2PRFA

Three dimensional solution structure of acanthamoeba profilin i
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
125
structure length
125
Chain Sequence
SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGQTLASAFNNADPIRASGFDLAGVHYVTLRADDRSIYGKKGSAGVITVKTSKSILVGVYNEKIQPGTAANVVEKLADYLIGQGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROFILIN IA
publication title Three-dimensional solution structure of Acanthamoeba profilin-I.
pubmed doi rcsb
source organism Acanthamoeba sp.
molecule tags Actin-binding
total genus 11
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1994-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 2prfA00
4QWOA 3KYEA 1CF0A 3LGOA 2VK3A 3T1RA 2JKGA 2BTFP 1Z09A 3DAVA 5EM0A 4FTXA 1VEUB 2V8CA 4ESPA 1PNEA 1K0KA 3L9KA 2PAVP 1FIKA 1SKOA 1FILA 4X1LA 5FEFA 4D60A 2HZ5A 1YPRA 4X25A 1ACFA 3L7HA 3CPTA 2ZL1A 5EV0A 3LEQA 3CHWP 1HLUP 1SZVA 1VETA 3MS6A 3NULA 3NECA 1SKOB 5FEGA 5FDSA 4FUWA 3T1SA 2V8FA 3T1QB 1J3WA 3D9YA 1F2KA 1CQAA 3T12B 3MSHA 1Y4OA 1D1JA 2JKFA 1PFLA 2PBDP 3CPTB 5EM1A 1G5UA 2ZL1B 4X1MA 2E8JA 1A0KA 3T1XA 1VETB 2PRFA 1AWIA 2B95A 3UB5P 1PRQA 1VEUA 2ACGA 5EVEA 1CJFA 3U4LP
chains in the Genus database with same CATH superfamily
3HVFA 4GOGA 3Q1FA 3KYEA 3S7QA 2Y2HA 2V0UA 2ZQCA 1GSXA 1OTDA 3OCLA 3S7OA 3O86A 1FCOA 4R3AA 3ZG8B 1ALQA 4RQ9A 3UDFA 2XFSA 1HD8A 3W2ZA 3G6OA 2VJWA 3N7WA 3FPVA 1K25A 4E3IA 2W3DA 5I5LA 3TE8A 3PBOA 4PM8A 1XJ6A 1YPRA 1Y54A 1BLHA 2XDMA 3BM6A 2WKIA 1TS8A 3BFEA 1C3BA 3LIBA 2QYBA 2WGWB 3PTEA 4QY6A 5KSHA 3KX0X 3G30A 3KSIA 4GD6A 4EBNA 1L2SA 3MZEA 3BLMA 1IFQA 4NEED 3CWFA 4KUOA 3O5YA 1BSGA 4FUWA 3ZG7B 1MWRA 2V8FA 4OOLA 3MQOA 5HL1A 1ZC2A 3E4QA 3C4PA 1BLSA 4DF6A 1ES3A 1ES4A 2JKFA 2XD5A 1DJCA 2MJ6A 1BLCA 5DTSA 1W63M 4KQOA 2CC1A 4XT2A 2A24A 2QWSA 3DWKA 2OSUA 3IBRA 1ES5A 5F6AA 2KDKA 5EVID 3U4LP 3F1OB 3F1PA 3S4XA 2ZQ7A 5HZHA 3O88A 3UB7A 2Q0OA 5BOHA 4PKYG 4X6TA 1N9NA 3AGEA 2A3UA 4OPZA 5JYOA 2B18A 3DAVA 2XA7S 3H82B 4KZAA 1S4SA 5HPIA 2HDSA 5GLBA 3FZCA 5CXWA 4DDSA 1PWCA 4E3JA 5DVAA 1XA7A 4WM9A 1H0MA 4U0TA 2VZWA 3IT9A 3V5MA 1K4EA 2KLIA 5M1AA 2HV1A 3UNWA 3MJQA 5K5BA 4HBUA 2R9WA 1FQGA 4ARZB 5FI7A 1H3QA 5AVEA 1KGEA 2OOLA 1Q2PA 3UO9A 3CHWP 3MR0A 2JE5A 1WYCA 2PHYA 2PU2A 4GDBA 5J8XA 4MMNA 3C8CA 2P7JA 3AGFA 4RVAA 2O99A 3M2JA 3O3VA 2WGVA 1BZAA 5CHJA 2B5RA 4NXBA 1K6SA 4LRXC 2XF3A 2XD1A 3TRCA 3KO6A 4HP9A 4NG2A 1YLZA 4QB8A 2Y59A 1YLJA 3SS4A 4XUZA 4E3NA 1U60A 2C5WB 5HAQA 3UE0A 3DBAA 1WE4A 1CF0A 3MXSA 4R70A 3LR0A 5CTMA 5DF8A 4OQHA 4Y0UA 3ZGAB 3LIEA 5CECA 2WZXA 4GDNA 2Y91A 3KSHA 2K2NA 5HW3A 4HY8A 2M7VA 1TS6A 2BASA 1ES2A 3WWXA 4EBLA 3PBRA 3C38A 3OLOA 1S1ZA 3CZDA 4GCZA 4QJGA 2GZAA 1TS0A 2XK1A 4O0PA 4X1LA 5AVFA 3BFDA 3VSKA 1S67L 1P9RA 3HUOA 4ETZA 3JPUA 5M18A 1T1BA 4UA6A 4WMCD 2Y2PA 3PYPA 3BLSA 5DTKA 2XROA 3TG9A 4FD8A 1K56A 2L4RA 4HOIA 4UAAA 1SZVA 3I7JA 1N9OA 4FCFA 1MC0A 1NRFA 2JKTI 3OPHA 5KSCA 3ITBA 3T1QB 3V3SA 3UPOA 2Y2JA 3DTKA 5F68A 3GMWA 5AQAA 2EWVA 1CQAA 4IJGA 2P74A 3IWIA 5CRFA 2PT7A 4CLCD 4EUVA 1G5UA 1FCNA 4P6ZS 3LY4A 4LRZE 3T1XA 2WK0A 3OPLA 3T4LA 3R4KA 1SDNA 1PRQA 3GVBA 3G2YA 4M4XA 4RX2A 3IX3A 1CI9A 5EVLA 1SCWA 3ZHHA 2VKSA 5U47A 4KZ3A 2XRNA 4F94A 4YOFA 3FKWA 3PBTA 2W0NA 4KQRA 4LCLA 4PKYA 5FQQA 4I3AA 4H8RA 2INWA 4S2MA 2HDQA 3C2WA 5HARA 3LEZA 3SH8A 2GJ3A 1PI4A 4UEYA 2ZC6B 2V9AA 2B02A 3BQ8A 3IBJA 1ZG4A 5GHXA 3NOUC 4I38A 3CPTA 1NLZA 1PWGA 1P97A 1EWZA 3UDIA 4JXSA 4B9OA 5F5YA 3IF6C 1EI5A 1MZUA 4ZDXA 2C6WB 3DW0A 2ZC4B 4FSFA 1GA9A 3VSLA 4ZAMA 4L9GA 1JTGA 5HAPA 1VQQA 2GDNA 3VOYA 4NKPA 4OOMA 5IS1A 1L0FA 3HUMA 4HH2A 3IS2B 3BFGA 1OJGA 4WELA 2RCXA 4DE1A 4X1MA 4KZ7A 2PYPA 3FV7A 1K57A 1EW0A 2ZMAA 4WZ5A 3NDEA 5TGFA 2Y4AA 2Q9MA 4DJ2A 2NUPC 3IHBA 1H5XA 2P08A 3EGXC 5CGWA 4YWZA 3C7UA 2ZQDA 3E0YA 3SZTA 2VEAA 4JPMA 4DDYA 4ZJ3A 1D06A 4CLCB 3EOIA 4R4SA 2ZM0A 2H10A 4K0XA 4LRYC 4Q0IA 3LIDA 1XJ3A 2VV7A 3S7PA 2ZD8A 1CK3A 4S2NA 4D60A 1SDEA 1W5DA 3JVUA 2WAFA 2Q9NA 3DWZA 1SHVA 1KVMA 1OTEA 1W8QA 5AQBA 4L9EA 5AQ7A 4GLQA 3F1NA 4PM9A 2DCFA 4S2JA 3KSFA 3MZFA 3GSGA 3QP1A 4PM7A 4Z1WA 1NRJA 2ZM8A 1YSQA 2RL3A 1OPXA 5E2EA 3IF5A 4GHIA 3ZNTA 4UQIM 2YKHA 4OOYA 1DP6A 2W3HA 3IXGA 1NYMA 1T1CA 3EQVA 4H6JB 4WYYA 1LT0A 3JYIA 2G7UA 5A8BA 3UB9A 1VETB 3T4SA 5C5KA 1FCMA 3LO7A 3E2LA 3JVVA 5EE8A 4MBHA 4JBFA 4R3BA 4S2OA 3FWLA 4WLAA 3UPPA 3VE4A 3P01A 5HWVA 5I94A 1XJ4A 3W8KA 3CUEA 2K7SA 3TJZC 4GD8A 4CLCE 3LICA 4YINA 3G34A 4WL9A 3LY3A 2HPBA 3WRTA 4N9LA 4E04A 2WGWA 3FPWA 5EM0A 4DE0A 1IYOA 2X71A 3VP3A 3HLCA 5TJJA 3QP2A 3A3JA 4II7A 1G6AA 1RCJA 3QP4A 5L09A 1M40A 2H0TA 3QP5A 4EQIA 1IKGA 4HHDA 3IWOA 1K57C 2KOIA 4X25A 1ACFA 2GNXA 2Y8HA 3V39A 3IX4A 3OOVA 4F3LB 4G3KA 5EECA 1YMSA 2EXAA 2V1ZA 3CG5A 4HEFA 4EETB 4KQQA 2PR6A 1LHYA 3BECA 1NLYA 3F1OA 4JF4A 1OTIA 2ZLYA 4OQGA 2ZJ9A 1PZOA 1LI0A 3MMHA 3IWQA 3ZG9B 2EWWA 5FAQA 3KYQA 4GNUA 4EU0A 4JKTA 3H82A 3UB5P 2Y2IA 4R3JA 3GDIA 4JGQA 4BMWA 2HJEA 4HI4A 4LENA 3IXBA 3HLGA 2EXBA 3A3EA 1L0DA 3NJAA 3LGOA 3NCKA 4OP8A 1ESIA 3G2ZA 1T18A 2JKGA 5HDCA 3CI6A 4ARZA 4LGWA 2KX6A 2QJ7A 4HJ4A 4N1HA 4LLOB 4WEKA 2JKRM 4IUHA 3HJIA 3FKVA 3BEBA 1NYYA 3IQAA 3BRMA 5FQKA 5HWWA 1V9ZA 5G18A 4N92A 1O07A 4JGOA 1K6RA 1TDGA 5FEFA 2ZMFA 3WS5A 3VP1A 1F5MA 3N8RA 3MZDA 2GX5A 3IXDA 1RP5A 5IHVA 4FOFA 2V2FF 3A3DA 1ERQA 1I2SA 1OTBA 1W7FA 3NHQA 1K54A 5EOEA 3WS2A 3BQAA 4BL2A 3RXWA 3SW1A 3NOPC 4GW9A 4JGPA 3PAGA 1JVJA 3E4PA 3TOIA 1XP4A 4MDZA 3CUEC 4Y13A 3D9YA 1W8YA 1Y4OA 2UWXA 1E3UD 3LR5A 3K2NA 4BBVA 3Q81A 5FI2A 2ZL1B 1K38A 2E8JA 2J8YA 1ODVA 4DMZA 5FAOA 3HLWA 2B95A 3ZG0A 1H8YA 3R7WB 2ACGA 1XFNA 5DKLA 1KGGA 2VV6A 1MXOA 3H7WB 3QP6A 3A3IA 4OPQA 5HSQA 5DJTA 2Z2MB 3ITAA 3CJMA 3HLBA 3A3FA 2Y55A 4RA7A 3P7NA 3VP0A 1K56D 4HJ6A 5D3OA 2FFFB 1ZHHB 3G32A 4ZTKA 2FZ0A 1L0EA 1PW1A 1KGFA 3L9KA 1BLPA 2VV8A 2EFUA 2PAVP 1FIKA 3OPRA 2J3WA 1DP8A 4EWFA 2EFXA 2H5SA 4LV1A 5F1GA 2OLVA 2QHKA 4I39A 1CEFA 1PZPA 1TDLA 3ISGA 1NXYA 1G68A 5F83A 1T1AA 3B3XA 1UWPX 2ZC5B 3G31A 5CHMA 1W63Q 3Q82A 1BYWA 4MNRA 1K4FA 1HLUP 2BG1A 3C5AA 3HLEA 4BBUA 1OMEA 3NC8A 5EVIB 3N8SA 2J9PA 5KZHA 4S2PA 1MY8A 1L0GA 1FOFA 1PFLA 3NDGA 3C4OA 1N9BA 3BYDA 1NJ4A 2EX9A 5HD5A 1FSYA 4EBPA 3V67A 5KMWA 4ME4A 2DRWA 3A0VA 1AWIA 3QNBA 2XQZA 3ZFZA 1XGIA 3A0RA 5CEBA 3QHYA 5MC7A 1DRMA 4OPRA 5HX9A 1TS7A 4FH4A 1N4OA 1MWSA 2ZC3B 3IF6B 3S22A 4WN5A 3PR6A 3ZYTA 1K54C 3T4KA 3CMZA 3Q7VB 4MBKA 1F9IA 3QP8A 4IBXA 4K91A 4NXFA 4Y5FA 1XGJA 2X02A 1TD5A 4IBRA 4IEDA 4G3WA 1PNEA 3C7VA 4EUZA 3O87A 4PMAA 1XJ2A 2Z6DA 3RJUA 4DE2A 2ZM2A 1DJAA 3FG8A 3LR4A 4EW7A 1UWNX 4PM5A 3C30A 2X01A 3IS2A 4WUJA 4LPZA 3LIAA 3MKFA 3D4FA 4WMCA 4RX3A 2O9CA 2VX8A 1IOUA 1M6KA 2Y79A 4NXEA 5HD3A 1J3WA 4QU3A 2DMWA 2LB9A 4EEUA 5L2FA 1LSXA 2EX2A 3G4PA 4JXVA 3PHYA 3VMAA 4S2LA 4PAUA 2R9XA 4MEZA 4CLCA 1T19A 1MKMA 2OAQ1 4MN5A 4OQIA 3GR2A 4JLFA 4KZ5A 3VOLA 2WKHA 4HQAA 4R6LA 3MKEA 3E4OA 3B42A 5FAPA 1DJBA 2O0YA 2I9VA 2XFTA 3S1YA 2Y2GA 5AQ9A 1GA0A 3CITA 1S4RA 4KZ4A 2FH5A 3LUQA 2R78A 3GRJA 3ZDJA 5M19A 2WKQA 2Z6CA 1H8ZA 3E2KA 4I5SA 3SS3A 3G35A 3K3CA 1VEUB 4KENB 4R4RA 2V8CA 2Y2QA 1Y28A 3CAXA 3EQUA 5GHZA 1J9MA 4K08A 2BLSA 4XXRA 1YLWA 3LI9A 4UA9A 1WA9A 4MCWA 3WS0A 2FFYA 2ZC7A 1EROA 2HDRA 1KDSA 3UMEA 1NZOA 4BQMA 4KZBA 4LFUA 4HP4A 4H6JA 1S6RA 1YKDA 2JKRI 3IH8A 4B4XA 4X69A 3KYZA 4P0MA 1YLTA 5EV0A 3V50A 1VETA 3MS6A 1SKOB 3OBFA 1GSWA 3LR3A 4KZ8A 4E6XA 3H9WA 3W4QA 3EEAA 3D3OA 5TFQA 4ZJ2A 4QD4A 1KE0A 4P6ZM 3BW6A 3T12B 1Q2QA 1OT6A 4CJNA 3UY6A 3ZCZA 3QNCA 1A0KA 4OLGA 3VP2A 1GHIA 5A93A 2XEPA 3Q7ZA 1BTLA 1ONHA 1Z6FA 1JNUA 3M6HA 1IYPA 2WKRA 1LSWA 3LI8A 3T4TA 4AFIA 3A0SA 2P9VB 3MXQA 5HDDA 2IWDA 3WS1A 2DNSA 1GHMA 1V9YA 4GS9B 2AVXA 4NETA 5HAIA 1HVBA 3T1RA 1TVFA 4BD1A 4IUKA 4NXGA 4OPYA 4MN6A 1ONGA 1Z09A 2I72A 2V20A 4JF6A 3LCEA 5GLAA 2J3TC 2HDUA 1GHPA 5FI6A 1JWZA 1FR1A 1KVLA 1YSPA 4F3LA 4EEPA 4I3IA 3B33A 4MN7A 1WYBA 5IT5A 2V1BA 4Y7PA 1FR6A 2O9BA 4IVIA 3SOIA 4HJ3A 2J9OA 5E2GA 3LFVA 5J3WA 4BBTA 1W79A 3F1NB 1YT4A 4EERA 1YQSA 1E25A 4K0WA 5HFOA 1JWPA 1RGZA 2ZMVA 2W3EA 5DFXA 3UB8A 4YFMA 4O7DA 4IVKA 2YKFA 5CTNA 3T1SA 1LL5A 4Q8IA 4WZ5C 1IYSA 4R23A 4BENA 3MSHA 4KQDA 3PBSA 5TBMB 1IELA 2JHEA 1XFQA 1XPBA 1JTDA 3LIFA 2L1MA 2OLUA 2IA2A 4B88A 4E3MA 3WS4A 3SS5A 4QPRA 4D2OA 2HP9A 5J4EA 4OVDA 2WUQA 3ZG5A 5HL6A 1CJFA 4PM6A 3IHAA 1MWUA 4GB7A 4ID4A 5DTTA 5F69A 3N8LA 1F98A 4YNRA 1K55A 4N9KA 5HWTA 1PIOA 3PBNA 4GKUA 2WAEA 3GTCA 4O01A 4S2NC 4DJ3A 2V1AA 2WGIA 4P85A 1KOUA 2HP5A 1YAXA 4ZBEA 2W1TB 3DTMA 1S0WA 1YLPA 4BLMA 3LYXA 4M3KA 2Y2MA 2WADA 1H8MA 3ULFA 1CEGA 4B93A 3MXRA 3RTYA 1L3LA 2ZQ8A 2M1CA 2E8IA 3ZQ5A 1MKIA 3EWKA 2ZL1A 4RYEA 3VE3A 3VP4A 1I5QA 4OQ0A 1ZTUA 5CGXA 4L9FA 2OAP1 2JN7A 2VGLM 4Y17A 5FEGA 2XLNA 3T4OA 4ETXA 3P98A 4X53A 5FA7A 3R7WA 2XSSA 3T50A 3AGDA 3SH9A 3ICYA 4HH3A 5DF9A 1F2KA 3H7WA 1KE3A 2QJ5A 4EQ1A 3GQZA 3M6BA 2XGNA 3HL9A 3CLOA 1MBLA 2VLGA 1HTZA 5FDHA 5CX7A 4KG5A 4DKIA 4JF5A 2ZOIA 4JXWA 2CMNA 2L0WA 3ZNYA 5G4ZA 5DKKA 1GCEA 4WBGA 5J7EA 2WYXA 3FC7A 5E2FA 5CHUA 3OCNA 4XT2B 2A24B 4WZ4A 3SH7A 1PW8A 3TSGA 1XX2A 1GSVA 4HNBA 3UDXA 5A91A 3MF0A 1PWDA 2NUTC 2PU4A 4U3TA 2QZ6A 5GLCA 4E6WA 3F1PB 5A90A 5EVIA 3MQQA 4R1GA 4DRTA 3HCYA 2Y2LA 4HESA 1XKZA 1LL8A 2P04A 1VB6A 2VA0A 4L0LA 2IWBA 3HJKA 5TR7A 1LI9A 3LEQA 3VOZA 4S2KA 1NWZA 3FYZA 3NULA 1I2WA 4OKPA 5FQ9A 5FQIA 2OWJA 2QKPA 5FDSA 2PDRA 4QHCA 2JC7A 1K55C 3B47A 3UN7A 2D02A 4BL3A 2WKPA 3HBRA 3IF6A 5DFYA 2ZOHA 2OV5A 4PHTA 1E3UA 3T4JA 4U0XA 4DE3A 3Q7VA 4C75A 1D7EA 5HDSA 4G3VA 2PRFA 4WEJA 5L07A 3NOTC 2EA9A 5GHYA 2PBYA 1BULA 1E4DA 1ZKJA 1QMFA 1XA1A 1TF1A 1UGUA 2D01A 3PBQA 2EX8A 1DY6A 3IXHA 5EFWA 3UB6A 4OLDA 4KUKA 2VK3A 3VFHA 2Y2NA 2Y2KA 2VGKA 3WRZA 5IU1A 4JXGA 3N6IA 4Y3IA 1IEMA 4UA7A 4BWIA 4C6YA 2W1RA 2J3TD 3W4PA 1QMEA 4Y15A 3EGDC 1FILA 2XA7M 1NY0A 5FL3A 3K3DA 3UE1A 5L8MA 4QY5A 4Y0OA 2HZ5A 3RXXA 4EXOA 1MPLA 2ZQ9A 4GZBA 3L7HA 1RGYA 4DXCA 1YM1A 1YLYA 4EV4A 4GJ4A 4OH0A 2K31A 1PYYA 1G6OA 3W4OA 1X0OA 2A2LA 5EPHA 5LBRA 1PI5A 4LCMA 5F82A 1P9WA 5FASA 5L10A 4KZ6A 4E3KA 3GV9A 4LV2A 4UQIS 4PPRA 5EM1A 4N1XA 1MWTA 4X68A 1S66L 2HJ9C 3NI9A 5JYPA 5EVIC 4NK3A 1XXMA 2A49A 2WZZA 3NIAA 1VEUA 2H0YA 2J80A 1LSVA 4FH2A 2JCHA 4QWOA 4Y0TA 4CPKA 1IKIA 4ZRRA 2G2WA 1IYQA 3BFCA 1VM1A 2PYRA 3MFDA 4KG6A 2BTFP 3BY9A 4S2IA 5HPFA 5DF7A 3DTEA 3NY4A 3MFXA 4FTXA 4ESPA 2PR5A 3PXPA 5FATA 2G2UA 4MBFA 2W27A 1SKOA 2EX6A 3RFBA 1LLBA 1G28A 3HUNA 3IX8A 3NBLA 5A92A 2UV0E 3HLFA 3UMDA 4Q0HA 4E3LA 4WF0A 1STZA 4IHQA 4BJPA 2Z2LB 5E43A 4KG2A 4R38A 3HLDA 3NECA 3RH8B 4GN2A 3UPNA 1OT9A 4Y2FA 4LV0A 4O8GA 3D72A 4OP5A 5FQMA 5FQJA 2P9VA 1ESUA 3TW8A 1CI8A 1D1JA 2JBFA 3M2KA 4X56A 4GS9A 3CPTB 2J7VA 3BJNA 1FSWA 1O7EA 4P6BA 2HF6A 3GECA 5DJUA 4LV3A 5EUAA 1TEMA 4XUXA 3U2AA 1KDWA 2HP6A 4DN0A 4BD0A 4A5RA 1BT5A 1OJ5A 1LL9A 1SKFA 5EVEA 3ZVWA 1DP9A 1OTAA 5FSRA 2W3GA 1ERMA 3BFFA 4Q0JA 3PAEA 3V3RA 2W3FA 2QMIA 3BWLA 1ZG6A 3OZHA 3UE6A 3OC2A 5E2HA 5GLDA 3BY8A 4ZJ1A 1S1YA 2HGVA 4KZ9A 3HREA 2H28A 4MLLA 4UHUA 5EOOA 2O9AA 2ZBBA 1K0KA 2WKEA 3T4QA 1HZOA 2XR0A 3EEHA 2PD8A 3P09A 3VFFA 1YMXA 3S7NA 3KSGA 2JKTM 2ZQAA 3E98A 2VGLS 3IH9A 4C3QA 5TBMA 2V0WA 3DTIA 3OPPA 2M7UA 2VGJA 4OONA 2OWHA 3MBZA 3N4IA 5KIZA 1VHMA 2LB5A 5F1FA 4R0QA 5CEDA 4CLCC 4I3JA 5G4YA 5GL9A 4HBTA 1JWVA 5CERA 2PD7A 1NZUA 2XH9A 3VV4A 1N9LA 2PBDP 1P0ZA 4DXBA 5AJGA 4B4ZA 2Y2OA 1BUEA 1KE4A 4JGRA 4HIAA 2QPNA 3UE3A 3Q07A 3ZVTA 1AXBA 4E3OA 4GHIB 4CQHA 4EESA 4P87A 2IWCA 4X55A 3MQ0A 5CGSA 4Z9QA 2W1TA
chains in the Genus database with same CATH topology
4QWOA 3KYEA 1CF0A 3LGOA 2VK3A 3T1RA 2JKGA 2BTFP 1Z09A 3DAVA 5EM0A 4FTXA 1VEUB 2V8CA 4ESPA 1PNEA 1K0KA 3L9KA 2PAVP 1FIKA 1SKOA 1FILA 4X1LA 5FEFA 4D60A 2HZ5A 1YPRA 4X25A 1ACFA 3L7HA 3CPTA 2ZL1A 5EV0A 3LEQA 3CHWP 1HLUP 1SZVA 1VETA 3MS6A 3NULA 3NECA 1SKOB 5FEGA 5FDSA 4FUWA 3T1SA 2V8FA 3T1QB 1J3WA 3D9YA 1F2KA 1CQAA 3T12B 3MSHA 1Y4OA 1D1JA 2JKFA 1PFLA 2PBDP 3CPTB 5EM1A 1G5UA 2ZL1B 4X1MA 2E8JA 1A0KA 3T1XA 1VETB 2PRFA 1AWIA 2B95A 3UB5P 1PRQA 1VEUA 2ACGA 5EVEA 1CJFA 3U4LP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QWO A;  3KYE A;  1CF0 A;  3LGO A;  2VK3 A;  3T1R A;  2JKG A;  2BTF P;  1Z09 A;  3DAV A;  5EM0 A;  4FTX A;  1VEU B;  2V8C A;  4ESP A;  1PNE A;  1K0K A;  3L9K A;  2PAV P;  1FIK A;  1SKO A;  1FIL A;  4X1L A;  5FEF A;  4D60 A;  2HZ5 A;  1YPR A;  4X25 A;  1ACF A;  3L7H A;  3CPT A;  2ZL1 A;  5EV0 A;  3LEQ A;  3CHW P;  1HLU P;  1SZV A;  1VET A;  3MS6 A;  3NUL A;  3NEC A;  1SKO B;  5FEG A;  5FDS A;  4FUW A;  3T1S A;  2V8F A;  3T1Q B;  1J3W A;  3D9Y A;  1F2K A;  1CQA A;  3T12 B;  3MSH A;  1Y4O A;  1D1J A;  2JKF A;  1PFL A;  2PBD P;  3CPT B;  5EM1 A;  1G5U A;  2ZL1 B;  4X1M A;  2E8J A;  1A0K A;  3T1X A;  1VET B;  2PRF A;  1AWI A;  2B95 A;  3UB5 P;  1PRQ A;  1VEU A;  2ACG A;  5EVE A;  1CJF A;  3U4L P; 
#chains in the Genus database with same CATH topology
 3HVF A;  4GOG A;  3Q1F A;  3KYE A;  3S7Q A;  2Y2H A;  2V0U A;  2ZQC A;  1GSX A;  1OTD A;  3OCL A;  3S7O A;  3O86 A;  1FCO A;  4R3A A;  3ZG8 B;  1ALQ A;  4RQ9 A;  3UDF A;  2XFS A;  1HD8 A;  3W2Z A;  3G6O A;  2VJW A;  3N7W A;  3FPV A;  1K25 A;  4E3I A;  2W3D A;  5I5L A;  3TE8 A;  3PBO A;  4PM8 A;  1XJ6 A;  1YPR A;  1Y54 A;  1BLH A;  2XDM A;  3BM6 A;  2WKI A;  1TS8 A;  3BFE A;  1C3B A;  3LIB A;  2QYB A;  2WGW B;  3PTE A;  4QY6 A;  5KSH A;  3KX0 X;  3G30 A;  3KSI A;  4GD6 A;  4EBN A;  1L2S A;  3MZE A;  3BLM A;  1IFQ A;  4NEE D;  3CWF A;  4KUO A;  3O5Y A;  1BSG A;  4FUW A;  3ZG7 B;  1MWR A;  2V8F A;  4OOL A;  3MQO A;  5HL1 A;  1ZC2 A;  3E4Q A;  3C4P A;  1BLS A;  4DF6 A;  1ES3 A;  1ES4 A;  2JKF A;  2XD5 A;  1DJC A;  2MJ6 A;  1BLC A;  5DTS A;  1W63 M;  4KQO A;  2CC1 A;  4XT2 A;  2A24 A;  2QWS A;  3DWK A;  2OSU A;  3IBR A;  1ES5 A;  5F6A A;  2KDK A;  5EVI D;  3U4L P;  3F1O B;  3F1P A;  3S4X A;  2ZQ7 A;  5HZH A;  3O88 A;  3UB7 A;  2Q0O A;  5BOH A;  4PKY G;  4X6T A;  1N9N A;  3AGE A;  2A3U A;  4OPZ A;  5JYO A;  2B18 A;  3DAV A;  2XA7 S;  3H82 B;  4KZA A;  1S4S A;  5HPI A;  2HDS A;  5GLB A;  3FZC A;  5CXW A;  4DDS A;  1PWC A;  4E3J A;  5DVA A;  1XA7 A;  4WM9 A;  1H0M A;  4U0T A;  2VZW A;  3IT9 A;  3V5M A;  1K4E A;  2KLI A;  5M1A A;  2HV1 A;  3UNW A;  3MJQ A;  5K5B A;  4HBU A;  2R9W A;  1FQG A;  4ARZ B;  5FI7 A;  1H3Q A;  5AVE A;  1KGE A;  2OOL A;  1Q2P A;  3UO9 A;  3CHW P;  3MR0 A;  2JE5 A;  1WYC A;  2PHY A;  2PU2 A;  4GDB A;  5J8X A;  4MMN A;  3C8C A;  2P7J A;  3AGF A;  4RVA A;  2O99 A;  3M2J A;  3O3V A;  2WGV A;  1BZA A;  5CHJ A;  2B5R A;  4NXB A;  1K6S A;  4LRX C;  2XF3 A;  2XD1 A;  3TRC A;  3KO6 A;  4HP9 A;  4NG2 A;  1YLZ A;  4QB8 A;  2Y59 A;  1YLJ A;  3SS4 A;  4XUZ A;  4E3N A;  1U60 A;  2C5W B;  5HAQ A;  3UE0 A;  3DBA A;  1WE4 A;  1CF0 A;  3MXS A;  4R70 A;  3LR0 A;  5CTM A;  5DF8 A;  4OQH A;  4Y0U A;  3ZGA B;  3LIE A;  5CEC A;  2WZX A;  4GDN A;  2Y91 A;  3KSH A;  2K2N A;  5HW3 A;  4HY8 A;  2M7V A;  1TS6 A;  2BAS A;  1ES2 A;  3WWX A;  4EBL A;  3PBR A;  3C38 A;  3OLO A;  1S1Z A;  3CZD A;  4GCZ A;  4QJG A;  2GZA A;  1TS0 A;  2XK1 A;  4O0P A;  4X1L A;  5AVF A;  3BFD A;  3VSK A;  1S67 L;  1P9R A;  3HUO A;  4ETZ A;  3JPU A;  5M18 A;  1T1B A;  4UA6 A;  4WMC D;  2Y2P A;  3PYP A;  3BLS A;  5DTK A;  2XRO A;  3TG9 A;  4FD8 A;  1K56 A;  2L4R A;  4HOI A;  4UAA A;  1SZV A;  3I7J A;  1N9O A;  4FCF A;  1MC0 A;  1NRF A;  2JKT I;  3OPH A;  5KSC A;  3ITB A;  3T1Q B;  3V3S A;  3UPO A;  2Y2J A;  3DTK A;  5F68 A;  3GMW A;  5AQA A;  2EWV A;  1CQA A;  4IJG A;  2P74 A;  3IWI A;  5CRF A;  2PT7 A;  4CLC D;  4EUV A;  1G5U A;  1FCN A;  4P6Z S;  3LY4 A;  4LRZ E;  3T1X A;  2WK0 A;  3OPL A;  3T4L A;  3R4K A;  1SDN A;  1PRQ A;  3GVB A;  3G2Y A;  4M4X A;  4RX2 A;  3IX3 A;  1CI9 A;  5EVL A;  1SCW A;  3ZHH A;  2VKS A;  5U47 A;  4KZ3 A;  2XRN A;  4F94 A;  4YOF A;  3FKW A;  3PBT A;  2W0N A;  4KQR A;  4LCL A;  4PKY A;  5FQQ A;  4I3A A;  4H8R A;  2INW A;  4S2M A;  2HDQ A;  3C2W A;  5HAR A;  3LEZ A;  3SH8 A;  2GJ3 A;  1PI4 A;  4UEY A;  2ZC6 B;  2V9A A;  2B02 A;  3BQ8 A;  3IBJ A;  1ZG4 A;  5GHX A;  3NOU C;  4I38 A;  3CPT A;  1NLZ A;  1PWG A;  1P97 A;  1EWZ A;  3UDI A;  4JXS A;  4B9O A;  5F5Y A;  3IF6 C;  1EI5 A;  1MZU A;  4ZDX A;  2C6W B;  3DW0 A;  2ZC4 B;  4FSF A;  1GA9 A;  3VSL A;  4ZAM A;  4L9G A;  1JTG A;  5HAP A;  1VQQ A;  2GDN A;  3VOY A;  4NKP A;  4OOM A;  5IS1 A;  1L0F A;  3HUM A;  4HH2 A;  3IS2 B;  3BFG A;  1OJG A;  4WEL A;  2RCX A;  4DE1 A;  4X1M A;  4KZ7 A;  2PYP A;  3FV7 A;  1K57 A;  1EW0 A;  2ZMA A;  4WZ5 A;  3NDE A;  5TGF A;  2Y4A A;  2Q9M A;  4DJ2 A;  2NUP C;  3IHB A;  1H5X A;  2P08 A;  3EGX C;  5CGW A;  4YWZ A;  3C7U A;  2ZQD A;  3E0Y A;  3SZT A;  2VEA A;  4JPM A;  4DDY A;  4ZJ3 A;  1D06 A;  4CLC B;  3EOI A;  4R4S A;  2ZM0 A;  2H10 A;  4K0X A;  4LRY C;  4Q0I A;  3LID A;  1XJ3 A;  2VV7 A;  3S7P A;  2ZD8 A;  1CK3 A;  4S2N A;  4D60 A;  1SDE A;  1W5D A;  3JVU A;  2WAF A;  2Q9N A;  3DWZ A;  1SHV A;  1KVM A;  1OTE A;  1W8Q A;  5AQB A;  4L9E A;  5AQ7 A;  4GLQ A;  3F1N A;  4PM9 A;  2DCF A;  4S2J A;  3KSF A;  3MZF A;  3GSG A;  3QP1 A;  4PM7 A;  4Z1W A;  1NRJ A;  2ZM8 A;  1YSQ A;  2RL3 A;  1OPX A;  5E2E A;  3IF5 A;  4GHI A;  3ZNT A;  4UQI M;  2YKH A;  4OOY A;  1DP6 A;  2W3H A;  3IXG A;  1NYM A;  1T1C A;  3EQV A;  4H6J B;  4WYY A;  1LT0 A;  3JYI A;  2G7U A;  5A8B A;  3UB9 A;  1VET B;  3T4S A;  5C5K A;  1FCM A;  3LO7 A;  3E2L A;  3JVV A;  5EE8 A;  4MBH A;  4JBF A;  4R3B A;  4S2O A;  3FWL A;  4WLA A;  3UPP A;  3VE4 A;  3P01 A;  5HWV A;  5I94 A;  1XJ4 A;  3W8K A;  3CUE A;  2K7S A;  3TJZ C;  4GD8 A;  4CLC E;  3LIC A;  4YIN A;  3G34 A;  4WL9 A;  3LY3 A;  2HPB A;  3WRT A;  4N9L A;  4E04 A;  2WGW A;  3FPW A;  5EM0 A;  4DE0 A;  1IYO A;  2X71 A;  3VP3 A;  3HLC A;  5TJJ A;  3QP2 A;  3A3J A;  4II7 A;  1G6A A;  1RCJ A;  3QP4 A;  5L09 A;  1M40 A;  2H0T A;  3QP5 A;  4EQI A;  1IKG A;  4HHD A;  3IWO A;  1K57 C;  2KOI A;  4X25 A;  1ACF A;  2GNX A;  2Y8H A;  3V39 A;  3IX4 A;  3OOV A;  4F3L B;  4G3K A;  5EEC A;  1YMS A;  2EXA A;  2V1Z A;  3CG5 A;  4HEF A;  4EET B;  4KQQ A;  2PR6 A;  1LHY A;  3BEC A;  1NLY A;  3F1O A;  4JF4 A;  1OTI A;  2ZLY A;  4OQG A;  2ZJ9 A;  1PZO A;  1LI0 A;  3MMH A;  3IWQ A;  3ZG9 B;  2EWW A;  5FAQ A;  3KYQ A;  4GNU A;  4EU0 A;  4JKT A;  3H82 A;  3UB5 P;  2Y2I A;  4R3J A;  3GDI A;  4JGQ A;  4BMW A;  2HJE A;  4HI4 A;  4LEN A;  3IXB A;  3HLG A;  2EXB A;  3A3E A;  1L0D A;  3NJA A;  3LGO A;  3NCK A;  4OP8 A;  1ESI A;  3G2Z A;  1T18 A;  2JKG A;  5HDC A;  3CI6 A;  4ARZ A;  4LGW A;  2KX6 A;  2QJ7 A;  4HJ4 A;  4N1H A;  4LLO B;  4WEK A;  2JKR M;  4IUH A;  3HJI A;  3FKV A;  3BEB A;  1NYY A;  3IQA A;  3BRM A;  5FQK A;  5HWW A;  1V9Z A;  5G18 A;  4N92 A;  1O07 A;  4JGO A;  1K6R A;  1TDG A;  5FEF A;  2ZMF A;  3WS5 A;  3VP1 A;  1F5M A;  3N8R A;  3MZD A;  2GX5 A;  3IXD A;  1RP5 A;  5IHV A;  4FOF A;  2V2F F;  3A3D A;  1ERQ A;  1I2S A;  1OTB A;  1W7F A;  3NHQ A;  1K54 A;  5EOE A;  3WS2 A;  3BQA A;  4BL2 A;  3RXW A;  3SW1 A;  3NOP C;  4GW9 A;  4JGP A;  3PAG A;  1JVJ A;  3E4P A;  3TOI A;  1XP4 A;  4MDZ A;  3CUE C;  4Y13 A;  3D9Y A;  1W8Y A;  1Y4O A;  2UWX A;  1E3U D;  3LR5 A;  3K2N A;  4BBV A;  3Q81 A;  5FI2 A;  2ZL1 B;  1K38 A;  2E8J A;  2J8Y A;  1ODV A;  4DMZ A;  5FAO A;  3HLW A;  2B95 A;  3ZG0 A;  1H8Y A;  3R7W B;  2ACG A;  1XFN A;  5DKL A;  1KGG A;  2VV6 A;  1MXO A;  3H7W B;  3QP6 A;  3A3I A;  4OPQ A;  5HSQ A;  5DJT A;  2Z2M B;  3ITA A;  3CJM A;  3HLB A;  3A3F A;  2Y55 A;  4RA7 A;  3P7N A;  3VP0 A;  1K56 D;  4HJ6 A;  5D3O A;  2FFF B;  1ZHH B;  3G32 A;  4ZTK A;  2FZ0 A;  1L0E A;  1PW1 A;  1KGF A;  3L9K A;  1BLP A;  2VV8 A;  2EFU A;  2PAV P;  1FIK A;  3OPR A;  2J3W A;  1DP8 A;  4EWF A;  2EFX A;  2H5S A;  4LV1 A;  5F1G A;  2OLV A;  2QHK A;  4I39 A;  1CEF A;  1PZP A;  1TDL A;  3ISG A;  1NXY A;  1G68 A;  5F83 A;  1T1A A;  3B3X A;  1UWP X;  2ZC5 B;  3G31 A;  5CHM A;  1W63 Q;  3Q82 A;  1BYW A;  4MNR A;  1K4F A;  1HLU P;  2BG1 A;  3C5A A;  3HLE A;  4BBU A;  1OME A;  3NC8 A;  5EVI B;  3N8S A;  2J9P A;  5KZH A;  4S2P A;  1MY8 A;  1L0G A;  1FOF A;  1PFL A;  3NDG A;  3C4O A;  1N9B A;  3BYD A;  1NJ4 A;  2EX9 A;  5HD5 A;  1FSY A;  4EBP A;  3V67 A;  5KMW A;  4ME4 A;  2DRW A;  3A0V A;  1AWI A;  3QNB A;  2XQZ A;  3ZFZ A;  1XGI A;  3A0R A;  5CEB A;  3QHY A;  5MC7 A;  1DRM A;  4OPR A;  5HX9 A;  1TS7 A;  4FH4 A;  1N4O A;  1MWS A;  2ZC3 B;  3IF6 B;  3S22 A;  4WN5 A;  3PR6 A;  3ZYT A;  1K54 C;  3T4K A;  3CMZ A;  3Q7V B;  4MBK A;  1F9I A;  3QP8 A;  4IBX A;  4K91 A;  4NXF A;  4Y5F A;  1XGJ A;  2X02 A;  1TD5 A;  4IBR A;  4IED A;  4G3W A;  1PNE A;  3C7V A;  4EUZ A;  3O87 A;  4PMA A;  1XJ2 A;  2Z6D A;  3RJU A;  4DE2 A;  2ZM2 A;  1DJA A;  3FG8 A;  3LR4 A;  4EW7 A;  1UWN X;  4PM5 A;  3C30 A;  2X01 A;  3IS2 A;  4WUJ A;  4LPZ A;  3LIA A;  3MKF A;  3D4F A;  4WMC A;  4RX3 A;  2O9C A;  2VX8 A;  1IOU A;  1M6K A;  2Y79 A;  4NXE A;  5HD3 A;  1J3W A;  4QU3 A;  2DMW A;  2LB9 A;  4EEU A;  5L2F A;  1LSX A;  2EX2 A;  3G4P A;  4JXV A;  3PHY A;  3VMA A;  4S2L A;  4PAU A;  2R9X A;  4MEZ A;  4CLC A;  1T19 A;  1MKM A;  2OAQ 1;  4MN5 A;  4OQI A;  3GR2 A;  4JLF A;  4KZ5 A;  3VOL A;  2WKH A;  4HQA A;  4R6L A;  3MKE A;  3E4O A;  3B42 A;  5FAP A;  1DJB A;  2O0Y A;  2I9V A;  2XFT A;  3S1Y A;  2Y2G A;  5AQ9 A;  1GA0 A;  3CIT A;  1S4R A;  4KZ4 A;  2FH5 A;  3LUQ A;  2R78 A;  3GRJ A;  3ZDJ A;  5M19 A;  2WKQ A;  2Z6C A;  1H8Z A;  3E2K A;  4I5S A;  3SS3 A;  3G35 A;  3K3C A;  1VEU B;  4KEN B;  4R4R A;  2V8C A;  2Y2Q A;  1Y28 A;  3CAX A;  3EQU A;  5GHZ A;  1J9M A;  4K08 A;  2BLS A;  4XXR A;  1YLW A;  3LI9 A;  4UA9 A;  1WA9 A;  4MCW A;  3WS0 A;  2FFY A;  2ZC7 A;  1ERO A;  2HDR A;  1KDS A;  3UME A;  1NZO A;  4BQM A;  4KZB A;  4LFU A;  4HP4 A;  4H6J A;  1S6R A;  1YKD A;  2JKR I;  3IH8 A;  4B4X A;  4X69 A;  3KYZ A;  4P0M A;  1YLT A;  5EV0 A;  3V50 A;  1VET A;  3MS6 A;  1SKO B;  3OBF A;  1GSW A;  3LR3 A;  4KZ8 A;  4E6X A;  3H9W A;  3W4Q A;  3EEA A;  3D3O A;  5TFQ A;  4ZJ2 A;  4QD4 A;  1KE0 A;  4P6Z M;  3BW6 A;  3T12 B;  1Q2Q A;  1OT6 A;  4CJN A;  3UY6 A;  3ZCZ A;  3QNC A;  1A0K A;  4OLG A;  3VP2 A;  1GHI A;  5A93 A;  2XEP A;  3Q7Z A;  1BTL A;  1ONH A;  1Z6F A;  1JNU A;  3M6H A;  1IYP A;  2WKR A;  1LSW A;  3LI8 A;  3T4T A;  4AFI A;  3A0S A;  2P9V B;  3MXQ A;  5HDD A;  2IWD A;  3WS1 A;  2DNS A;  1GHM A;  1V9Y A;  4GS9 B;  2AVX A;  4NET A;  5HAI A;  1HVB A;  3T1R A;  1TVF A;  4BD1 A;  4IUK A;  4NXG A;  4OPY A;  4MN6 A;  1ONG A;  1Z09 A;  2I72 A;  2V20 A;  4JF6 A;  3LCE A;  5GLA A;  2J3T C;  2HDU A;  1GHP A;  5FI6 A;  1JWZ A;  1FR1 A;  1KVL A;  1YSP A;  4F3L A;  4EEP A;  4I3I A;  3B33 A;  4MN7 A;  1WYB A;  5IT5 A;  2V1B A;  4Y7P A;  1FR6 A;  2O9B A;  4IVI A;  3SOI A;  4HJ3 A;  2J9O A;  5E2G A;  3LFV A;  5J3W A;  4BBT A;  1W79 A;  3F1N B;  1YT4 A;  4EER A;  1YQS A;  1E25 A;  4K0W A;  5HFO A;  1JWP A;  1RGZ A;  2ZMV A;  2W3E A;  5DFX A;  3UB8 A;  4YFM A;  4O7D A;  4IVK A;  2YKF A;  5CTN A;  3T1S A;  1LL5 A;  4Q8I A;  4WZ5 C;  1IYS A;  4R23 A;  4BEN A;  3MSH A;  4KQD A;  3PBS A;  5TBM B;  1IEL A;  2JHE A;  1XFQ A;  1XPB A;  1JTD A;  3LIF A;  2L1M A;  2OLU A;  2IA2 A;  4B88 A;  4E3M A;  3WS4 A;  3SS5 A;  4QPR A;  4D2O A;  2HP9 A;  5J4E A;  4OVD A;  2WUQ A;  3ZG5 A;  5HL6 A;  1CJF A;  4PM6 A;  3IHA A;  1MWU A;  4GB7 A;  4ID4 A;  5DTT A;  5F69 A;  3N8L A;  1F98 A;  4YNR A;  1K55 A;  4N9K A;  5HWT A;  1PIO A;  3PBN A;  4GKU A;  2WAE A;  3GTC A;  4O01 A;  4S2N C;  4DJ3 A;  2V1A A;  2WGI A;  4P85 A;  1KOU A;  2HP5 A;  1YAX A;  4ZBE A;  2W1T B;  3DTM A;  1S0W A;  1YLP A;  4BLM A;  3LYX A;  4M3K A;  2Y2M A;  2WAD A;  1H8M A;  3ULF A;  1CEG A;  4B93 A;  3MXR A;  3RTY A;  1L3L A;  2ZQ8 A;  2M1C A;  2E8I A;  3ZQ5 A;  1MKI A;  3EWK A;  2ZL1 A;  4RYE A;  3VE3 A;  3VP4 A;  1I5Q A;  4OQ0 A;  1ZTU A;  5CGX A;  4L9F A;  2OAP 1;  2JN7 A;  2VGL M;  4Y17 A;  5FEG A;  2XLN A;  3T4O A;  4ETX A;  3P98 A;  4X53 A;  5FA7 A;  3R7W A;  2XSS A;  3T50 A;  3AGD A;  3SH9 A;  3ICY A;  4HH3 A;  5DF9 A;  1F2K A;  3H7W A;  1KE3 A;  2QJ5 A;  4EQ1 A;  3GQZ A;  3M6B A;  2XGN A;  3HL9 A;  3CLO A;  1MBL A;  2VLG A;  1HTZ A;  5FDH A;  5CX7 A;  4KG5 A;  4DKI A;  4JF5 A;  2ZOI A;  4JXW A;  2CMN A;  2L0W A;  3ZNY A;  5G4Z A;  5DKK A;  1GCE A;  4WBG A;  5J7E A;  2WYX A;  3FC7 A;  5E2F A;  5CHU A;  3OCN A;  4XT2 B;  2A24 B;  4WZ4 A;  3SH7 A;  1PW8 A;  3TSG A;  1XX2 A;  1GSV A;  4HNB A;  3UDX A;  5A91 A;  3MF0 A;  1PWD A;  2NUT C;  2PU4 A;  4U3T A;  2QZ6 A;  5GLC A;  4E6W A;  3F1P B;  5A90 A;  5EVI A;  3MQQ A;  4R1G A;  4DRT A;  3HCY A;  2Y2L A;  4HES A;  1XKZ A;  1LL8 A;  2P04 A;  1VB6 A;  2VA0 A;  4L0L A;  2IWB A;  3HJK A;  5TR7 A;  1LI9 A;  3LEQ A;  3VOZ A;  4S2K A;  1NWZ A;  3FYZ A;  3NUL A;  1I2W A;  4OKP A;  5FQ9 A;  5FQI A;  2OWJ A;  2QKP A;  5FDS A;  2PDR A;  4QHC A;  2JC7 A;  1K55 C;  3B47 A;  3UN7 A;  2D02 A;  4BL3 A;  2WKP A;  3HBR A;  3IF6 A;  5DFY A;  2ZOH A;  2OV5 A;  4PHT A;  1E3U A;  3T4J A;  4U0X A;  4DE3 A;  3Q7V A;  4C75 A;  1D7E A;  5HDS A;  4G3V A;  2PRF A;  4WEJ A;  5L07 A;  3NOT C;  2EA9 A;  5GHY A;  2PBY A;  1BUL A;  1E4D A;  1ZKJ A;  1QMF A;  1XA1 A;  1TF1 A;  1UGU A;  2D01 A;  3PBQ A;  2EX8 A;  1DY6 A;  3IXH A;  5EFW A;  3UB6 A;  4OLD A;  4KUK A;  2VK3 A;  3VFH A;  2Y2N A;  2Y2K A;  2VGK A;  3WRZ A;  5IU1 A;  4JXG A;  3N6I A;  4Y3I A;  1IEM A;  4UA7 A;  4BWI A;  4C6Y A;  2W1R A;  2J3T D;  3W4P A;  1QME A;  4Y15 A;  3EGD C;  1FIL A;  2XA7 M;  1NY0 A;  5FL3 A;  3K3D A;  3UE1 A;  5L8M A;  4QY5 A;  4Y0O A;  2HZ5 A;  3RXX A;  4EXO A;  1MPL A;  2ZQ9 A;  4GZB A;  3L7H A;  1RGY A;  4DXC A;  1YM1 A;  1YLY A;  4EV4 A;  4GJ4 A;  4OH0 A;  2K31 A;  1PYY A;  1G6O A;  3W4O A;  1X0O A;  2A2L A;  5EPH A;  5LBR A;  1PI5 A;  4LCM A;  5F82 A;  1P9W A;  5FAS A;  5L10 A;  4KZ6 A;  4E3K A;  3GV9 A;  4LV2 A;  4UQI S;  4PPR A;  5EM1 A;  4N1X A;  1MWT A;  4X68 A;  1S66 L;  2HJ9 C;  3NI9 A;  5JYP A;  5EVI C;  4NK3 A;  1XXM A;  2A49 A;  2WZZ A;  3NIA A;  1VEU A;  2H0Y A;  2J80 A;  1LSV A;  4FH2 A;  2JCH A;  4QWO A;  4Y0T A;  4CPK A;  1IKI A;  4ZRR A;  2G2W A;  1IYQ A;  3BFC A;  1VM1 A;  2PYR A;  3MFD A;  4KG6 A;  2BTF P;  3BY9 A;  4S2I A;  5HPF A;  5DF7 A;  3DTE A;  3NY4 A;  3MFX A;  4FTX A;  4ESP A;  2PR5 A;  3PXP A;  5FAT A;  2G2U A;  4MBF A;  2W27 A;  1SKO A;  2EX6 A;  3RFB A;  1LLB A;  1G28 A;  3HUN A;  3IX8 A;  3NBL A;  5A92 A;  2UV0 E;  3HLF A;  3UMD A;  4Q0H A;  4E3L A;  4WF0 A;  1STZ A;  4IHQ A;  4BJP A;  2Z2L B;  5E43 A;  4KG2 A;  4R38 A;  3HLD A;  3NEC A;  3RH8 B;  4GN2 A;  3UPN A;  1OT9 A;  4Y2F A;  4LV0 A;  4O8G A;  3D72 A;  4OP5 A;  5FQM A;  5FQJ A;  2P9V A;  1ESU A;  3TW8 A;  1CI8 A;  1D1J A;  2JBF A;  3M2K A;  4X56 A;  4GS9 A;  3CPT B;  2J7V A;  3BJN A;  1FSW A;  1O7E A;  4P6B A;  2HF6 A;  3GEC A;  5DJU A;  4LV3 A;  5EUA A;  1TEM A;  4XUX A;  3U2A A;  1KDW A;  2HP6 A;  4DN0 A;  4BD0 A;  4A5R A;  1BT5 A;  1OJ5 A;  1LL9 A;  1SKF A;  5EVE A;  3ZVW A;  1DP9 A;  1OTA A;  5FSR A;  2W3G A;  1ERM A;  3BFF A;  4Q0J A;  3PAE A;  3V3R A;  2W3F A;  2QMI A;  3BWL A;  1ZG6 A;  3OZH A;  3UE6 A;  3OC2 A;  5E2H A;  5GLD A;  3BY8 A;  4ZJ1 A;  1S1Y A;  2HGV A;  4KZ9 A;  3HRE A;  2H28 A;  4MLL A;  4UHU A;  5EOO A;  2O9A A;  2ZBB A;  1K0K A;  2WKE A;  3T4Q A;  1HZO A;  2XR0 A;  3EEH A;  2PD8 A;  3P09 A;  3VFF A;  1YMX A;  3S7N A;  3KSG A;  2JKT M;  2ZQA A;  3E98 A;  2VGL S;  3IH9 A;  4C3Q A;  5TBM A;  2V0W A;  3DTI A;  3OPP A;  2M7U A;  2VGJ A;  4OON A;  2OWH A;  3MBZ A;  3N4I A;  5KIZ A;  1VHM A;  2LB5 A;  5F1F A;  4R0Q A;  5CED A;  4CLC C;  4I3J A;  5G4Y A;  5GL9 A;  4HBT A;  1JWV A;  5CER A;  2PD7 A;  1NZU A;  2XH9 A;  3VV4 A;  1N9L A;  2PBD P;  1P0Z A;  4DXB A;  5AJG A;  4B4Z A;  2Y2O A;  1BUE A;  1KE4 A;  4JGR A;  4HIA A;  2QPN A;  3UE3 A;  3Q07 A;  3ZVT A;  1AXB A;  4E3O A;  4GHI B;  4CQH A;  4EES A;  4P87 A;  2IWC A;  4X55 A;  3MQ0 A;  5CGS A;  4Z9Q A;  2W1T A; 
#chains in the Genus database with same CATH homology
 4QWO A;  3KYE A;  1CF0 A;  3LGO A;  2VK3 A;  3T1R A;  2JKG A;  2BTF P;  1Z09 A;  3DAV A;  5EM0 A;  4FTX A;  1VEU B;  2V8C A;  4ESP A;  1PNE A;  1K0K A;  3L9K A;  2PAV P;  1FIK A;  1SKO A;  1FIL A;  4X1L A;  5FEF A;  4D60 A;  2HZ5 A;  1YPR A;  4X25 A;  1ACF A;  3L7H A;  3CPT A;  2ZL1 A;  5EV0 A;  3LEQ A;  3CHW P;  1HLU P;  1SZV A;  1VET A;  3MS6 A;  3NUL A;  3NEC A;  1SKO B;  5FEG A;  5FDS A;  4FUW A;  3T1S A;  2V8F A;  3T1Q B;  1J3W A;  3D9Y A;  1F2K A;  1CQA A;  3T12 B;  3MSH A;  1Y4O A;  1D1J A;  2JKF A;  1PFL A;  2PBD P;  3CPT B;  5EM1 A;  1G5U A;  2ZL1 B;  4X1M A;  2E8J A;  1A0K A;  3T1X A;  1VET B;  2PRF A;  1AWI A;  2B95 A;  3UB5 P;  1PRQ A;  1VEU A;  2ACG A;  5EVE A;  1CJF A;  3U4L P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...