PI5A 2ZOHA 4O7DA 1UWNX 3IF6C 1K54C 3IQAA 3M6BA 4R3AA 3IT9A 5F68A 4B9OA 5HW3A 4Y5FA 4JPMA 1V9ZA 2EWWA 5IHVA 4DJ2A 3FKWA 1KOUA 2HJ9C 4N1HA 5HWVA 4D60A 4EETB 4DE3A 4MN5A 3FPWA 3L9KA 4LRXC 3GR2A 3RJUA 4KG2A 4P0MA 3VMAA 2VK3A 1CJFA 4WEKA 3F1OA 4OLDA 2IA2A 3GVBA 1XA7A 3A0VA 4JXSA 2V20A 5HD3A 1Z09A 5AQ7A 2QKPA 5CGWA 3QHYA 4PM5A 1PI4A 1HD8A 4GB7A 4JGQA 3G6OA 3HLEA 3IX4A 2ZMFA 1T18A 4N9KA 2JE5A 2DCFA 2ZBBA 1GA9A 2HZ5A 3P09A 1KE4A 3GV9A 3SS4A 2Y55A 4WLAA 3HUMA 3ZVWA 4DKIA 4DE2A 1CQAA 3ITBA 1YLZA 5M1AA 3MXSA 5FQJA 1VHMA 4DXCA 3HLDA 1JNUA 1ACFA 1MY8A 2Y2MA 4Q0HA 3UB6A 3IBRA 4LCLA 1F9IA 1ZKJA 1MBLA 3IXBA 2ZQ8A 4ID4A 3VP2A 3BJNA 3G2ZA 3ZG7B 2WK0A 4DE1A 4QJGA 2EX9A 3CWFA 1OTAA 3BFEA 3QP8A 2JKRM 4EERA 4OP8A 3QP1A 1M6KA 4GDNA 3V5MA 2XRNA 1FQGA 1GHMA 3VOYA 2QJ5A 5CTNA 2BLSA 3T50A 3BM6A 1H0MA 2V8FA 1SZVA 4L9GA 3BEBA 5IT5A 4U3TA 4OH0A 1DJBA 1SKOA 4FD8A 4GD6A 1PWDA 2WGIA 3IF6A 3UNWA 4MDZA 5FQMA 3W8KA 2ZL1A 1ALQA 4E04A 4GNUA 5EPHA 2Y8HA 4JGOA 3K3CA 1I5QA 3OOVA 4X55A 4KQQA 1GCEA 3CPTA 3P01A 4OPRA 4BWIA 3ZDJA 2HP6A 1RGYA 1BT5A 3OCNA 1PW8A 1PWGA 2J9PA 3HLBA 1VEUA 2B02A 2ZOIA 2W3HA 2Q9MA 3PAEA 4HP4A 3CITA 3SH9A 5M18A 5EOEA 2EX2A 4PMAA 4U0TA 2JKFA 3JPUA 3C4PA 1S67L 3HBRA 3G34A 5HL1A 4ZBEA 4KZ8A 3PBQA 5GHZA 4I5SA 1N9BA 1PW1A 2C5WB 3MQ0A 3S22A 1DP9A 3A3IA 2EX6A 1S4RA 4NETA 3NIAA 1DY6A 4GW9A 3MZEA 4EQIA 5DF9A 1E3UD 5HDCA 1VQQA 2L0WA 2Y91A 4ZJ3A 4FSFA 1JTDA 1XKZA 2JHEA 1YSQA 2INWA 3QNBA 3UY6A 1W79A 3BY8A 2JC7A 2MJ6A 1KE0A 2KX6A 4Q0IA 4Y0OA 2KLIA 1FR1A 1G6OA 3OPPA 3UPNA 2EFXA 1TS0A 3S1YA 2PYPA 1N9OA 2WKPA 3LEZA 2B18A 2NUPC 2Z2LB 4HEFA 4OQIA 1F5MA 1OT6A 1T1CA 4Y7PA 2Y2NA 5FI2A 4A5RA 3E98A 2Y79A 1NYMA 2A24B 3EQUA 5FEGA 1HVBA 2OSUA 1YPRA 1K4FA 2C6WB 1SDNA 4IEDA 3VP3A 4NEED 3VSKA 2KOIA 3HCYA 5L09A 3LICA 4R70A 4XUXA 3A3FA 5KMWA 4AFIA 4JBFA 4NG2A 3CI6A 4B4XA 3E4PA 4BMWA 4CLCB 3N8SA 1BYWA 1EWZA 2XDMA 3A3EA 3NI9A 1TVFA 1NZUA 1XFNA 2O99A 3V50A 2PBYA 3LY4A 1ONHA 4HI4A 5F83A 3IX3A 4Y0UA 1BLHA 3T12B 2ZD8A 3N7WA 3ZFZA 3T1XA 5CGXA 1VETB 5FDSA 2WKEA 1RGZA 3D9YA 1SDEA 5DTSA 3A0SA 4WELA 1GA0A 1P0ZA 2OLVA 2VZWA 3LY3A 4K0WA 1XXMA 1JVJA 4B93A 1A0KA 1PZPA 3EQVA 5HAIA 4EBPA 1UWPX 3MF0A 4RYEA 3CUEA 4MBFA 2VA0A 4QU3A 3MSHA 3ITAA 3L7HA 1L0DA 4QD4A 2ZM0A 1OTEA 1IYOA 3LCEA 4DDSA 2VKSA 5GHXA 2Y2QA 1LSXA 2HDRA 4PM7A 4CLCD 1MPLA 1RCJA 3MBZA 4YFMA 1EI5A 3OPLA 1GHPA 2RL3A 1TD5A 1CI8A 2HJEA 3ZYTA 3G32A 4HQAA 5EVIA 2XFSA 3QP4A 4Z1WA 4X6TA 1K57C 2ZLYA 1IELA 3FZCA 4MLLA 3E4QA 1H3QA 1IFQA 5KSCA 4S2JA 4GS9A 5CHMA 2GDNA 1PFLA 1IKGA 1XA1A 1CK3A 2E8IA 5D3OA 3EEAA 5EFWA 2J8YA 3WS1A 3KX0X 4LRZE 1J3WA 1YLJA 1PIOA 2GZAA 3C5AA 2ZC7A 5E2HA 4MCWA 2H0YA 1FCNA 3CLOA 4KG6A 1MKMA 1NLYA 2WKRA 4LGWA 5FATA 4O0PA 5FQ9A 2Y2HA 2H10A 4X68A 1H8ZA 3OPHA 3T4SA 3E0YA 4LV0A 4OVDA 2XGNA 3HJIA 3LR0A 3IXGA 3FYZA 4GHIA 3VE4A 4YINA 4R3BA 4DF6A 4RVAA 3K2NA 5HWWA 2X01A 5EVID 3WS5A 3GMWA 2X02A 2Z2MB 1OT9A 3PR6A 3ZNTA 2W3DA 4R0QA 4DRTA 3PTEA 1JTGA 4ME4A 4S2PA 2H5SA 5FDHA 1Z6FA 1L0FA 3F1PB 3C4OA 5CERA 4EV4A 3VP4A 3UMEA 3DAVA 4OQGA 1XJ6A 4OLGA 4JGRA 1YM1A 3BY9A 4XUZA 4E3NA 4UEYA 3LR5A 1K0KA 3T1RA 1MKIA 4ZDXA 3UN7A 2PT7A 2OV5A 4LCMA 4PHTA 2VGKA 3T1SA 3IH9A 3MJQA 1HLUP 3ZVTA 1JWZA 2P9VA 2WUQA 2ZC5B 1K57A 4PM6A 2WADA 1OMEA 2XQZA 2V2FF 1K4EA 3GTCA 3MQQA 4CPKA 4NK3A 2XROA 3IS2A 3V67A 4I3AA 1WE4A 5EV0A 4BBUA 4DXBA 3DTKA 4S2MA 1YLPA 3A3DA 3MZFA 3P7NA 1MWTA 3HUNA 4LRYC 3QP2A 3K3DA 4EW7A 3IWQA 5IS1A 3NC8A 5EM1A 3ZCZA 1ZC2A 5CECA 1VB6A 4L0LA 4WMCA 3H82B 3S7NA 4Z9QA 2HV1A 4CLCC 1LSWA 1GSXA 1MXOA 1NLZA 3M2JA 3GDIA 3IX8A 2WZXA 2HP9A 3MR0A 1CEFA 1VM1A 3LGOA 3SOIA 1MWSA 4OQ0A 3M2KA 3IWIA 3MFDA 1LSVA 3Q81A 3B47A 3F1NB 1IYQA 5F82A 3OPRA 2P9VB 3O86A 2PR6A 4ZAMA 3OLOA 3SS3A 2PBDP 3A0RA 4HNBA 1KGGA 1MC0A 3H82A 3PBOA 3QNCA 3O5YA 3TRCA 4BD1A 2EXBA 3FKVA 1LT0A 1G28A 1LL9A 3BQ8A 3IS2B 5E2EA 3TJZC 4HP9A 4L9EA 5GLDA 3Q7VB 2VGLM 2Z6CA 3PAGA 4HJ3A 2VGLS 4R4SA 4UAAA 1S4SA 1YLYA 4BD0A 2J9OA 3QP6A 2W1RA 5AQ9A 4R23A 5AQBA 2H0TA 1TEMA 4OOMA 5HPFA 1YAXA 1OTBA 2WGWA 4HJ4A 2JCHA 1DP8A 5HWTA 3WS2A 3DBAA 1YMSA 4P85A 1W8QA 4Y3IA 3V3SA 1NRFA 4MN7A 2HDQA 4KZ3A 4EQ1A 3ZG0A 2VEAA 4ZRRA 5L07A 3UO9A 2Y2OA 5A8BA 5FL3A 1IEMA 5DF7A 3CG5A 3RH8B 2P08A 2PDRA 2WGWB 2QZ6A 4N9LA 3VSLA 4IJGA 1ESUA 5HAQA 3VP0A 3GQZA 3CUEC 3B33A 2G2UA 4CJNA 3R7WA 3V39A 3C2WA 4R38A 3UB7A 4C75A 3D72A 4F3LA 2W0NA 5G4ZA 4PAUA 4X1LA 5FAQA 1FSYA 4FCFA 3FG8A 4NXGA 2M1CA 2VV6A 2YKFA 3N8RA 2ZQ7A 1KDWA 4R6LA 2P04A 2EA9A 2PR5A 3KSIA 5FQIA 1LHYA 4U0XA 4HBUA 1MWUA 1PWCA 2J3TC 2Y2IA 5CEBA 3ZHHA 4KUKA 1N9LA 3Q7ZA 2RCXA 5GL9A 3ZG9B 2WGVA 3GSGA 3SH7A 4GJ4A 4WN5A 3RXWA 3HLCA 4HIAA 4UA7A 4N1XA 2VJWA 3G30A 1ESIA 5E2GA 4KZ5A 4WUJA 2QJ7A 5MC7A 1QMFA 5EECA 3T4QA 5F1GA 2K31A 3V3RA 4PM9A 3PBTA 3BFCA 3W4OA 4FH2A 4QB8A 3KSHA 4X53A 4MBKA 3BYDA 3UE6A 2XEPA 3KYZA 1G5UA 3GECA 5HL6A 3CHWP 3AGDA 3UB5P 4LV2A 5CEDA 4X25A 1YT4A 3PBSA 4UA6A 4BBVA 3KYQA 5EM0A 4Y13A 2VX8A 3EWKA 5CTMA 5AQAA 3UE1A 3FPVA 3VFHA 2ZC4B 4GOGA 4MN6A 3MKEA 3DTIA 5FQKA 3Q82A 3ZG5A 1BLCA 5I94A 2L1MA 4OPZA 4B4ZA 4WBGA 4Y0TA 3E2KA 4UQIS 4OPYA 4GKUA 4N92A 3ICYA 4E3IA 4JLFA 4E6WA 1ES2A 4ETXA 3BWLA 2ZL1B 4KZAA 2XD1A 4UHUA 4GS9B 4PKYG 4HHDA 2FFYA 4HOIA 1XPBA 2Y2JA 1FIKA 2VV7A 1OTDA 4JF4A 4IBRA 1Q2QA 1S6RA 3MS6A 5BOHA 1M40A 2ZM2A 2PU2A 3C8CA 4I3JA 3GRJA 2B95A 3B3XA 3DWKA 4EEPA 2HDUA 4KQDA 1BLSA 5HAPA 3IXHA 4C3QA 3D4FA 4ZJ2A 5AJGA 3NDGA 5DTTA 4S2KA 2GNXA 3TOIA 4MEZA 5J3WA 3Q07A 3ZG8B 4KZ7A 3VE3A 1VETA 2W1TB 2PRFA 1H8YA 2I72A 4PKYA 2CMNA 1K56A 1TF1A 3LR4A 5FAPA 3CZDA 4O01A 4Y17A 5E43A 2R9WA 4G3VA 2JBFA 3LIDA 4LFUA 4M3KA 4H6JB 1WA9A 1N4OA 2WKQA 4BL2A 2Q0OA 5DFYA 3T4JA 4KZ9A 4Y2FA 5FAOA 3T4KA 5L10A 5JYPA 2ZQAA 4S2IA 2FH5A 5M19A 2L4RA 1Y54A 2ACGA 4E3OA 3NCKA 3G2YA 1T1AA 3TW8A 1G6AA 1N9NA 2J7VA 2FZ0A 2JKGA 3DW0A 4H6JA 4O8GA 5CRFA 3E2LA 4K08A 1ES4A 3EGDC 5FI7A 4EUVA 1TS7A 1FR6A 1DJCA 1GSWA 5EVLA 1ZG4A 2OAQ1 2DRWA 3VV4A 2HPBA 5G18A 3P98A 4FOFA 2P7JA 4GLQA 2V8CA 4JGPA 4LENA 3LIFA 3G35A 1H8MA 4QPRA 4GHIB 2UWXA 4PM8A 1HZOA 4WM9A 3OZHA 1OTIA 3OCLA 5EE8A 1K55A 1CI9A 2ZC3B 5KIZA 5GLBA 4IVIA 4ZJ1A 2EFUA 3BLSA 3T4LA 4S2LA 3LFVA 2OLUA 3UPPA 3IWOA 2GX5A 1PZOA 2Y2KA 4JXVA 2OAP1 4XXRA 4KQOA 1ES3A 2Y2PA 4MMNA 2XA7M 4HH3A 1Q2PA 2ZJ9A 1BTLA 1E3UA 5HSQA 4QY6A 5EUAA 3NJAA 3IF5A 1W8YA 3PBRA 2PD7A 4E3KA 1PNEA 5TGFA 5GLAA 3KYEA 3PHYA 4LV3A 4IUHA 2EWVA 2QWSA 1LLBA 1D06A 1EW0A 2Z6DA 4NXBA 2VV8A 4R3JA 2VGJA 5HDSA 3Q7VA 2PD8A 1FOFA 4WL9A 2GJ3A 2BASA 1WYCA 1IOUA 3VOZA 1PRQA 4OOYA 5HPIA 1T19A 1PYYA 2H28A 2R9XA 1S66L 4OPQA 4UA9A 1T1BA 1F98A 4KZ6A 3F1NA 3ISGA 3BLMA 3LI8A 2D02A 3O88A 1YLTA 4LPZA 5AVFA 1SKFA 3C7VA 4HBTA 3WWXA 3CPTB 1BZAA 2PYRA 3MKFA 5HDDA 4NXEA 1LI0A 3U4LP 4ZTKA 1OJ5A 4OOLA 4OKPA
chains in the Genus database with same CATH topology
1SZVA 1J3WA 1CQAA 4X1MA 2JKFA 1FIKA 1Z09A 4ESPA 3LEQA 1K0KA 4FTXA 3T1RA 1CF0A 2ACGA 3CPTA 3T1XA 1D1JA 3L9KA 1PRQA 1VETB 5FDSA 1G5UA 1SKOA 2E8JA 3CPTB 3MSHA 3CHWP 5EVEA 3UB5P 3D9YA 3L7HA 1ACFA 5EV0A 5FEGA 4QWOA 3MS6A 4X25A 5FEFA 3T1SA 1YPRA 2PAVP 1HLUP 2VK3A 5EM1A 1CJFA 1PFLA 2JKGA 1VEUA 2V8CA 4X1LA 1FILA 1PNEA 5EM0A 3KYEA 3NECA 3DAVA 1F2KA 2ZL1B 4FUWA 2HZ5A 2PBDP 2B95A 2BTFP 3U4LP 1VETA 1SKOB 2ZL1A 1AWIA 2PRFA 1Y4OA 3NULA 3LGOA 1VEUB 1A0KA 2V8FA 3T1QB 4D60A 3T12B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SZV A;  1J3W A;  1CQA A;  4X1M A;  2JKF A;  1FIK A;  1Z09 A;  4ESP A;  3LEQ A;  1K0K A;  4FTX A;  3T1R A;  1CF0 A;  2ACG A;  3CPT A;  3T1X A;  1D1J A;  3L9K A;  1PRQ A;  1VET B;  5FDS A;  1G5U A;  1SKO A;  2E8J A;  3CPT B;  3MSH A;  3CHW P;  5EVE A;  3UB5 P;  3D9Y A;  3L7H A;  1ACF A;  5EV0 A;  5FEG A;  4QWO A;  3MS6 A;  4X25 A;  5FEF A;  3T1S A;  1YPR A;  2PAV P;  1HLU P;  2VK3 A;  5EM1 A;  1CJF A;  1PFL A;  2JKG A;  1VEU A;  2V8C A;  4X1L A;  1FIL A;  1PNE A;  5EM0 A;  3KYE A;  3NEC A;  3DAV A;  1F2K A;  2ZL1 B;  4FUW A;  2HZ5 A;  2PBD P;  2B95 A;  2BTF P;  3U4L P;  1VET A;  1SKO B;  2ZL1 A;  1AWI A;  2PRF A;  1Y4O A;  3NUL A;  3LGO A;  1VEU B;  1A0K A;  2V8F A;  3T1Q B;  4D60 A;  3T12 B; 
#chains in the Genus database with same CATH topology
 1KGE A;  2Y2L A;  4WZ5 A;  2Q9N A;  1TDL A;  1W63 Q;  1S1Z A;  3LO7 A;  1G68 A;  1S0W A;  2P74 A;  3FWL A;  4HY8 A;  4I3I A;  4JF6 A;  1IKI A;  3KSF A;  5CHJ A;  3IF6 B;  4DN0 A;  2BTF P;  3OBF A;  1FCM A;  1DP6 A;  2IWD A;  3KSG A;  3F1O B;  4X1M A;  3HRE A;  3E4O A;  3ZQ5 A;  3UMD A;  2PU4 A;  4JXG A;  1ODV A;  1DJA A;  2W3G A;  3ULF A;  3NEC A;  1TDG A;  3WS0 A;  3NOP C;  2BG1 A;  3HVF A;  2HGV A;  3HJK A;  3NUL A;  3IHA A;  5EOO A;  4EEU A;  2W27 A;  1ERQ A;  3NBL A;  2EX8 A;  1O07 A;  3JYI A;  2OWH A;  3LIA A;  4LLO B;  4BLM A;  3DWZ A;  4WZ4 A;  4YOF A;  5FAS A;  3ZGA B;  3IHB A;  5A93 A;  1TS6 A;  4QHC A;  3OC2 A;  1BSG A;  4QY5 A;  1Y4O A;  4KQR A;  3TSG A;  4Q0J A;  2IWC A;  3NHQ A;  4GD8 A;  3N8L A;  2XFT A;  1STZ A;  4KG5 A;  1KE3 A;  1IYP A;  2CC1 A;  4LV1 A;  4R1G A;  1P9W A;  2J3T D;  5GHY A;  5CHU A;  3G4P A;  3UE3 A;  3WS4 A;  4OON A;  3JVV A;  1FIL A;  1NJ4 A;  4GZB A;  1ES5 A;  3MQO A;  3DTE A;  5CGS A;  4ESP A;  2ZQC A;  4FTX A;  4S2O A;  1E4D A;  1D1J A;  2JKR I;  4C6Y A;  4DJ3 A;  1LL5 A;  3S7Q A;  4ETZ A;  5DKK A;  2K2N A;  2ZMA A;  3AGF A;  2R78 A;  1MWR A;  2Y59 A;  2V1A A;  5HD5 A;  3PBN A;  5CX7 A;  2QMI A;  4CLC E;  3LI9 A;  5FI6 A;  2QYB A;  4I39 A;  2A2L A;  4UQI M;  3MXR A;  3H9W A;  5FQQ A;  4E6X A;  2UV0 E;  3B42 A;  3Q1F A;  2VLG A;  2WKI A;  3BFD A;  3LIE A;  2Y4A A;  1L0G A;  5K5B A;  1I2S A;  3SZT A;  4Q8I A;  4EBL A;  1NXY A;  3U2A A;  2D01 A;  4EES A;  2DNS A;  2O9C A;  3FV7 A;  5TR7 A;  1GHI A;  3T1Q B;  2W3E A;  3NOT C;  4NKP A;  3W2Z A;  1XJ4 A;  4WEJ A;  3I7J A;  3C30 A;  4G3W A;  4S2N A;  5A91 A;  5F1F A;  3T4O A;  4JXW A;  4K0X A;  4NXF A;  5F5Y A;  4EU0 A;  1LL8 A;  1D7E A;  3R7W B;  3W4P A;  3R4K A;  3AGE A;  1O7E A;  4IBX A;  3BEC A;  3SW1 A;  1K38 A;  3PYP A;  2WAE A;  1I2W A;  3HL9 A;  2WYX A;  4RX3 A;  2PAV P;  4WZ5 C;  3UB9 A;  5CXW A;  5HAR A;  3UDF A;  1IYS A;  5G4Y A;  4D2O A;  3H7W B;  5KZH A;  4OQH A;  5L8M A;  3S7O A;  3WRZ A;  2PHY A;  4E3M A;  1XJ2 A;  4BQM A;  5HX9 A;  1HTZ A;  2QHK A;  2XR0 A;  2JN7 A;  1SCW A;  5TFQ A;  3SH8 A;  2I9V A;  1TS8 A;  2V0U A;  5C5K A;  4KZ4 A;  4FH4 A;  3C7U A;  4BBT A;  2XH9 A;  3QP5 A;  3UPO A;  3IH8 A;  1ZHH B;  4WF0 A;  4X56 A;  5F69 A;  2LB5 A;  1XFQ A;  3IBJ A;  1QME A;  2X71 A;  1S1Y A;  3UE0 A;  4HJ6 A;  1XGJ A;  1OPX A;  3ZNY A;  4E3L A;  5A92 A;  1NWZ A;  3VFF A;  4WMC D;  2FFF B;  3IXD A;  1F2K A;  1L3L A;  4DDY A;  2O9B A;  2A3U A;  5DVA A;  1KGF A;  1H5X A;  1ERM A;  4Y15 A;  5DKL A;  1J9M A;  1RP5 A;  3UDI A;  3LEQ A;  3NDE A;  4MBH A;  4P6Z S;  1C3B A;  5TBM B;  2ZQ9 A;  1E25 A;  4JKT A;  5FEF A;  5DFX A;  3BQA A;  2W3F A;  2XLN A;  1NY0 A;  4FUW A;  3NY4 A;  1YQS A;  1FCO A;  4F94 A;  1KVM A;  3BW6 A;  4P6B A;  1CF0 A;  4ARZ B;  3VP1 A;  3HLG A;  2IWB A;  4KEN B;  3CAX A;  2XF3 A;  5TBM A;  1OJG A;  4H8R A;  3RXX A;  3O87 A;  5GLC A;  2ZQD A;  2WAF A;  3H7W A;  4E3J A;  3D3O A;  3W4Q A;  4I38 A;  5AVE A;  2NUT C;  3DTM A;  1K6R A;  1K54 A;  1ZG6 A;  4IHQ A;  3BFG A;  4HES A;  1JWV A;  2E8J A;  3SS5 A;  4QWO A;  3N6I A;  5I5L A;  4DE0 A;  2V1B A;  5E2F A;  2HF6 A;  3F1P A;  1XX2 A;  4KZB A;  2A49 A;  3LIB A;  3EOI A;  1NRJ A;  1AXB A;  2EXA A;  1P9R A;  3KO6 A;  3CMZ A;  5EVI B;  4XT2 B;  1K55 C;  2QPN A;  4HH2 A;  3G31 A;  5F6A A;  5J4E A;  3TE8 A;  1XP4 A;  4IUK A;  1MZU A;  1SHV A;  5L2F A;  3M6H A;  5EVI C;  3EEH A;  3CJM A;  1KVL A;  1UGU A;  4P6Z M;  3S7P A;  4JF5 A;  2V0W A;  2K7S A;  4EWF A;  2JKT M;  4II7 A;  4PPR A;  3HLF A;  1V9Y A;  3RFB A;  2XSS A;  4EXO A;  4B88 A;  4GDB A;  5U47 A;  1GSV A;  5HFO A;  4L9F A;  2XA7 S;  1W63 M;  4RA7 A;  4K91 A;  1BUL A;  4CLC A;  2WZZ A;  5J7E A;  2ZMV A;  3EGX C;  1CEG A;  1XJ3 A;  3UDX A;  2XD5 A;  5FA7 A;  3A3J A;  3VOL A;  2OWJ A;  2ZM8 A;  3HUO A;  1Y28 A;  3C38 A;  4YNR A;  1KDS A;  4IVK A;  1YSP A;  1FSW A;  3HLW A;  3LR3 A;  1K25 A;  4OP5 A;  4MNR A;  2DMW A;  5IU1 A;  3RTY A;  1VEU B;  1LI9 A;  5DJU A;  4WYY A;  2JKT I;  3T4T A;  2M7U A;  4KUO A;  1YKD A;  4G3K A;  5LBR A;  4RX2 A;  3MXQ A;  3LYX A;  3N4I A;  1K6S A;  5FSR A;  5EVE A;  2Y2G A;  4F3L B;  5DTK A;  2OOL A;  4ARZ A;  3MMH A;  2V9A A;  1YMX A;  1NYY A;  2KDK A;  1L2S A;  2V1Z A;  3S4X A;  3PXP A;  2O0Y A;  4M4X A;  1W5D A;  4XT2 A;  2B5R A;  5HZH A;  1P97 A;  3BFF A;  1X0O A;  1L0E A;  1W7F A;  1ERO A;  3MFX A;  4EBN A;  4RQ9 A;  3WRT A;  2G2W A;  2O9A A;  3JVU A;  2AVX A;  4EUZ A;  4BL3 A;  4DMZ A;  1ONG A;  1BLP A;  2W1T A;  2G7U A;  5DF8 A;  5TJJ A;  2WKH A;  1NZO A;  4CQH A;  2J3W A;  4YWZ A;  1BUE A;  5J8X A;  1XGI A;  1K56 D;  1ZTU A;  2YKH A;  3TG9 A;  4GCZ A;  3MZD A;  1DRM A;  5DJT A;  2HDS A;  5JYO A;  1JWP A;  3FC7 A;  2ZC6 B;  3BRM A;  4BEN A;  5A90 A;  1U60 A;  1YLW A;  4BJP A;  2J80 A;  2LB9 A;  4P87 A;  3O3V A;  2A24 A;  5KSH A;  4GN2 A;  1SKO B;  2M7V A;  1AWI A;  1WYB A;  4R4R A;  2HP5 A;  3LUQ A;  3NOU C;  4X69 A;  2XK1 A;  4S2N C;  3UB8 A;  1PI5 A;  2ZOH A;  4O7D A;  1UWN X;  3IF6 C;  1K54 C;  3IQA A;  3M6B A;  4R3A A;  3IT9 A;  5F68 A;  4B9O A;  5HW3 A;  4Y5F A;  4JPM A;  1V9Z A;  2EWW A;  5IHV A;  4DJ2 A;  3FKW A;  1KOU A;  2HJ9 C;  4N1H A;  5HWV A;  4D60 A;  4EET B;  4DE3 A;  4MN5 A;  3FPW A;  3L9K A;  4LRX C;  3GR2 A;  3RJU A;  4KG2 A;  4P0M A;  3VMA A;  2VK3 A;  1CJF A;  4WEK A;  3F1O A;  4OLD A;  2IA2 A;  3GVB A;  1XA7 A;  3A0V A;  4JXS A;  2V20 A;  5HD3 A;  1Z09 A;  5AQ7 A;  2QKP A;  5CGW A;  3QHY A;  4PM5 A;  1PI4 A;  1HD8 A;  4GB7 A;  4JGQ A;  3G6O A;  3HLE A;  3IX4 A;  2ZMF A;  1T18 A;  4N9K A;  2JE5 A;  2DCF A;  2ZBB A;  1GA9 A;  2HZ5 A;  3P09 A;  1KE4 A;  3GV9 A;  3SS4 A;  2Y55 A;  4WLA A;  3HUM A;  3ZVW A;  4DKI A;  4DE2 A;  1CQA A;  3ITB A;  1YLZ A;  5M1A A;  3MXS A;  5FQJ A;  1VHM A;  4DXC A;  3HLD A;  1JNU A;  1ACF A;  1MY8 A;  2Y2M A;  4Q0H A;  3UB6 A;  3IBR A;  4LCL A;  1F9I A;  1ZKJ A;  1MBL A;  3IXB A;  2ZQ8 A;  4ID4 A;  3VP2 A;  3BJN A;  3G2Z A;  3ZG7 B;  2WK0 A;  4DE1 A;  4QJG A;  2EX9 A;  3CWF A;  1OTA A;  3BFE A;  3QP8 A;  2JKR M;  4EER A;  4OP8 A;  3QP1 A;  1M6K A;  4GDN A;  3V5M A;  2XRN A;  1FQG A;  1GHM A;  3VOY A;  2QJ5 A;  5CTN A;  2BLS A;  3T50 A;  3BM6 A;  1H0M A;  2V8F A;  1SZV A;  4L9G A;  3BEB A;  5IT5 A;  4U3T A;  4OH0 A;  1DJB A;  1SKO A;  4FD8 A;  4GD6 A;  1PWD A;  2WGI A;  3IF6 A;  3UNW A;  4MDZ A;  5FQM A;  3W8K A;  2ZL1 A;  1ALQ A;  4E04 A;  4GNU A;  5EPH A;  2Y8H A;  4JGO A;  3K3C A;  1I5Q A;  3OOV A;  4X55 A;  4KQQ A;  1GCE A;  3CPT A;  3P01 A;  4OPR A;  4BWI A;  3ZDJ A;  2HP6 A;  1RGY A;  1BT5 A;  3OCN A;  1PW8 A;  1PWG A;  2J9P A;  3HLB A;  1VEU A;  2B02 A;  2ZOI A;  2W3H A;  2Q9M A;  3PAE A;  4HP4 A;  3CIT A;  3SH9 A;  5M18 A;  5EOE A;  2EX2 A;  4PMA A;  4U0T A;  2JKF A;  3JPU A;  3C4P A;  1S67 L;  3HBR A;  3G34 A;  5HL1 A;  4ZBE A;  4KZ8 A;  3PBQ A;  5GHZ A;  4I5S A;  1N9B A;  1PW1 A;  2C5W B;  3MQ0 A;  3S22 A;  1DP9 A;  3A3I A;  2EX6 A;  1S4R A;  4NET A;  3NIA A;  1DY6 A;  4GW9 A;  3MZE A;  4EQI A;  5DF9 A;  1E3U D;  5HDC A;  1VQQ A;  2L0W A;  2Y91 A;  4ZJ3 A;  4FSF A;  1JTD A;  1XKZ A;  2JHE A;  1YSQ A;  2INW A;  3QNB A;  3UY6 A;  1W79 A;  3BY8 A;  2JC7 A;  2MJ6 A;  1KE0 A;  2KX6 A;  4Q0I A;  4Y0O A;  2KLI A;  1FR1 A;  1G6O A;  3OPP A;  3UPN A;  2EFX A;  1TS0 A;  3S1Y A;  2PYP A;  1N9O A;  2WKP A;  3LEZ A;  2B18 A;  2NUP C;  2Z2L B;  4HEF A;  4OQI A;  1F5M A;  1OT6 A;  1T1C A;  4Y7P A;  2Y2N A;  5FI2 A;  4A5R A;  3E98 A;  2Y79 A;  1NYM A;  2A24 B;  3EQU A;  5FEG A;  1HVB A;  2OSU A;  1YPR A;  1K4F A;  2C6W B;  1SDN A;  4IED A;  3VP3 A;  4NEE D;  3VSK A;  2KOI A;  3HCY A;  5L09 A;  3LIC A;  4R70 A;  4XUX A;  3A3F A;  5KMW A;  4AFI A;  4JBF A;  4NG2 A;  3CI6 A;  4B4X A;  3E4P A;  4BMW A;  4CLC B;  3N8S A;  1BYW A;  1EWZ A;  2XDM A;  3A3E A;  3NI9 A;  1TVF A;  1NZU A;  1XFN A;  2O99 A;  3V50 A;  2PBY A;  3LY4 A;  1ONH A;  4HI4 A;  5F83 A;  3IX3 A;  4Y0U A;  1BLH A;  3T12 B;  2ZD8 A;  3N7W A;  3ZFZ A;  3T1X A;  5CGX A;  1VET B;  5FDS A;  2WKE A;  1RGZ A;  3D9Y A;  1SDE A;  5DTS A;  3A0S A;  4WEL A;  1GA0 A;  1P0Z A;  2OLV A;  2VZW A;  3LY3 A;  4K0W A;  1XXM A;  1JVJ A;  4B93 A;  1A0K A;  1PZP A;  3EQV A;  5HAI A;  4EBP A;  1UWP X;  3MF0 A;  4RYE A;  3CUE A;  4MBF A;  2VA0 A;  4QU3 A;  3MSH A;  3ITA A;  3L7H A;  1L0D A;  4QD4 A;  2ZM0 A;  1OTE A;  1IYO A;  3LCE A;  4DDS A;  2VKS A;  5GHX A;  2Y2Q A;  1LSX A;  2HDR A;  4PM7 A;  4CLC D;  1MPL A;  1RCJ A;  3MBZ A;  4YFM A;  1EI5 A;  3OPL A;  1GHP A;  2RL3 A;  1TD5 A;  1CI8 A;  2HJE A;  3ZYT A;  3G32 A;  4HQA A;  5EVI A;  2XFS A;  3QP4 A;  4Z1W A;  4X6T A;  1K57 C;  2ZLY A;  1IEL A;  3FZC A;  4MLL A;  3E4Q A;  1H3Q A;  1IFQ A;  5KSC A;  4S2J A;  4GS9 A;  5CHM A;  2GDN A;  1PFL A;  1IKG A;  1XA1 A;  1CK3 A;  2E8I A;  5D3O A;  3EEA A;  5EFW A;  2J8Y A;  3WS1 A;  3KX0 X;  4LRZ E;  1J3W A;  1YLJ A;  1PIO A;  2GZA A;  3C5A A;  2ZC7 A;  5E2H A;  4MCW A;  2H0Y A;  1FCN A;  3CLO A;  4KG6 A;  1MKM A;  1NLY A;  2WKR A;  4LGW A;  5FAT A;  4O0P A;  5FQ9 A;  2Y2H A;  2H10 A;  4X68 A;  1H8Z A;  3OPH A;  3T4S A;  3E0Y A;  4LV0 A;  4OVD A;  2XGN A;  3HJI A;  3LR0 A;  3IXG A;  3FYZ A;  4GHI A;  3VE4 A;  4YIN A;  4R3B A;  4DF6 A;  4RVA A;  3K2N A;  5HWW A;  2X01 A;  5EVI D;  3WS5 A;  3GMW A;  2X02 A;  2Z2M B;  1OT9 A;  3PR6 A;  3ZNT A;  2W3D A;  4R0Q A;  4DRT A;  3PTE A;  1JTG A;  4ME4 A;  4S2P A;  2H5S A;  5FDH A;  1Z6F A;  1L0F A;  3F1P B;  3C4O A;  5CER A;  4EV4 A;  3VP4 A;  3UME A;  3DAV A;  4OQG A;  1XJ6 A;  4OLG A;  4JGR A;  1YM1 A;  3BY9 A;  4XUZ A;  4E3N A;  4UEY A;  3LR5 A;  1K0K A;  3T1R A;  1MKI A;  4ZDX A;  3UN7 A;  2PT7 A;  2OV5 A;  4LCM A;  4PHT A;  2VGK A;  3T1S A;  3IH9 A;  3MJQ A;  1HLU P;  3ZVT A;  1JWZ A;  2P9V A;  2WUQ A;  2ZC5 B;  1K57 A;  4PM6 A;  2WAD A;  1OME A;  2XQZ A;  2V2F F;  1K4E A;  3GTC A;  3MQQ A;  4CPK A;  4NK3 A;  2XRO A;  3IS2 A;  3V67 A;  4I3A A;  1WE4 A;  5EV0 A;  4BBU A;  4DXB A;  3DTK A;  4S2M A;  1YLP A;  3A3D A;  3MZF A;  3P7N A;  1MWT A;  3HUN A;  4LRY C;  3QP2 A;  3K3D A;  4EW7 A;  3IWQ A;  5IS1 A;  3NC8 A;  5EM1 A;  3ZCZ A;  1ZC2 A;  5CEC A;  1VB6 A;  4L0L A;  4WMC A;  3H82 B;  3S7N A;  4Z9Q A;  2HV1 A;  4CLC C;  1LSW A;  1GSX A;  1MXO A;  1NLZ A;  3M2J A;  3GDI A;  3IX8 A;  2WZX A;  2HP9 A;  3MR0 A;  1CEF A;  1VM1 A;  3LGO A;  3SOI A;  1MWS A;  4OQ0 A;  3M2K A;  3IWI A;  3MFD A;  1LSV A;  3Q81 A;  3B47 A;  3F1N B;  1IYQ A;  5F82 A;  3OPR A;  2P9V B;  3O86 A;  2PR6 A;  4ZAM A;  3OLO A;  3SS3 A;  2PBD P;  3A0R A;  4HNB A;  1KGG A;  1MC0 A;  3H82 A;  3PBO A;  3QNC A;  3O5Y A;  3TRC A;  4BD1 A;  2EXB A;  3FKV A;  1LT0 A;  1G28 A;  1LL9 A;  3BQ8 A;  3IS2 B;  5E2E A;  3TJZ C;  4HP9 A;  4L9E A;  5GLD A;  3Q7V B;  2VGL M;  2Z6C A;  3PAG A;  4HJ3 A;  2VGL S;  4R4S A;  4UAA A;  1S4S A;  1YLY A;  4BD0 A;  2J9O A;  3QP6 A;  2W1R A;  5AQ9 A;  4R23 A;  5AQB A;  2H0T A;  1TEM A;  4OOM A;  5HPF A;  1YAX A;  1OTB A;  2WGW A;  4HJ4 A;  2JCH A;  1DP8 A;  5HWT A;  3WS2 A;  3DBA A;  1YMS A;  4P85 A;  1W8Q A;  4Y3I A;  3V3S A;  1NRF A;  4MN7 A;  2HDQ A;  4KZ3 A;  4EQ1 A;  3ZG0 A;  2VEA A;  4ZRR A;  5L07 A;  3UO9 A;  2Y2O A;  5A8B A;  5FL3 A;  1IEM A;  5DF7 A;  3CG5 A;  3RH8 B;  2P08 A;  2PDR A;  2WGW B;  2QZ6 A;  4N9L A;  3VSL A;  4IJG A;  1ESU A;  5HAQ A;  3VP0 A;  3GQZ A;  3CUE C;  3B33 A;  2G2U A;  4CJN A;  3R7W A;  3V39 A;  3C2W A;  4R38 A;  3UB7 A;  4C75 A;  3D72 A;  4F3L A;  2W0N A;  5G4Z A;  4PAU A;  4X1L A;  5FAQ A;  1FSY A;  4FCF A;  3FG8 A;  4NXG A;  2M1C A;  2VV6 A;  2YKF A;  3N8R A;  2ZQ7 A;  1KDW A;  4R6L A;  2P04 A;  2EA9 A;  2PR5 A;  3KSI A;  5FQI A;  1LHY A;  4U0X A;  4HBU A;  1MWU A;  1PWC A;  2J3T C;  2Y2I A;  5CEB A;  3ZHH A;  4KUK A;  1N9L A;  3Q7Z A;  2RCX A;  5GL9 A;  3ZG9 B;  2WGV A;  3GSG A;  3SH7 A;  4GJ4 A;  4WN5 A;  3RXW A;  3HLC A;  4HIA A;  4UA7 A;  4N1X A;  2VJW A;  3G30 A;  1ESI A;  5E2G A;  4KZ5 A;  4WUJ A;  2QJ7 A;  5MC7 A;  1QMF A;  5EEC A;  3T4Q A;  5F1G A;  2K31 A;  3V3R A;  4PM9 A;  3PBT A;  3BFC A;  3W4O A;  4FH2 A;  4QB8 A;  3KSH A;  4X53 A;  4MBK A;  3BYD A;  3UE6 A;  2XEP A;  3KYZ A;  1G5U A;  3GEC A;  5HL6 A;  3CHW P;  3AGD A;  3UB5 P;  4LV2 A;  5CED A;  4X25 A;  1YT4 A;  3PBS A;  4UA6 A;  4BBV A;  3KYQ A;  5EM0 A;  4Y13 A;  2VX8 A;  3EWK A;  5CTM A;  5AQA A;  3UE1 A;  3FPV A;  3VFH A;  2ZC4 B;  4GOG A;  4MN6 A;  3MKE A;  3DTI A;  5FQK A;  3Q82 A;  3ZG5 A;  1BLC A;  5I94 A;  2L1M A;  4OPZ A;  4B4Z A;  4WBG A;  4Y0T A;  3E2K A;  4UQI S;  4OPY A;  4GKU A;  4N92 A;  3ICY A;  4E3I A;  4JLF A;  4E6W A;  1ES2 A;  4ETX A;  3BWL A;  2ZL1 B;  4KZA A;  2XD1 A;  4UHU A;  4GS9 B;  4PKY G;  4HHD A;  2FFY A;  4HOI A;  1XPB A;  2Y2J A;  1FIK A;  2VV7 A;  1OTD A;  4JF4 A;  4IBR A;  1Q2Q A;  1S6R A;  3MS6 A;  5BOH A;  1M40 A;  2ZM2 A;  2PU2 A;  3C8C A;  4I3J A;  3GRJ A;  2B95 A;  3B3X A;  3DWK A;  4EEP A;  2HDU A;  4KQD A;  1BLS A;  5HAP A;  3IXH A;  4C3Q A;  3D4F A;  4ZJ2 A;  5AJG A;  3NDG A;  5DTT A;  4S2K A;  2GNX A;  3TOI A;  4MEZ A;  5J3W A;  3Q07 A;  3ZG8 B;  4KZ7 A;  3VE3 A;  1VET A;  2W1T B;  2PRF A;  1H8Y A;  2I72 A;  4PKY A;  2CMN A;  1K56 A;  1TF1 A;  3LR4 A;  5FAP A;  3CZD A;  4O01 A;  4Y17 A;  5E43 A;  2R9W A;  4G3V A;  2JBF A;  3LID A;  4LFU A;  4M3K A;  4H6J B;  1WA9 A;  1N4O A;  2WKQ A;  4BL2 A;  2Q0O A;  5DFY A;  3T4J A;  4KZ9 A;  4Y2F A;  5FAO A;  3T4K A;  5L10 A;  5JYP A;  2ZQA A;  4S2I A;  2FH5 A;  5M19 A;  2L4R A;  1Y54 A;  2ACG A;  4E3O A;  3NCK A;  3G2Y A;  1T1A A;  3TW8 A;  1G6A A;  1N9N A;  2J7V A;  2FZ0 A;  2JKG A;  3DW0 A;  4H6J A;  4O8G A;  5CRF A;  3E2L A;  4K08 A;  1ES4 A;  3EGD C;  5FI7 A;  4EUV A;  1TS7 A;  1FR6 A;  1DJC A;  1GSW A;  5EVL A;  1ZG4 A;  2OAQ 1;  2DRW A;  3VV4 A;  2HPB A;  5G18 A;  3P98 A;  4FOF A;  2P7J A;  4GLQ A;  2V8C A;  4JGP A;  4LEN A;  3LIF A;  3G35 A;  1H8M A;  4QPR A;  4GHI B;  2UWX A;  4PM8 A;  1HZO A;  4WM9 A;  3OZH A;  1OTI A;  3OCL A;  5EE8 A;  1K55 A;  1CI9 A;  2ZC3 B;  5KIZ A;  5GLB A;  4IVI A;  4ZJ1 A;  2EFU A;  3BLS A;  3T4L A;  4S2L A;  3LFV A;  2OLU A;  3UPP A;  3IWO A;  2GX5 A;  1PZO A;  2Y2K A;  4JXV A;  2OAP 1;  4XXR A;  4KQO A;  1ES3 A;  2Y2P A;  4MMN A;  2XA7 M;  4HH3 A;  1Q2P A;  2ZJ9 A;  1BTL A;  1E3U A;  5HSQ A;  4QY6 A;  5EUA A;  3NJA A;  3IF5 A;  1W8Y A;  3PBR A;  2PD7 A;  4E3K A;  1PNE A;  5TGF A;  5GLA A;  3KYE A;  3PHY A;  4LV3 A;  4IUH A;  2EWV A;  2QWS A;  1LLB A;  1D06 A;  1EW0 A;  2Z6D A;  4NXB A;  2VV8 A;  4R3J A;  2VGJ A;  5HDS A;  3Q7V A;  2PD8 A;  1FOF A;  4WL9 A;  2GJ3 A;  2BAS A;  1WYC A;  1IOU A;  3VOZ A;  1PRQ A;  4OOY A;  5HPI A;  1T19 A;  1PYY A;  2H28 A;  2R9X A;  1S66 L;  4OPQ A;  4UA9 A;  1T1B A;  1F98 A;  4KZ6 A;  3F1N A;  3ISG A;  3BLM A;  3LI8 A;  2D02 A;  3O88 A;  1YLT A;  4LPZ A;  5AVF A;  1SKF A;  3C7V A;  4HBT A;  3WWX A;  3CPT B;  1BZA A;  2PYR A;  3MKF A;  5HDD A;  4NXE A;  1LI0 A;  3U4L P;  4ZTK A;  1OJ5 A;  4OOL A;  4OKP A; 
#chains in the Genus database with same CATH homology
 1SZV A;  1J3W A;  1CQA A;  4X1M A;  2JKF A;  1FIK A;  1Z09 A;  4ESP A;  3LEQ A;  1K0K A;  4FTX A;  3T1R A;  1CF0 A;  2ACG A;  3CPT A;  3T1X A;  1D1J A;  3L9K A;  1PRQ A;  1VET B;  5FDS A;  1G5U A;  1SKO A;  2E8J A;  3CPT B;  3MSH A;  3CHW P;  5EVE A;  3UB5 P;  3D9Y A;  3L7H A;  1ACF A;  5EV0 A;  5FEG A;  4QWO A;  3MS6 A;  4X25 A;  5FEF A;  3T1S A;  1YPR A;  2PAV P;  1HLU P;  2VK3 A;  5EM1 A;  1CJF A;  1PFL A;  2JKG A;  1VEU A;  2V8C A;  4X1L A;  1FIL A;  1PNE A;  5EM0 A;  3KYE A;  3NEC A;  3DAV A;  1F2K A;  2ZL1 B;  4FUW A;  2HZ5 A;  2PBD P;  2B95 A;  2BTF P;  3U4L P;  1VET A;  1SKO B;  2ZL1 A;  1AWI A;  2PRF A;  1Y4O A;  3NUL A;  3LGO A;  1VEU B;  1A0K A;  2V8F A;  3T1Q B;  4D60 A;  3T12 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...