2PRFA

Three dimensional solution structure of acanthamoeba profilin i
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
125
structure length
125
Chain Sequence
b'SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGQTLASAFNNADPIRASGFDLAGVHYVTLRADDRSIYGKKGSAGVITVKTSKSILVGVYNEKIQPGTAANVVEKLADYLIGQGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROFILIN IA
publication title Three-dimensional solution structure of Acanthamoeba profilin-I.
pubmed doi rcsb
source organism Acanthamoeba sp.
molecule tags Actin-binding
total genus 11
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1994-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 2prfA00
2PRFA 1D1JA 3CPTA 1A0KA 3T1XA 1CJFA 1K0KA 2ACGA 1VETA 3UB5P 5FEFA 1J3WA 1HLUP 4ESPA 4X1MA 1VETB 1VEUA 3T12B 1SKOB 2PBDP 3NECA 5EVEA 5FDSA 1FILA 3L9KA 3LEQA 3CHWP 2VK3A 1VEUB 1YPRA 3DAVA 5EM0A 4D60A 5FEGA 2B95A 4X25A 1SKOA 1CQAA 3MSHA 3L7HA 1AWIA 1PNEA 4X1LA 1PFLA 1Y4OA 5EM1A 1FIKA 1CF0A 1ACFA 2E8JA 3MS6A 3D9YA 3NULA 2V8FA 2JKGA 2JKFA 5EV0A 3KYEA 2ZL1B 4FUWA 1F2KA 3T1RA 1Z09A 2HZ5A 4QWOA 3T1QB 1SZVA 4FTXA 2PAVP 2ZL1A 3U4LP 2BTFP 1PRQA 1G5UA 3CPTB 2V8CA 3LGOA 3T1SA
chains in the Genus database with same CATH superfamily
2V9AA 4IUHA 4C6YA 4UQIS 2WYXA 5FQQA 4UA6A 1CJFA 2YKHA 4LRXC 1KDSA 4RQ9A 1K0KA 2HDUA 2W1TB 2H5SA 2H0YA 3UPNA 1JNUA 3QP6A 4EWFA 5CTNA 1O7EA 1WA9A 4BBUA 3KYZA 4WEKA 5TR7A 3AGEA 4LV3A 4KZ8A 5FSRA 1XA7A 3B3XA 1MWSA 1XKZA 4WMCD 1T1CA 4DRTA 5KSCA 5A92A 2XK1A 2HJ9C 1UGUA 2WK0A 2Z2MB 4GKUA 1K38A 4KZ4A 1QMEA 3BFEA 1PNEA 3GSGA 4FSFA 1YM1A 2GX5A 3UDXA 5GLDA 3UMDA 1MWRA 1MWUA 3QP1A 2JKTI 4Q0HA 1KE0A 4WMCA 1ACFA 5J7EA 3ZVTA 3IF6C 3Q7ZA 2VV7A 4YOFA 1LL8A 3BY8A 1P9RA 3MXQA 2Y59A 1ESIA 3W8KA 1HTZA 3NCKA 3SH7A 5DF9A 1Z09A 3EQUA 1ES4A 1H8YA 2R9WA 2WZZA 3MXRA 4GHIB 1ONGA 4L9FA 1NWZA 3C4PA 2O9BA 2Y2QA 3G30A 3PHYA 3BJNA 2OV5A 4B4ZA 2M7UA 1ERMA 4S2IA 1CI9A 5F68A 4WF0A 4PM9A 1PZPA 4EESA 4E3JA 4I3JA 4H6JA 1F98A 2ZM8A 4WYYA 5HWVA 1K6SA 5CEDA 3G32A 4B9OA 3GVBA 3NHQA 4Q0JA 4JGOA 4OKPA 2Q9MA 3MQOA 3V3SA 1H0MA 2Y2HA 3T4QA 4Y13A 1IYSA 4E3KA 3GTCA 5CEBA 5CGSA 3W4OA 1XFQA 2H10A 3KSGA 3V5MA 5HARA 4BL3A 1I5QA 4K0XA 1NLZA 4Z1WA 3ZG8B 3HUOA 1NZUA 5F6AA 2R9XA 2EXBA 4KUKA 1S4RA 1PI4A 3DWZA 3BY9A 3VV4A 1EW0A 3ZG7B 3NY4A 3UB8A 5E2HA 2WUQA 2KX6A 4NETA 2XQZA 3LYXA 3LIFA 2EFUA 1Y4OA 3ZG0A 1LL9A 1S66L 1CEFA 4CLCD 3ZGAB 5FQ9A 1N9OA 4QY6A 3MKFA 5CTMA 1MWTA 1YLTA 3UE0A 5J8XA 4FD8A 2L4RA 3UNWA 4IBXA 5I5LA 2ZL1A 2M7VA 3IHAA 3OPLA 4H6JB 2IWCA 2W0NA 5FQMA 5HWTA 4CLCA 4ETZA 1OPXA 2V8CA 1K57A 4HEFA 4GOGA 4JKTA 3R7WA 2XROA 3CMZA 4GNUA 1WYCA 3E98A 3A3EA 2WAEA 3RH8B 2K31A 1G28A 3G34A 5M19A 1S6RA 2VEAA 4XT2A 4KZ6A 1K55A 4KZ3A 2V2FF 3BLSA 1NYYA 2C6WB 4DE3A 2X71A 3MBZA 4I38A 4GS9B 3ZHHA 1JTDA 3B42A 5DJTA 1ES2A 3LCEA 3JVUA 3P01A 2ZQAA 2NUTC 4UEYA 4KZ9A 2XFSA 4PPRA 2VGKA 3KSIA 2MJ6A 3EGDC 4DJ2A 4D60A 5L2FA 5FDHA 1E3UA 3IH8A 1HD8A 2ZBBA 1T1BA 3E4QA 5GLAA 5FAQA 4OPQA 4X1LA 4CQHA 5GL9A 2VGLS 2Y91A 4X69A 1KGGA 1FIKA 3UDFA 1GA0A 3SW1A 5GHYA 3VOZA 2ZL1B 3VP1A 3Q7VA 5IHVA 2NUPC 4CLCB 1F2KA 2ZM0A 4JPMA 3R7WB 3IXHA 2JN7A 4JGQA 1H5XA 4KQRA 3B47A 1MKMA 4JF4A 4LFUA 1RGZA 4IEDA 3O88A 2P9VA 4XT2B 1T19A 2XDMA 5E43A 1XX2A 3CPTA 4N9KA 3IF6B 5EVLA 3F1PA 3OCLA 5EPHA 2BLSA 5K5BA 1Q2PA 1RCJA 2ZC5B 1W63Q 3SS4A 4DKIA 3IF5A 4GLQA 1H8ZA 3VE3A 1HZOA 4HHDA 3HREA 3S1YA 1OTEA 1KE3A 3LI8A 1GCEA 4P87A 1NZOA 4OVDA 4S2NC 4RX3A 1XJ4A 3EEHA 3VP0A 1V9YA 4GW9A 3HJIA 1QMFA 2VGLM 3W2ZA 2G2WA 4JF6A 3VSLA 3LIBA 3DAVA 5FI6A 1XJ2A 2GJ3A 1XFNA 1PWCA 5AQ7A 4GDBA 2OSUA 2WKHA 3C2WA 3WS5A 3LICA 3Q7VB 3UB6A 3MQQA 2E8JA 3BFFA 2V8FA 4FH4A 3GDIA 4PKYG 5FI2A 3BW6A 3MKEA 3D72A 4HY8A 2P9VB 2G7UA 5EE8A 4MCWA 3CPTB 3LR5A 1DRMA 2OOLA 3LR4A 4HH2A 3NC8A 5HL1A 5CHMA 4HIAA 3RTYA 1TD5A 1TS7A 2WGWA 4MN7A 2ZMFA 4E3LA 3ZNYA 3Q1FA 3ZNTA 3NOPC 4UAAA 4ETXA 4Y3IA 2ZD8A 2HJEA 4U0XA 3OOVA 3PBQA 3LUQA 4ZBEA 5CECA 2HP9A 4QY5A 1YT4A 5FEFA 2ZC3B 3E2LA 5GLCA 1PW8A 4HESA 4Y5FA 1KGEA 4KG2A 2XH9A 4MBHA 1DP9A 3F1OB 4X53A 2XA7S 3FG8A 3L9KA 4B93A 3BRMA 4RVAA 4UA9A 3WS2A 4N1XA 1MBLA 3LO7A 5AJGA 1YSQA 5AQ9A 1OJ5A 3CAXA 2Y2IA 5FAPA 3F1NA 3WS0A 2ZMVA 4NKPA 1PFLA 1LT0A 2P74A 2QPNA 3O3VA 4ZJ3A 2KDKA 2A2LA 4JGPA 2EWVA 3VMAA 5CHUA 5CGWA 2OWHA 2WGWB 3IQAA 5AQAA 3IWIA 4HJ3A 5GLBA 3MFXA 3CLOA 1M40A 5DF8A 4OONA 1F5MA 2HDQA 2W27A 3QP8A 4NXGA 5E2GA 3WS1A 3OPPA 5KSHA 1ODVA 1BTLA 2EXAA 3CITA 3T1SA 1ES5A 1MC0A 2FZ0A 2Y2KA 1A0KA 4MNRA 4B4XA 4I5SA 4CJNA 2HP6A 4O8GA 4ARZA 2IWDA 2RL3A 2XA7M 3KX0X 5L8MA 2ACGA 4Y15A 4Q8IA 5E2EA 1H3QA 4F94A 5J3WA 4MEZA 2P7JA 3E0YA 1GSWA 2JKRM 4KQDA 4X55A 4A5RA 3FV7A 5LBRA 1LSVA 3T12B 2V1AA 3M6HA 4BD0A 1EI5A 1OJGA 4GZBA 3H7WA 4EQIA 3M6BA 1G6AA 1TDGA 2Y2MA 4UA7A 3F1NB 1VEUB 3VFHA 5L10A 1BSGA 2V0UA 2WZXA 2O9AA 1PZOA 5G4YA 1PYYA 3CUEC 5FASA 5F82A 1YLYA 3CI6A 3DW0A 1BULA 1EROA 4CLCC 5EM1A 4DXCA 1T1AA 2EX2A 1K57C 1UWNX 3G6OA 2GDNA 1PI5A 1JWZA 5GHXA 4E6XA 2K7SA 3RXWA 3PBTA 1P0ZA 3T1RA 4BL2A 2GZAA 5HW3A 5F5YA 3UB7A 3G31A 1JWPA 4BBVA 1K55C 3C7VA 4HQAA 4XXRA 4PM6A 3D4FA 2BASA 2JC7A 3G2YA 2QYBA 3WRTA 2XFTA 1ERQA 4NK3A 1ZTUA 2V1BA 1MPLA 5DFXA 2W3GA 4DDSA 3ZVWA 4UHUA 5C5KA 2KOIA 3G35A 3T1XA 2Y8HA 4UQIM 3FKVA 2ZM2A 1FOFA 3OPHA 4YWZA 1VETA 4GD8A 1IYOA 1RGYA 4DE0A 3I7JA 3E2KA 1HLUP 3P98A 4ESPA 1PIOA 1G68A 3IWOA 3VP3A 3A3JA 4OQ0A 3UY6A 1LL5A 2JE5A 3HLGA 1C3BA 3IX8A 4PM7A 3PXPA 1W79A 2HP5A 3TJZC 2D02A 5L07A 3IXDA 4Y0OA 3S7NA 1W7FA 4S2JA 1RP5A 1CF0A 1G6OA 5EVID 2WGIA 3BM6A 4GN2A 4LV1A 5EECA 4PKYA 4R4SA 2Y2OA 1W5DA 2OAP1 4HJ4A 3AGFA 2ZOHA 1S1ZA 4E3MA 2Z2LB 4X68A 4X6TA 3LEZA 3UPOA 2HZ5A 1PWDA 1YSPA 3PYPA 2OLVA 2OAQ1 5EVIA 2XSSA 1L3LA 5DFYA 2P08A 3GQZA 3V50A 5FA7A 2B18A 3A0VA 2VV6A 5HAQA 5DJUA 4DF6A 1K25A 1W63M 2X02A 3MJQA 1IELA 3S7OA 5JYOA 1N9BA 3E4OA 4DDYA 4P6BA 1CK3A 4OH0A 3T4OA 2ZMAA 3ZG9B 3Q81A 4EQ1A 1T18A 1BUEA 4WZ5A 1O07A 1LLBA 2QJ5A 4RA7A 1XJ3A 3RXXA 2R78A 5G18A 2VZWA 4EEUA 4OP8A 1LI9A 2Z6DA 4EW7A 2PBDP 3T4TA 5FDSA 2O0YA 2W1RA 1GSXA 2EA9A 3EOIA 4FOFA 2FFFB 3C8CA 1OT6A 4HNBA 2PT7A 2HF6A 2B95A 2HPBA 2WADA 5FI7A 3ZQ5A 4PM8A 3R4KA 2XRNA 1YQSA 3EWKA 2WKRA 3O87A 4O7DA 3N8SA 1E3UD 1N4OA 1OMEA 3G4PA 4N92A 4KZAA 4R3AA 5TJJA 4ME4A 2EX6A 3OZHA 4OOLA 2PD8A 4NXEA 5EVIB 5A91A 4Y2FA 4E6WA 4G3WA 4M3KA 3TOIA 2ZC4B 4GB7A 2LB5A 3SS5A 4P6ZS 2PD7A 5KIZA 1SHVA 3VP4A 1ONHA 2A24A 5J4EA 3H9WA 4YFMA 1Z6FA 2QWSA 2BTFP 1PRQA 1H8MA 2XF3A 1GSVA 4OLDA 4OQIA 1IKIA 2ZQDA 4L9GA 1YAXA 1K56D 1MY8A 1XGJA 3HLEA 3SZTA 2Y4AA 1LSXA 1SDEA 3WS4A 3M2KA 1NJ4A 3VOLA 4EBPA 2HGVA 4LLOB 3UE6A 1DJAA 4Y17A 1NLYA 2VV8A 4R23A 4S2MA 3UE3A 1K56A 3PBRA 1KGFA 1YLZA 4GD6A 3K3DA 3TSGA 3ITBA 5CHJA 1K54A 3VOYA 4LGWA 5CERA 3DTKA 4R1GA 1IKGA 2WKQA 3T50A 1OTBA 1IOUA 4FCFA 1L0EA 5EM0A 2O9CA 2XR0A 4ZJ1A 2ZLYA 1E4DA 4KZBA 2V0WA 5DKKA 2J8YA 1TF1A 1GHIA 1VQQA 4HBUA 2J9OA 4K91A 1P9WA 2ZC6B 4KG5A 4CLCE 3BLMA 5FQKA 5A8BA 3MXSA 4WZ4A 5BOHA 1TVFA 4L9EA 3MS6A 4IHQA 1MXOA 5EV0A 2A24B 5HFOA 2H28A 3RFBA 4WM9A 3V67A 2DNSA 4JGRA 1J9MA 2Y2LA 4XUXA 2PYPA 3JPUA 1ZG4A 2H0TA 3UMEA 5F69A 1Y54A 5HDCA 1L0GA 3FYZA 3FKWA 2JCHA 1CEGA 2ZQ7A 5DVAA 3GMWA 1EWZA 4H8RA 3HBRA 1JVJA 4LV0A 1SKFA 3AGDA 4WL9A 3IH9A 3NOUC 4NG2A 2X01A 5IU1A 3N4IA 5TBMA 3K2NA 2AVXA 4GDNA 1XGIA 2J80A 2QKPA 1YKDA 2PU2A 3F1PB 4E3OA 4BBTA 3BFDA 3MZDA 1FCNA 2JKTM 4MN6A 4WEJA 3IS2A 3NECA 5EVEA 2PR5A 3OPRA 2J7VA 3HUMA 3Q07A 5AQBA 3IHBA 3W4QA 5HDDA 5G4ZA 3MSHA 2XD1A 3HLCA 3NDEA 4QHCA 2DCFA 4P85A 1IFQA 1FSWA 4E3IA 2DRWA 3HCYA 3LIDA 3GRJA 3P7NA 3NDGA 3VSKA 1ESUA 3NULA 4PAUA 4R0QA 4OPYA 1S1YA 1KOUA 3UE1A 3HLDA 3LR0A 3KSHA 5HAIA 3H82A 1NXYA 1OTAA 5CX7A 2V20A 2J3TD 5HD5A 4OOMA 3OCNA 1D06A 4QB8A 4WLAA 4HI4A 1SZVA 1PWGA 1PW1A 4PM5A 4S2LA 1G5UA 3TE8A 4KG6A 2QMIA 3BQAA 2OWJA 4WN5A 5F1FA 3MFDA 4DMZA 1XP4A 2W1TA 1KVMA 3O86A 3O5YA 2VGJA 5TGFA 1S4SA 2KLIA 4ZAMA 3UB5P 3ULFA 1U60A 4G3VA 4OQHA 4O01A 1SDNA 1VHMA 4DJ3A 1TEMA 4Y0UA 1XJ6A 4X1MA 2A49A 5EOOA 1LI0A 1JTGA 1ZG6A 3MR0A 2ZQ8A 1NYMA 1L0DA 4KQOA 2A3UA 5DTKA 5FEGA 1ZKJA 4JF5A 1YLWA 3L7HA 1AWIA 5F1GA 5EVIC 3UB9A 2JKGA 3MF0A 4QJGA 5HSQA 1YLJA 3HVFA 2IA2A 4GHIA 4BLMA 1I2WA 2B5RA 1W8QA 2E8IA 4XUZA 2FH5A 1LSWA 4QWOA 1TS6A 3U4LP 4EETB 4WZ5C 1NRFA 4S2OA 2CMNA 4EEPA 3BFGA 1FCOA 2LB9A 5IS1A 1F9IA 1STZA 3LY4A 4EU0A 2JBFA 1ALQA 1N9LA 3IBJA 1KVLA 5HPFA 4EV4A 5FAOA 4JXVA 4KENB 2HV1A 2YKFA 1BYWA 2PBYA 4FH2A 3S22A 5A90A 4Y7PA 2JHEA 1Q2QA 2P04A 3UN7A 3WRZA 4NEED 1K4EA 3KO6A 2IWBA 5AVEA 4R38A 3NI9A 3MMHA 1ES3A 1GHPA 4ARZB 3KYQA 4BD1A 3B33A 3V39A 3WWXA 5U47A 1DJCA 5EFWA 1N9NA 1IYQA 4II7A 4S2KA 1L2SA 2L0WA 4L0LA 2UWXA 2ZJ9A 3H7WB 4EXOA 3UDIA 1SCWA 5EOEA 3RJUA 2CC1A 3PBOA 2ZOIA 4JXGA 4RYEA 4R3BA 2DMWA 3MZEA 1BLPA 3GR2A 3FC7A 4JXSA 4LPZA 3HJKA 2Q9NA 5FL3A 5KMWA 4WBGA 4LCMA 3A0RA 3PTEA 5E2FA 4BQMA 3LR3A 3IXBA 3PBNA 3MZFA 1LHYA 5EUAA 2WGVA 3N8LA 4GCZA 4MBFA 3PR6A 5M18A 4IVIA 5A93A 3BECA 3FPWA 4BMWA 1K54C 2OLUA 1MZUA 2EX8A 5DF7A 2Y2JA 1OTDA 1BLSA 2ZC7A 3T4JA 5M1AA 3DTEA 3LFVA 4HH3A 2VA0A 3C38A 3BQ8A 3GECA 3KSFA 2D01A 4R6LA 4GS9A 3ZCZA 3ICYA 4I3AA 4GJ4A 1OT9A 3BYDA 2PR6A 4N1HA 1VETB 3D3OA 4DE2A 4OP5A 1L0FA 3A0SA 5CRFA 3TG9A 3C7UA 3P09A 2Q0OA 1SKOA 3HL9A 3JVVA 4YNRA 3MQ0A 4B88A 3QNBA 4CPKA 3BFCA 4EUZA 3ISGA 3CUEA 2M1CA 3N6IA 1FQGA 3OLOA 5CGXA 2JKRI 3HLFA 1KDWA 3CG5A 4R4RA 2PHYA 2JKFA 4WUJA 5KZHA 1BLHA 2Y55A 3BEBA 1X0OA 4OQGA 4I3IA 2EWWA 3EEAA 2WKIA 3LI9A 1VM1A 4M4XA 1VB6A 3HLBA 3QP2A 3M2JA 2J3WA 3ITAA 1W8YA 3T1QB 2I72A 2BG1A 1WE4A 4G3KA 5L09A 1DY6A 2XGNA 3IF6A 1K4FA 2W3FA 4IBRA 4LRZE 5DTSA 4ID4A 2PYRA 4HP4A 4C75A 2PRFA 1D1JA 3FZCA 3K3CA 3NBLA 2HDSA 3ZG5A 1WYBA 3JYIA 1IEMA 3HUNA 4KQQA 4IJGA 5FATA 2EFXA 3QP4A 1ZC2A 3N8RA 4MMNA 3DTIA 1K6RA 3ZYTA 4ZDXA 2Y2NA 3VE4A 1HVBA 2PU4A 4JBFA 4OLGA 4EBLA 1J3WA 4KZ5A 2Z6CA 2INWA 3T4LA 4DXBA 2W3HA 1CI8A 2FFYA 1SKOB 4E3NA 3A3IA 3TRCA 1FILA 2W3DA 3CWFA 2WKPA 2Y2PA 4RX2A 3DTMA 2XLNA 5HAPA 1TDLA 1Y28A 2VK3A 3NIAA 1IYPA 4X25A 4U0TA 3GV9A 3C5AA 4HOIA 2GNXA 4PMAA 1XA1A 1FSYA 4ZRRA 3SH8A 3ZDJA 4JLFA 5IT5A 4P0MA 3PBSA 3SS3A 4DN0A 2XEPA 4S2PA 3IX3A 5D3OA 3S7PA 2J3TC 1YMXA 5HL6A 4X56A 3VFFA 4OPRA 4KUOA 1NY0A 3TW8A 3LY3A 1NRJA 1MKIA 5HD3A 4P6ZM 2ZQCA 4F3LA 2WAFA 4HBTA 3A3FA 1XPBA 4DE1A 4K08A 3LIAA 3A3DA 5HDSA 3UO9A 1M6KA 1GHMA 2XD5A 3QHYA 2UV0E 4IVKA 3T4SA 2K2NA 5FQJA 4EBNA 1YMSA 2W3EA 1S0WA 4R70A 4U3TA 4JXWA 3HLWA 3NOTC 4BWIA 1KE4A 4EUVA 5FQIA 3F1OA 3SH9A 3EQVA 3E4PA 2VKSA 3N7WA 2HDRA 4QD4A 2L1MA 3LIEA 2J9PA 3LEQA 1UWPX 1TS8A 4PHTA 3IX4A 1YPRA 2Y2GA 4OOYA 1FCMA 4OPZA 2VJWA 1BZAA 3EGXC 4E04A 3S7QA 2ZQ9A 5I94A 1YLPA 1CQAA 3QNCA 1OTIA 3OC2A 2QZ6A 1DP8A 4Z9QA 1D7EA 3C30A 1V9ZA 2C5WB 4YINA 4LV2A 5DTTA 2QHKA 3NJAA 4MLLA 4BENA 4R3JA 3W4PA 4D2OA 3IWQA 4F3LB 4FUWA 5AVFA 5HZHA 5HWWA 3IXGA 5JYPA 3IT9A 3BWLA 1E25A 4NXFA 4AFIA 4C3QA 5F83A 2Y79A 4ZJ2A 4QPRA 2V1ZA 3LGOA 1GA9A 2B02A 5HPIA 3VP2A 3Q82A 5GHZA 3DBAA 3UPPA 5MC7A 4LRYC 4IUKA 4BJPA 4MN5A 1XXMA 2WKEA 3PAEA 2VLGA 4LCLA 4MBKA 4NXBA 3T4KA 2O99A 5TBMB 3ZFZA 1FR1A 3G2ZA 5DKLA 4O0PA 1VEUA 1AXBA 2PDRA 4MDZA 2I9VA 4HP9A 3SOIA 3DWKA 3CHWP 3IS2B 3CZDA 5TFQA 1S67L 1FR6A 4WELA 2RCXA 2EX9A 3C4OA 3S4XA 4ZTKA 5HX9A 1BLCA 4S2NA 4LENA 4QU3A 4N9LA 3D9YA 1DJBA 1I2SA 3KYEA 1DP6A 3V3RA 4I39A 5CXWA 3OBFA 4K0WA 4Y0TA 2G2UA 1ZHHB 3FPVA 3CJMA 1TS0A 2VX8A 3FWLA 1P97A 4HJ6A 3PAGA 4KZ7A 2QJ7A 3H82B 4FTXA 2PAVP 4EERA 3QP5A 3U2AA 3IBRA 4Q0IA 1BT5A 1JWVA
chains in the Genus database with same CATH topology
2PRFA 1D1JA 3CPTA 1A0KA 3T1XA 1CJFA 1K0KA 2ACGA 1VETA 3UB5P 5FEFA 1J3WA 1HLUP 4ESPA 4X1MA 1VETB 1VEUA 3T12B 1SKOB 2PBDP 3NECA 5EVEA 5FDSA 1FILA 3L9KA 3LEQA 3CHWP 2VK3A 1VEUB 1YPRA 3DAVA 5EM0A 4D60A 5FEGA 2B95A 4X25A 1SKOA 1CQAA 3MSHA 3L7HA 1AWIA 1PNEA 4X1LA 1PFLA 1Y4OA 5EM1A 1FIKA 1CF0A 1ACFA 2E8JA 3MS6A 3D9YA 3NULA 2V8FA 2JKGA 2JKFA 5EV0A 3KYEA 2ZL1B 4FUWA 1F2KA 3T1RA 1Z09A 2HZ5A 4QWOA 3T1QB 1SZVA 4FTXA 2PAVP 2ZL1A 3U4LP 2BTFP 1PRQA 1G5UA 3CPTB 2V8CA 3LGOA 3T1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PRF A;  1D1J A;  3CPT A;  1A0K A;  3T1X A;  1CJF A;  1K0K A;  2ACG A;  1VET A;  3UB5 P;  5FEF A;  1J3W A;  1HLU P;  4ESP A;  4X1M A;  1VET B;  1VEU A;  3T12 B;  1SKO B;  2PBD P;  3NEC A;  5EVE A;  5FDS A;  1FIL A;  3L9K A;  3LEQ A;  3CHW P;  2VK3 A;  1VEU B;  1YPR A;  3DAV A;  5EM0 A;  4D60 A;  5FEG A;  2B95 A;  4X25 A;  1SKO A;  1CQA A;  3MSH A;  3L7H A;  1AWI A;  1PNE A;  4X1L A;  1PFL A;  1Y4O A;  5EM1 A;  1FIK A;  1CF0 A;  1ACF A;  2E8J A;  3MS6 A;  3D9Y A;  3NUL A;  2V8F A;  2JKG A;  2JKF A;  5EV0 A;  3KYE A;  2ZL1 B;  4FUW A;  1F2K A;  3T1R A;  1Z09 A;  2HZ5 A;  4QWO A;  3T1Q B;  1SZV A;  4FTX A;  2PAV P;  2ZL1 A;  3U4L P;  2BTF P;  1PRQ A;  1G5U A;  3CPT B;  2V8C A;  3LGO A;  3T1S A; 
#chains in the Genus database with same CATH topology
 2V9A A;  4IUH A;  4C6Y A;  4UQI S;  2WYX A;  5FQQ A;  4UA6 A;  1CJF A;  2YKH A;  4LRX C;  1KDS A;  4RQ9 A;  1K0K A;  2HDU A;  2W1T B;  2H5S A;  2H0Y A;  3UPN A;  1JNU A;  3QP6 A;  4EWF A;  5CTN A;  1O7E A;  1WA9 A;  4BBU A;  3KYZ A;  4WEK A;  5TR7 A;  3AGE A;  4LV3 A;  4KZ8 A;  5FSR A;  1XA7 A;  3B3X A;  1MWS A;  1XKZ A;  4WMC D;  1T1C A;  4DRT A;  5KSC A;  5A92 A;  2XK1 A;  2HJ9 C;  1UGU A;  2WK0 A;  2Z2M B;  4GKU A;  1K38 A;  4KZ4 A;  1QME A;  3BFE A;  1PNE A;  3GSG A;  4FSF A;  1YM1 A;  2GX5 A;  3UDX A;  5GLD A;  3UMD A;  1MWR A;  1MWU A;  3QP1 A;  2JKT I;  4Q0H A;  1KE0 A;  4WMC A;  1ACF A;  5J7E A;  3ZVT A;  3IF6 C;  3Q7Z A;  2VV7 A;  4YOF A;  1LL8 A;  3BY8 A;  1P9R A;  3MXQ A;  2Y59 A;  1ESI A;  3W8K A;  1HTZ A;  3NCK A;  3SH7 A;  5DF9 A;  1Z09 A;  3EQU A;  1ES4 A;  1H8Y A;  2R9W A;  2WZZ A;  3MXR A;  4GHI B;  1ONG A;  4L9F A;  1NWZ A;  3C4P A;  2O9B A;  2Y2Q A;  3G30 A;  3PHY A;  3BJN A;  2OV5 A;  4B4Z A;  2M7U A;  1ERM A;  4S2I A;  1CI9 A;  5F68 A;  4WF0 A;  4PM9 A;  1PZP A;  4EES A;  4E3J A;  4I3J A;  4H6J A;  1F98 A;  2ZM8 A;  4WYY A;  5HWV A;  1K6S A;  5CED A;  3G32 A;  4B9O A;  3GVB A;  3NHQ A;  4Q0J A;  4JGO A;  4OKP A;  2Q9M A;  3MQO A;  3V3S A;  1H0M A;  2Y2H A;  3T4Q A;  4Y13 A;  1IYS A;  4E3K A;  3GTC A;  5CEB A;  5CGS A;  3W4O A;  1XFQ A;  2H10 A;  3KSG A;  3V5M A;  5HAR A;  4BL3 A;  1I5Q A;  4K0X A;  1NLZ A;  4Z1W A;  3ZG8 B;  3HUO A;  1NZU A;  5F6A A;  2R9X A;  2EXB A;  4KUK A;  1S4R A;  1PI4 A;  3DWZ A;  3BY9 A;  3VV4 A;  1EW0 A;  3ZG7 B;  3NY4 A;  3UB8 A;  5E2H A;  2WUQ A;  2KX6 A;  4NET A;  2XQZ A;  3LYX A;  3LIF A;  2EFU A;  1Y4O A;  3ZG0 A;  1LL9 A;  1S66 L;  1CEF A;  4CLC D;  3ZGA B;  5FQ9 A;  1N9O A;  4QY6 A;  3MKF A;  5CTM A;  1MWT A;  1YLT A;  3UE0 A;  5J8X A;  4FD8 A;  2L4R A;  3UNW A;  4IBX A;  5I5L A;  2ZL1 A;  2M7V A;  3IHA A;  3OPL A;  4H6J B;  2IWC A;  2W0N A;  5FQM A;  5HWT A;  4CLC A;  4ETZ A;  1OPX A;  2V8C A;  1K57 A;  4HEF A;  4GOG A;  4JKT A;  3R7W A;  2XRO A;  3CMZ A;  4GNU A;  1WYC A;  3E98 A;  3A3E A;  2WAE A;  3RH8 B;  2K31 A;  1G28 A;  3G34 A;  5M19 A;  1S6R A;  2VEA A;  4XT2 A;  4KZ6 A;  1K55 A;  4KZ3 A;  2V2F F;  3BLS A;  1NYY A;  2C6W B;  4DE3 A;  2X71 A;  3MBZ A;  4I38 A;  4GS9 B;  3ZHH A;  1JTD A;  3B42 A;  5DJT A;  1ES2 A;  3LCE A;  3JVU A;  3P01 A;  2ZQA A;  2NUT C;  4UEY A;  4KZ9 A;  2XFS A;  4PPR A;  2VGK A;  3KSI A;  2MJ6 A;  3EGD C;  4DJ2 A;  4D60 A;  5L2F A;  5FDH A;  1E3U A;  3IH8 A;  1HD8 A;  2ZBB A;  1T1B A;  3E4Q A;  5GLA A;  5FAQ A;  4OPQ A;  4X1L A;  4CQH A;  5GL9 A;  2VGL S;  2Y91 A;  4X69 A;  1KGG A;  1FIK A;  3UDF A;  1GA0 A;  3SW1 A;  5GHY A;  3VOZ A;  2ZL1 B;  3VP1 A;  3Q7V A;  5IHV A;  2NUP C;  4CLC B;  1F2K A;  2ZM0 A;  4JPM A;  3R7W B;  3IXH A;  2JN7 A;  4JGQ A;  1H5X A;  4KQR A;  3B47 A;  1MKM A;  4JF4 A;  4LFU A;  1RGZ A;  4IED A;  3O88 A;  2P9V A;  4XT2 B;  1T19 A;  2XDM A;  5E43 A;  1XX2 A;  3CPT A;  4N9K A;  3IF6 B;  5EVL A;  3F1P A;  3OCL A;  5EPH A;  2BLS A;  5K5B A;  1Q2P A;  1RCJ A;  2ZC5 B;  1W63 Q;  3SS4 A;  4DKI A;  3IF5 A;  4GLQ A;  1H8Z A;  3VE3 A;  1HZO A;  4HHD A;  3HRE A;  3S1Y A;  1OTE A;  1KE3 A;  3LI8 A;  1GCE A;  4P87 A;  1NZO A;  4OVD A;  4S2N C;  4RX3 A;  1XJ4 A;  3EEH A;  3VP0 A;  1V9Y A;  4GW9 A;  3HJI A;  1QMF A;  2VGL M;  3W2Z A;  2G2W A;  4JF6 A;  3VSL A;  3LIB A;  3DAV A;  5FI6 A;  1XJ2 A;  2GJ3 A;  1XFN A;  1PWC A;  5AQ7 A;  4GDB A;  2OSU A;  2WKH A;  3C2W A;  3WS5 A;  3LIC A;  3Q7V B;  3UB6 A;  3MQQ A;  2E8J A;  3BFF A;  2V8F A;  4FH4 A;  3GDI A;  4PKY G;  5FI2 A;  3BW6 A;  3MKE A;  3D72 A;  4HY8 A;  2P9V B;  2G7U A;  5EE8 A;  4MCW A;  3CPT B;  3LR5 A;  1DRM A;  2OOL A;  3LR4 A;  4HH2 A;  3NC8 A;  5HL1 A;  5CHM A;  4HIA A;  3RTY A;  1TD5 A;  1TS7 A;  2WGW A;  4MN7 A;  2ZMF A;  4E3L A;  3ZNY A;  3Q1F A;  3ZNT A;  3NOP C;  4UAA A;  4ETX A;  4Y3I A;  2ZD8 A;  2HJE A;  4U0X A;  3OOV A;  3PBQ A;  3LUQ A;  4ZBE A;  5CEC A;  2HP9 A;  4QY5 A;  1YT4 A;  5FEF A;  2ZC3 B;  3E2L A;  5GLC A;  1PW8 A;  4HES A;  4Y5F A;  1KGE A;  4KG2 A;  2XH9 A;  4MBH A;  1DP9 A;  3F1O B;  4X53 A;  2XA7 S;  3FG8 A;  3L9K A;  4B93 A;  3BRM A;  4RVA A;  4UA9 A;  3WS2 A;  4N1X A;  1MBL A;  3LO7 A;  5AJG A;  1YSQ A;  5AQ9 A;  1OJ5 A;  3CAX A;  2Y2I A;  5FAP A;  3F1N A;  3WS0 A;  2ZMV A;  4NKP A;  1PFL A;  1LT0 A;  2P74 A;  2QPN A;  3O3V A;  4ZJ3 A;  2KDK A;  2A2L A;  4JGP A;  2EWV A;  3VMA A;  5CHU A;  5CGW A;  2OWH A;  2WGW B;  3IQA A;  5AQA A;  3IWI A;  4HJ3 A;  5GLB A;  3MFX A;  3CLO A;  1M40 A;  5DF8 A;  4OON A;  1F5M A;  2HDQ A;  2W27 A;  3QP8 A;  4NXG A;  5E2G A;  3WS1 A;  3OPP A;  5KSH A;  1ODV A;  1BTL A;  2EXA A;  3CIT A;  3T1S A;  1ES5 A;  1MC0 A;  2FZ0 A;  2Y2K A;  1A0K A;  4MNR A;  4B4X A;  4I5S A;  4CJN A;  2HP6 A;  4O8G A;  4ARZ A;  2IWD A;  2RL3 A;  2XA7 M;  3KX0 X;  5L8M A;  2ACG A;  4Y15 A;  4Q8I A;  5E2E A;  1H3Q A;  4F94 A;  5J3W A;  4MEZ A;  2P7J A;  3E0Y A;  1GSW A;  2JKR M;  4KQD A;  4X55 A;  4A5R A;  3FV7 A;  5LBR A;  1LSV A;  3T12 B;  2V1A A;  3M6H A;  4BD0 A;  1EI5 A;  1OJG A;  4GZB A;  3H7W A;  4EQI A;  3M6B A;  1G6A A;  1TDG A;  2Y2M A;  4UA7 A;  3F1N B;  1VEU B;  3VFH A;  5L10 A;  1BSG A;  2V0U A;  2WZX A;  2O9A A;  1PZO A;  5G4Y A;  1PYY A;  3CUE C;  5FAS A;  5F82 A;  1YLY A;  3CI6 A;  3DW0 A;  1BUL A;  1ERO A;  4CLC C;  5EM1 A;  4DXC A;  1T1A A;  2EX2 A;  1K57 C;  1UWN X;  3G6O A;  2GDN A;  1PI5 A;  1JWZ A;  5GHX A;  4E6X A;  2K7S A;  3RXW A;  3PBT A;  1P0Z A;  3T1R A;  4BL2 A;  2GZA A;  5HW3 A;  5F5Y A;  3UB7 A;  3G31 A;  1JWP A;  4BBV A;  1K55 C;  3C7V A;  4HQA A;  4XXR A;  4PM6 A;  3D4F A;  2BAS A;  2JC7 A;  3G2Y A;  2QYB A;  3WRT A;  2XFT A;  1ERQ A;  4NK3 A;  1ZTU A;  2V1B A;  1MPL A;  5DFX A;  2W3G A;  4DDS A;  3ZVW A;  4UHU A;  5C5K A;  2KOI A;  3G35 A;  3T1X A;  2Y8H A;  4UQI M;  3FKV A;  2ZM2 A;  1FOF A;  3OPH A;  4YWZ A;  1VET A;  4GD8 A;  1IYO A;  1RGY A;  4DE0 A;  3I7J A;  3E2K A;  1HLU P;  3P98 A;  4ESP A;  1PIO A;  1G68 A;  3IWO A;  3VP3 A;  3A3J A;  4OQ0 A;  3UY6 A;  1LL5 A;  2JE5 A;  3HLG A;  1C3B A;  3IX8 A;  4PM7 A;  3PXP A;  1W79 A;  2HP5 A;  3TJZ C;  2D02 A;  5L07 A;  3IXD A;  4Y0O A;  3S7N A;  1W7F A;  4S2J A;  1RP5 A;  1CF0 A;  1G6O A;  5EVI D;  2WGI A;  3BM6 A;  4GN2 A;  4LV1 A;  5EEC A;  4PKY A;  4R4S A;  2Y2O A;  1W5D A;  2OAP 1;  4HJ4 A;  3AGF A;  2ZOH A;  1S1Z A;  4E3M A;  2Z2L B;  4X68 A;  4X6T A;  3LEZ A;  3UPO A;  2HZ5 A;  1PWD A;  1YSP A;  3PYP A;  2OLV A;  2OAQ 1;  5EVI A;  2XSS A;  1L3L A;  5DFY A;  2P08 A;  3GQZ A;  3V50 A;  5FA7 A;  2B18 A;  3A0V A;  2VV6 A;  5HAQ A;  5DJU A;  4DF6 A;  1K25 A;  1W63 M;  2X02 A;  3MJQ A;  1IEL A;  3S7O A;  5JYO A;  1N9B A;  3E4O A;  4DDY A;  4P6B A;  1CK3 A;  4OH0 A;  3T4O A;  2ZMA A;  3ZG9 B;  3Q81 A;  4EQ1 A;  1T18 A;  1BUE A;  4WZ5 A;  1O07 A;  1LLB A;  2QJ5 A;  4RA7 A;  1XJ3 A;  3RXX A;  2R78 A;  5G18 A;  2VZW A;  4EEU A;  4OP8 A;  1LI9 A;  2Z6D A;  4EW7 A;  2PBD P;  3T4T A;  5FDS A;  2O0Y A;  2W1R A;  1GSX A;  2EA9 A;  3EOI A;  4FOF A;  2FFF B;  3C8C A;  1OT6 A;  4HNB A;  2PT7 A;  2HF6 A;  2B95 A;  2HPB A;  2WAD A;  5FI7 A;  3ZQ5 A;  4PM8 A;  3R4K A;  2XRN A;  1YQS A;  3EWK A;  2WKR A;  3O87 A;  4O7D A;  3N8S A;  1E3U D;  1N4O A;  1OME A;  3G4P A;  4N92 A;  4KZA A;  4R3A A;  5TJJ A;  4ME4 A;  2EX6 A;  3OZH A;  4OOL A;  2PD8 A;  4NXE A;  5EVI B;  5A91 A;  4Y2F A;  4E6W A;  4G3W A;  4M3K A;  3TOI A;  2ZC4 B;  4GB7 A;  2LB5 A;  3SS5 A;  4P6Z S;  2PD7 A;  5KIZ A;  1SHV A;  3VP4 A;  1ONH A;  2A24 A;  5J4E A;  3H9W A;  4YFM A;  1Z6F A;  2QWS A;  2BTF P;  1PRQ A;  1H8M A;  2XF3 A;  1GSV A;  4OLD A;  4OQI A;  1IKI A;  2ZQD A;  4L9G A;  1YAX A;  1K56 D;  1MY8 A;  1XGJ A;  3HLE A;  3SZT A;  2Y4A A;  1LSX A;  1SDE A;  3WS4 A;  3M2K A;  1NJ4 A;  3VOL A;  4EBP A;  2HGV A;  4LLO B;  3UE6 A;  1DJA A;  4Y17 A;  1NLY A;  2VV8 A;  4R23 A;  4S2M A;  3UE3 A;  1K56 A;  3PBR A;  1KGF A;  1YLZ A;  4GD6 A;  3K3D A;  3TSG A;  3ITB A;  5CHJ A;  1K54 A;  3VOY A;  4LGW A;  5CER A;  3DTK A;  4R1G A;  1IKG A;  2WKQ A;  3T50 A;  1OTB A;  1IOU A;  4FCF A;  1L0E A;  5EM0 A;  2O9C A;  2XR0 A;  4ZJ1 A;  2ZLY A;  1E4D A;  4KZB A;  2V0W A;  5DKK A;  2J8Y A;  1TF1 A;  1GHI A;  1VQQ A;  4HBU A;  2J9O A;  4K91 A;  1P9W A;  2ZC6 B;  4KG5 A;  4CLC E;  3BLM A;  5FQK A;  5A8B A;  3MXS A;  4WZ4 A;  5BOH A;  1TVF A;  4L9E A;  3MS6 A;  4IHQ A;  1MXO A;  5EV0 A;  2A24 B;  5HFO A;  2H28 A;  3RFB A;  4WM9 A;  3V67 A;  2DNS A;  4JGR A;  1J9M A;  2Y2L A;  4XUX A;  2PYP A;  3JPU A;  1ZG4 A;  2H0T A;  3UME A;  5F69 A;  1Y54 A;  5HDC A;  1L0G A;  3FYZ A;  3FKW A;  2JCH A;  1CEG A;  2ZQ7 A;  5DVA A;  3GMW A;  1EWZ A;  4H8R A;  3HBR A;  1JVJ A;  4LV0 A;  1SKF A;  3AGD A;  4WL9 A;  3IH9 A;  3NOU C;  4NG2 A;  2X01 A;  5IU1 A;  3N4I A;  5TBM A;  3K2N A;  2AVX A;  4GDN A;  1XGI A;  2J80 A;  2QKP A;  1YKD A;  2PU2 A;  3F1P B;  4E3O A;  4BBT A;  3BFD A;  3MZD A;  1FCN A;  2JKT M;  4MN6 A;  4WEJ A;  3IS2 A;  3NEC A;  5EVE A;  2PR5 A;  3OPR A;  2J7V A;  3HUM A;  3Q07 A;  5AQB A;  3IHB A;  3W4Q A;  5HDD A;  5G4Z A;  3MSH A;  2XD1 A;  3HLC A;  3NDE A;  4QHC A;  2DCF A;  4P85 A;  1IFQ A;  1FSW A;  4E3I A;  2DRW A;  3HCY A;  3LID A;  3GRJ A;  3P7N A;  3NDG A;  3VSK A;  1ESU A;  3NUL A;  4PAU A;  4R0Q A;  4OPY A;  1S1Y A;  1KOU A;  3UE1 A;  3HLD A;  3LR0 A;  3KSH A;  5HAI A;  3H82 A;  1NXY A;  1OTA A;  5CX7 A;  2V20 A;  2J3T D;  5HD5 A;  4OOM A;  3OCN A;  1D06 A;  4QB8 A;  4WLA A;  4HI4 A;  1SZV A;  1PWG A;  1PW1 A;  4PM5 A;  4S2L A;  1G5U A;  3TE8 A;  4KG6 A;  2QMI A;  3BQA A;  2OWJ A;  4WN5 A;  5F1F A;  3MFD A;  4DMZ A;  1XP4 A;  2W1T A;  1KVM A;  3O86 A;  3O5Y A;  2VGJ A;  5TGF A;  1S4S A;  2KLI A;  4ZAM A;  3UB5 P;  3ULF A;  1U60 A;  4G3V A;  4OQH A;  4O01 A;  1SDN A;  1VHM A;  4DJ3 A;  1TEM A;  4Y0U A;  1XJ6 A;  4X1M A;  2A49 A;  5EOO A;  1LI0 A;  1JTG A;  1ZG6 A;  3MR0 A;  2ZQ8 A;  1NYM A;  1L0D A;  4KQO A;  2A3U A;  5DTK A;  5FEG A;  1ZKJ A;  4JF5 A;  1YLW A;  3L7H A;  1AWI A;  5F1G A;  5EVI C;  3UB9 A;  2JKG A;  3MF0 A;  4QJG A;  5HSQ A;  1YLJ A;  3HVF A;  2IA2 A;  4GHI A;  4BLM A;  1I2W A;  2B5R A;  1W8Q A;  2E8I A;  4XUZ A;  2FH5 A;  1LSW A;  4QWO A;  1TS6 A;  3U4L P;  4EET B;  4WZ5 C;  1NRF A;  4S2O A;  2CMN A;  4EEP A;  3BFG A;  1FCO A;  2LB9 A;  5IS1 A;  1F9I A;  1STZ A;  3LY4 A;  4EU0 A;  2JBF A;  1ALQ A;  1N9L A;  3IBJ A;  1KVL A;  5HPF A;  4EV4 A;  5FAO A;  4JXV A;  4KEN B;  2HV1 A;  2YKF A;  1BYW A;  2PBY A;  4FH2 A;  3S22 A;  5A90 A;  4Y7P A;  2JHE A;  1Q2Q A;  2P04 A;  3UN7 A;  3WRZ A;  4NEE D;  1K4E A;  3KO6 A;  2IWB A;  5AVE A;  4R38 A;  3NI9 A;  3MMH A;  1ES3 A;  1GHP A;  4ARZ B;  3KYQ A;  4BD1 A;  3B33 A;  3V39 A;  3WWX A;  5U47 A;  1DJC A;  5EFW A;  1N9N A;  1IYQ A;  4II7 A;  4S2K A;  1L2S A;  2L0W A;  4L0L A;  2UWX A;  2ZJ9 A;  3H7W B;  4EXO A;  3UDI A;  1SCW A;  5EOE A;  3RJU A;  2CC1 A;  3PBO A;  2ZOI A;  4JXG A;  4RYE A;  4R3B A;  2DMW A;  3MZE A;  1BLP A;  3GR2 A;  3FC7 A;  4JXS A;  4LPZ A;  3HJK A;  2Q9N A;  5FL3 A;  5KMW A;  4WBG A;  4LCM A;  3A0R A;  3PTE A;  5E2F A;  4BQM A;  3LR3 A;  3IXB A;  3PBN A;  3MZF A;  1LHY A;  5EUA A;  2WGV A;  3N8L A;  4GCZ A;  4MBF A;  3PR6 A;  5M18 A;  4IVI A;  5A93 A;  3BEC A;  3FPW A;  4BMW A;  1K54 C;  2OLU A;  1MZU A;  2EX8 A;  5DF7 A;  2Y2J A;  1OTD A;  1BLS A;  2ZC7 A;  3T4J A;  5M1A A;  3DTE A;  3LFV A;  4HH3 A;  2VA0 A;  3C38 A;  3BQ8 A;  3GEC A;  3KSF A;  2D01 A;  4R6L A;  4GS9 A;  3ZCZ A;  3ICY A;  4I3A A;  4GJ4 A;  1OT9 A;  3BYD A;  2PR6 A;  4N1H A;  1VET B;  3D3O A;  4DE2 A;  4OP5 A;  1L0F A;  3A0S A;  5CRF A;  3TG9 A;  3C7U A;  3P09 A;  2Q0O A;  1SKO A;  3HL9 A;  3JVV A;  4YNR A;  3MQ0 A;  4B88 A;  3QNB A;  4CPK A;  3BFC A;  4EUZ A;  3ISG A;  3CUE A;  2M1C A;  3N6I A;  1FQG A;  3OLO A;  5CGX A;  2JKR I;  3HLF A;  1KDW A;  3CG5 A;  4R4R A;  2PHY A;  2JKF A;  4WUJ A;  5KZH A;  1BLH A;  2Y55 A;  3BEB A;  1X0O A;  4OQG A;  4I3I A;  2EWW A;  3EEA A;  2WKI A;  3LI9 A;  1VM1 A;  4M4X A;  1VB6 A;  3HLB A;  3QP2 A;  3M2J A;  2J3W A;  3ITA A;  1W8Y A;  3T1Q B;  2I72 A;  2BG1 A;  1WE4 A;  4G3K A;  5L09 A;  1DY6 A;  2XGN A;  3IF6 A;  1K4F A;  2W3F A;  4IBR A;  4LRZ E;  5DTS A;  4ID4 A;  2PYR A;  4HP4 A;  4C75 A;  2PRF A;  1D1J A;  3FZC A;  3K3C A;  3NBL A;  2HDS A;  3ZG5 A;  1WYB A;  3JYI A;  1IEM A;  3HUN A;  4KQQ A;  4IJG A;  5FAT A;  2EFX A;  3QP4 A;  1ZC2 A;  3N8R A;  4MMN A;  3DTI A;  1K6R A;  3ZYT A;  4ZDX A;  2Y2N A;  3VE4 A;  1HVB A;  2PU4 A;  4JBF A;  4OLG A;  4EBL A;  1J3W A;  4KZ5 A;  2Z6C A;  2INW A;  3T4L A;  4DXB A;  2W3H A;  1CI8 A;  2FFY A;  1SKO B;  4E3N A;  3A3I A;  3TRC A;  1FIL A;  2W3D A;  3CWF A;  2WKP A;  2Y2P A;  4RX2 A;  3DTM A;  2XLN A;  5HAP A;  1TDL A;  1Y28 A;  2VK3 A;  3NIA A;  1IYP A;  4X25 A;  4U0T A;  3GV9 A;  3C5A A;  4HOI A;  2GNX A;  4PMA A;  1XA1 A;  1FSY A;  4ZRR A;  3SH8 A;  3ZDJ A;  4JLF A;  5IT5 A;  4P0M A;  3PBS A;  3SS3 A;  4DN0 A;  2XEP A;  4S2P A;  3IX3 A;  5D3O A;  3S7P A;  2J3T C;  1YMX A;  5HL6 A;  4X56 A;  3VFF A;  4OPR A;  4KUO A;  1NY0 A;  3TW8 A;  3LY3 A;  1NRJ A;  1MKI A;  5HD3 A;  4P6Z M;  2ZQC A;  4F3L A;  2WAF A;  4HBT A;  3A3F A;  1XPB A;  4DE1 A;  4K08 A;  3LIA A;  3A3D A;  5HDS A;  3UO9 A;  1M6K A;  1GHM A;  2XD5 A;  3QHY A;  2UV0 E;  4IVK A;  3T4S A;  2K2N A;  5FQJ A;  4EBN A;  1YMS A;  2W3E A;  1S0W A;  4R70 A;  4U3T A;  4JXW A;  3HLW A;  3NOT C;  4BWI A;  1KE4 A;  4EUV A;  5FQI A;  3F1O A;  3SH9 A;  3EQV A;  3E4P A;  2VKS A;  3N7W A;  2HDR A;  4QD4 A;  2L1M A;  3LIE A;  2J9P A;  3LEQ A;  1UWP X;  1TS8 A;  4PHT A;  3IX4 A;  1YPR A;  2Y2G A;  4OOY A;  1FCM A;  4OPZ A;  2VJW A;  1BZA A;  3EGX C;  4E04 A;  3S7Q A;  2ZQ9 A;  5I94 A;  1YLP A;  1CQA A;  3QNC A;  1OTI A;  3OC2 A;  2QZ6 A;  1DP8 A;  4Z9Q A;  1D7E A;  3C30 A;  1V9Z A;  2C5W B;  4YIN A;  4LV2 A;  5DTT A;  2QHK A;  3NJA A;  4MLL A;  4BEN A;  4R3J A;  3W4P A;  4D2O A;  3IWQ A;  4F3L B;  4FUW A;  5AVF A;  5HZH A;  5HWW A;  3IXG A;  5JYP A;  3IT9 A;  3BWL A;  1E25 A;  4NXF A;  4AFI A;  4C3Q A;  5F83 A;  2Y79 A;  4ZJ2 A;  4QPR A;  2V1Z A;  3LGO A;  1GA9 A;  2B02 A;  5HPI A;  3VP2 A;  3Q82 A;  5GHZ A;  3DBA A;  3UPP A;  5MC7 A;  4LRY C;  4IUK A;  4BJP A;  4MN5 A;  1XXM A;  2WKE A;  3PAE A;  2VLG A;  4LCL A;  4MBK A;  4NXB A;  3T4K A;  2O99 A;  5TBM B;  3ZFZ A;  1FR1 A;  3G2Z A;  5DKL A;  4O0P A;  1VEU A;  1AXB A;  2PDR A;  4MDZ A;  2I9V A;  4HP9 A;  3SOI A;  3DWK A;  3CHW P;  3IS2 B;  3CZD A;  5TFQ A;  1S67 L;  1FR6 A;  4WEL A;  2RCX A;  2EX9 A;  3C4O A;  3S4X A;  4ZTK A;  5HX9 A;  1BLC A;  4S2N A;  4LEN A;  4QU3 A;  4N9L A;  3D9Y A;  1DJB A;  1I2S A;  3KYE A;  1DP6 A;  3V3R A;  4I39 A;  5CXW A;  3OBF A;  4K0W A;  4Y0T A;  2G2U A;  1ZHH B;  3FPV A;  3CJM A;  1TS0 A;  2VX8 A;  3FWL A;  1P97 A;  4HJ6 A;  3PAG A;  4KZ7 A;  2QJ7 A;  3H82 B;  4FTX A;  2PAV P;  4EER A;  3QP5 A;  3U2A A;  3IBR A;  4Q0I A;  1BT5 A;  1JWV A; 
#chains in the Genus database with same CATH homology
 2PRF A;  1D1J A;  3CPT A;  1A0K A;  3T1X A;  1CJF A;  1K0K A;  2ACG A;  1VET A;  3UB5 P;  5FEF A;  1J3W A;  1HLU P;  4ESP A;  4X1M A;  1VET B;  1VEU A;  3T12 B;  1SKO B;  2PBD P;  3NEC A;  5EVE A;  5FDS A;  1FIL A;  3L9K A;  3LEQ A;  3CHW P;  2VK3 A;  1VEU B;  1YPR A;  3DAV A;  5EM0 A;  4D60 A;  5FEG A;  2B95 A;  4X25 A;  1SKO A;  1CQA A;  3MSH A;  3L7H A;  1AWI A;  1PNE A;  4X1L A;  1PFL A;  1Y4O A;  5EM1 A;  1FIK A;  1CF0 A;  1ACF A;  2E8J A;  3MS6 A;  3D9Y A;  3NUL A;  2V8F A;  2JKG A;  2JKF A;  5EV0 A;  3KYE A;  2ZL1 B;  4FUW A;  1F2K A;  3T1R A;  1Z09 A;  2HZ5 A;  4QWO A;  3T1Q B;  1SZV A;  4FTX A;  2PAV P;  2ZL1 A;  3U4L P;  2BTF P;  1PRQ A;  1G5U A;  3CPT B;  2V8C A;  3LGO A;  3T1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...