2PRSA

Structure and metal binding properties of znua, a periplasmic zinc transporter from escherichia coli
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
284
structure length
263
Chain Sequence
AVVASLKPVGFIASAIADGVTETEVLLPDGASEHDYSLRPSDVKRLQNADLVVWVGPEMEAFMQKPVSKLPGAKQVTIAQLEDVKPLLMKGDFNMHLWLSPEIARATAVAIHGKLVELMPQSRAKLDANLKDFEAQLASTETQVGNELAPLKGKGYFVFHDAYGYFEKQFGLTPLGHFTVNPEIQPGAQRLHEIRTQLVEQKATCVFAEPQFRPAVVESVARGTSVRMGTLDPLGTNIKLGKTSYSEFLSQLANQYASCLKGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and metal binding properties of ZnuA, a periplasmic zinc transporter from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal transport
molecule keywords High-affinity zinc uptake system protein znuA
total genus 92
structure length 263
sequence length 284
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2prsA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2prsA02
2ETVA 5CR9A 2MINA 5KHLB 5JJ5A 2PS9A 3MWGA 3AEKA 2MINB 4NNOA 2AFIB 2WI8A 3EIWA 4WNAB 3TEFA 3LHSA 2PHZA 3U7QB 3GI1A 4FI3F 3U7QA 4TKUB 4HMPA 2PRSA 2XV1A 5FLYA 3HJTA 1N2ZA 3AETB 3G9QA 4OVKA 3MINB 5JOQA 5BVGA 4MDYA 2XQVA 1K7SN 3K1AB 3R5TA 1M1NA 4LS3A 1H1LA 3AEQB 4N01A 5B58T 5M29A 2XDQA 4XPIA 2M6KA 1G21A 4HMQA 3ZTTA 5KOJB 2Q8PA 1MIOB 3MINA 4FNAA 2OV3A 4OXQA 3CX3A 5GGYA 4UTOA 1N4AA 4NNPA 2PS0A 2XH8A 5M34A 1N2CA 4WESA 4TKUA 1KARA 3AERA 5JPDA 5KOHA 5BVGB 4UDOA 3R5SA 4MO9A 4WN9B 3TNYA 2XUZA 4LJSA 1QH8B 4PAGA 4H0FA 3AEKB 3AEUB 3MFQA 3BE5A 4WZBA 4WZBB 2YNMC 1K75A 1M1YA 1L5HB 1EFDN 1QGUA 4DBLE 5BVHB 2X4LA 2XY4A 4ND8B 1N2CB 1L5HA 4CL2A 5CX1B 5JG7A 4HMOA 2O1EA 4FILA 3AESB 1G20A 3AESA 2WHYA 4GICA 4TKVB 3NU1A 5I4KA 3EIXA 3PDIA 4HN9A 3ZKAA 1FP4B 1FP4A 1PSZA 3ZK7A 2QI9F 1XVLA 2OSVA 3HXPA 4K3VA 4H59A 3BE6A 1TOAA 1KAEA 1QGUB 1M1YB 2PS3A 4MX8A 3UJPA 3TLKA 5AFSA 5HX7A 2RG7A 3PSAA 2AFHB 2XDQB 1QH1A 3HH8A 3AETA 1ESZA 3LI2A 4B8YA 4WN9A 1M34B 4INPA 5HDQA 4UDNA 4FKMA 4WZAB 3AERB 3PDIB 2M6LA 4MLZA 5BVHA 4PM4A 1PQ4A 2AFIA 4WNAA 4M7OA 2OGWA 2R7AA 4BBPA 5CX1A 3ZK8A 4G07A 4WESB 4ND8A 4XPIB 3MWFA 5KOHB 1KAHA 4WZAA 5GGXA 1M34A 1K0FA 1M1NB 2Q8QA 4OXRA 1QH1B 2OV1A 1K2VN 1MIOA 4INOA 4IRMA 2AFHA 2YNMD 3AEUA 5M2QA 4TKVA 1QH8A 1G21B 5KOJA 3MD9A 4G09A 4UTPA 2R79A 1N4DA 3K1AA 5M3BA 1H1LB 3AEQA 3ZK9A 3PSHA 1G20B
chains in the Genus database with same CATH superfamily
4X65B 3CLHA 3I04A 1SOWA 1K98A 5D5HA 1E6UA 3AC0A 3I28A 5J2TB 2I7CA 3EG9B 1VSUA 3HL0A 2NU8A 3O9ZA 4EA9A 2BH2A 1RM4A 1W87A 3D43A 16PKA 3ZWNA 2EU8A 4BE4A 2MSCB 3FGZA 1MT3A 5A1JA 3GCZA 4RMNA 2ZJ2A 1KYIA 3QIAA 3SBDA 5FLYA 1MR3F 2VTDA 1G98A 3F7NA 3FFXA 4QRDA 2R4QA 5DHSA 3RYCA 3U9SA 3PNPA 3VU9A 1QHXA 3EWSA 3NEYA 4YBRA 1OXSC 1PL8A 1O6ZA 1EA5A 1USUA 2VJOA 2NO0A 1WW3A 1G8FA 2DHEA 3L06A 4H7PA 5P21A 5K6TA 5IPFA 1O94C 3E5MA 4HAZA 3OFVA 3WRWA 2PCJA 3CZQA 4K1LA 1Q11A 1U5BB 3OQJA 1XEWX 2D5LA 1CKEA 2MTBA 2AUNA 2FHPA 2J41A 3GMSA 3P0RA 3KFXA 3AG6A 3UV3A 3PEWA 3OTOB 3QVMA 2NYVA 1Z2CA 2ZE6A 4KMRA 3ZGZA 5JAHA 2IHNA 1ZD1A 1X80A 3EVFA 1XTJA 3ZU2A 3RTEA 5DIFA 1U28A 1G21E 2GZSA 3FPEA 4V0ME 4Z4FA 1ZK3A 5SZKB 5CFOA 1CUIA 1E4OA 2IVFA 3NEPX 2GHQA 4OHOA 4UXIA 5BVGB 5JRZA 1EDEA 3NDPA 2D3WA 1G19A 4RKEA 4GRIA 1EWRA 3MHPA 1C3OA 1LPNA 2QN8A 3N2EA 2DXIA 1FZTA 3JZMA 1L8AA 4NEHB 3LKDA 1RKBA 4BGVA 5B30A 2QK4A 2JBHA 4EUSA 1QIKA 2NTYC 2PKQO 1JLLA 3INNA 2KHZA 4CF3A 3EQ2A 1H6BA 4IOMA 5B6IA 5B1YA 2XUGA 5BV8A 5IJ0B 3KKZA 4HP8A 3TL3A 4WE3A 4A36A 4KI7A 5A6SB 1NN1A 3BYZA 3EIXA 5CGQB 3PWZA 3G5LA 1QHIA 4RZQA 1UBJS 1WM1A 4QARA 4MI1A 4YV7A 5HPYB 4EVSA 2OSVA 1EWYA 2W5UA 4LCBA 4NFHA 1LJUA 1LBTA 3I2FA 4OU5A 3IP3A 2ZUCA 4ANFA 3EYWA 2R8EA 4CG2A 2AFHB 3C3YA 2C0PA 4JYPA 3U09A 4AAYA 4FHGA 4OP3A 1YZ3A 3QUAA 1LVHA 1G5PA 3CTMA 2GEVA 4EYGA 3DOHA 4FZVA 2JJYA 3RNLA 4GH5A 4DWWA 3C7DB 3OJLA 2JBAA 4V0SA 4FWTA 2JIZA 3INRA 3TEJA 1GPDG 4L08A 3UKOA 1KK0A 2EJTA 3DAHA 2V7XA 1SVSA 4P4GA 3UT0A 4LRYA 3TECE 3SZ3A 1KXZA 2GARA 3K6SA 4BFLA 1FBNA 1DXQA 1RMTA 3CBQA 2H7XA 2KMLA 2O8NA 3CUUA 3FFWA 4GLOA 5ICFA 3WL8A 2P3LA 3EFOB 3FWKA 1MAAA 1MEJA 3TEMA 5L3SB 2YJTD 721PA 1BXGA 1Z73A 1ZVKA 3QPAA 4L9SA 4CQNA 3P5SA 4BS9A 1CRZA 1FYEA 3OOYA 5LZ2A 2FOIA 2VQDA 2RAFA 1SOAA 4JDUA 2R66A 5LLTA 1VJRA 3D6MA 1QRDA 4EB6A 2UDPA 1CE8B 3T95A 3TMAA 5CDHA 3QA9A 4M22A 4DSTA 3GPIA 1NUAA 3IEUA 3PUYA 1EXDA 2YDYA 5E1MA 4A9AA 2WFLB 1HYQA 1OH6A 4XRRA 4O2BF 1CWUA 4JJZA 2ZZNA 1HEIA 3IV7A 5HZHA 3E27A 2IZ0A 4NESA 3FTFA 6REQA 2DQKA 2H1RA 3QTTA 1WSAA 5EJ5A 4OH7A 4QECA 1TU3A 3BB3A 1M7BA 2XMGA 4TVKA 3O75A 4MITA 5KC8A 1TZJA 3D3QA 3OIUA 4Q4LA 2JVJA 3GYGA 4YQYA 3UNXA 4NBNA 5K99A 3SZOA 1RXSA 4H7HA 1N78A 1R7RA 5HE9A 5HUJA 4WOKA 2R25B 3ACCA 3M33A 2TMKA 4WGFA 5BN4A 3A4VA 5EJ7A 4DBZA 4Q24A 1KQPA 4GOKA 3ZHBA 5CNKA 4L75A 5JH7A 4LNHA 1Z0IA 2JJ1D 2Q5EA 2H8GA 2B37A 2OC9A 3PC8A 1QB7A 1ADBA 1ENZA 3AR9A 3JAWA 1QZTA 2H06A 5IFKA 5AI5A 3ZWBA 1RJWA 1UBFA 4RA6B 3ROFA 5EZQA 3WBFA 1W0JD 2O5CA 1BS2A 1KO1A 2FG6C 1A9TA 3MM4A 1T3GA 1V7ZA 3PDJA 4QVGA 4R1QA 4ZAZA 5KHAA 1XB2A 2PLRA 2TYSB 3BAFA 2XGMA 2AD1A 2X5JO 4ND1A 4Q18A 4QFMA 1RACA 4OB7A 4DY4A 4BY9E 2RKBA 1T3LA 2ZETA 2W2MA 4CNBA 5HFAA 4TV9A 4OMUA 3SQNA 4U7FA 2CZGA 3P96A 5KNBH 3JALA 2FPXA 5CLIA 2ZUDA 3BE5A 4O29A 2OD9A 4UFPA 3L7YA 5DT9A 3EWIA 3FSJX 1RHUA 2VDPB 4G4JA 4ARVA 1NUQA 1B26A 4ZODA 2NQTA 4KWTA 3KLNA 1BDHA 5L95A 3O1LA 2EL9A 4UTZA 3O92A 4YP0A 4M1SA 1FDUA 1YS9A 2RHJA 1P3Y1 4F46A 4TRJA 1NNI1 2DFVA 2WP0A 5DNDA 3GDWA 1JDJA 2OT3B 4YHBA 4CEJA 4Q9AA 3GT3A 4JAVC 2P65A 3GLHE 1A9OA 4FEYA 4C05A 1R0ZA 2QMZA 2I3AA 2EV9A 3L0DA 5AJXA 4ZYXA 2XMCA 4YCLA 2B94A 5ICEA 4Q37A 3KEFA 2HR1A 4DYVA 4BC0A 5JVDF 1OFHA 1TRHA 4LZPA 1DELA 1Z36A 2G06A 2Q9CA 1ZIPA 2Q46A 2ZITA 3KOMA 5KMGB 5TIIA 1VFNA 1PFGA 2G28A 2ZTVA 4PSUA 4F4DA 3ODPA 2DLCX 1QZUA 1JFRA 1QIFA 4IDHA 3UUGA 5B57C 1SGWA 1W94A 3TXYA 1FTQA 1LB1B 1FTNA 1WA5A 2E1RA 4GBMA 1E1RA 3K1JA 1DBVO 2BGIA 3UH1A 2VHZA 3A6HA 2FDXA 2QR2A 4A16A 5ECGC 821PA 3PD0A 4UEOA 5CGZA 4ZO8A 3GIDA 3L4BA 1NXOA 1LLFA 3RSLA 1QXSA 3FJ1A 2C2GA 5AH0A 1KI6B 3JQ7A 3CVXA 3NAZA 3QX9A 1UUFA 2ZT8A 3LX5A 4LJ7A 5JJIA 1L4MA 4AG3A 4CDMA 4WVFA 2W70A 1SRRA 3ZE2B 1JAXA 1HDCA 3M1YA 2IHKA 2IBMA 3I0NA 1HDRA 1XJ0A 2QMOA 2YIMA 3F5FA 3L1HA 2G3YA 4O08A 3UWSA 4R40A 4DEXA 2V5UA 5FOXA 4ZEMA 1E18A 3AV3A 1I14A 4OFXA 4MCAA 3NHAA 3OLWA 4X1KA 1BMDA 3HB7A 5KYYB 4RTPA 4RFSB 3VJKA 4TVSA 5KKNB 2R6CA 2J4FA 4TYMA 3EEBA 3VYVA 5JSZA 3WRXC 4WEQA 3MLBA 5HKBA 4QOIA 4MW1A 4MCJA 3RV4A 3BIXA 2IFTA 4K7JA 3LUFA 1RABA 1O08A 1DT3A 1E2LA 3L07A 3P9NA 4RCVA 3KKEA 3HWRA 1QPGA 3QWAA 4KQ1A 5JADA 4YCCA 1C3JA 2X40A 3CYFA 2AEEA 3BHJA 3UHFA 1CYDA 1XFAA 3HHEA 4DZTA 2YRXA 4C0BA 4LJ8A 4YX9A 4F4CA 4CGYA 4DIFA 2LBPA 4EATA 1T36A 2HCBA 2GLUA 5JLAA 4JWKA 4FB4A 2OD2A 1QF6A 3B20A 1COWD 1ZUNB 5EUQB 4YRBA 2G09A 2QPTA 1T2EA 3ZHOA 2XXAB 1DTWA 3BF8A 2RHGB 5MHTA 4FLFA 2QM8A 1NX9A 4AROA 1H4VB 3I05A 2R00A 3CA8A 3LG2A 3WGQA 3N2KA 3TFWA 1ORHA 2PZEA 3REFA 2VRCA 4TTPA 4AG6A 3W79A 1Y82A 2ERCA 4UVDA 1CJUC 3PXBA 4LK3A 4QFBA 4MAAA 3GFOA 2OO7A 3L7BA 5AMXA 4REQB 4IXDA 2VIIA 3PLAE 3FKQA 3EPRA 3K1YA 3FB4A 2PKQP 2Y1GA 3T7EA 1HE5A 2R97A 3BRWD 3PQ2A 4H1VA 2QQGA 3K1ZA 2A1UA 3BIJA 1M6YA 2ZE8A 1FW8A 5CEJA 4ENSA 4FQ5A 4XR9A 2EEPA 4NEQA 4JCOA 1TO6A 2ZJ6A 4INJA 1PNRA 3AESA 1ZW6A 3P9IA 1TW3A 4BVHA 2P3OA 3Q88A 3DXZA 2JGNA 1TJ5A 3E03A 3IP6A 2KBFA 4B4UA 3MJTA 5LFAA 3S8YA 3K70C 5H3LA 1TKBA 3L0OA 5LVAA 1VKOA 2GO7A 4UC0A 4H4EA 1NYLA 4P92A 3WAKA 4GOJA 1I94B 3VYSB 1D6MA 4X44A 4EW3A 1WY7A 1MAHA 1SCUB 4HDMB 2H7CA 3T6KA 1U8AA 3IKJA 1YDMA 2JCSA 1F48A 1UBOS 1U2RA 3M1IA 1R5BA 5LJIA 1XAIA 2D6FA 2YHIA 3ZU4A 4MUGA 1DG9A 1SBHA 1ULBA 2ZIFA 3CHYA 4WX2B 5COBA 1D7AA 2WD8A 3V4LA 1HDZA 3LK7A 4D9BA 3SR4A 1BJKA 1PZHA 3DEFA 2XE8A 3RF7A 4DC0A 1HORA 2P9ZA 4JFRA 2WIAA 4OQXA 3MOGA 4RS3A 4XGQA 3A6FA 4PWYA 1ODJA 2GERA 4B46A 3AB8A 5G0UA 2NU6A 2F6RA 1Q21A 2FFQA 3HDGA 5HIJA 4CR8A 4DR4B 1FYDA 1JU3A 1L7AA 5KO2A 4RELA 3A04A 4RKYA 4RX1A 1R0LA 3F73A 4LK2A 3DBLA 3A9VA 1E2IA 2BJWA 1SU4A 3VDRA 1VYTA 5TQJA 3U56A 4EYSA 3ADBA 2CLLB 2JLSA 4EY8A 3STTA 5I4IA 1GUAA 3GUCA 3HVUA 4PG5A 2BISA 1XTQA 2HA7A 1CUYA 3TRDA 3RRXA 3ANSA 3B1YA 3RYIB 1RKUA 4JS0A 2F8SA 3NHUA 1GQOA 4CJXA 2Z2YA 1IPFA 4LNUA 4PYQA 3O8QA 1M2KA 2VLIA 2V0CA 1N0WA 1NMEA 3RUEA 1PJRA 3S4YA 1ZD3A 5C51B 1O7JA 2ZU6A 4E5SA 4IJKA 2VP9A 2J3LA 1Y1SA 3BXPA 5A6VA 3NRCA 1PU2A 5JNRA 4O1HA 3G9QA 3L01A 5JZBA 2WD7B 2PUAA 4CMBA 4J0IA 2GXAA 3NH6A 1SQFA 3K73O 1AJEA 1AG9A 3GG9A 2QL7A 3CUSA 3HLTA 1NLYA 5KX5F 2P8SA 4IQGA 3T4UA 5K6AA 4H0NA 4GKBA 1XA3A 1EUDB 1GU1A 1I3KA 1IH8A 3E8SA 2V1XA 3AEYA 3IB6A 4NHEA 5AI9A 1MOSA 3A1WA 1V1MB 2PUEA 1ZNXA 1H2RS 2W11A 2QVYX 2ZRKA 3H4MA 4OIMA 3GRUA 2P9JA 3JQEA 5GWXA 2FFRA 4XWGA 5AI4A 3R77A 3PHLA 3TGWA 2GNAA 4AL4A 4JN6B 2QPAA 5A0VA 2FXIA 2YHUA 1X77A 3M82A 4C4OA 4MICA 4BBJA 3WHKA 4MCHA 3P0IA 3PWTA 4JZYA 3OD1A 4WZBB 5C1PA 2IHUA 1P1KA 2OCGA 3BCUA 4Y2RA 1L5HB 3TJRA 2ANBA 1T5BA 3D5TA 3TKYA 1VSBA 2QVGA 4JX9A 3GIWA 1OH8A 1MQ8B 2IW1A 1UMKA 3D3JA 3WLHA 3SICE 1M1YE 3CQ9A 3ND8A 1FS4A 2ZT7A 4QOGA 3S55A 4YLGA 1Z2OX 1M2OA 3ZJVA 1LX6A 3ITKA 2P9QA 5I4KA 1EYZA 1G8PA 2R5NA 4RE5A 1RXUA 4UBOA 5HRUA 1ZJWA 1EP3B 1Y6QA 4NS1A 2HRZA 1ZR4A 1IHOA 3ZV5A 4YRQA 3BMNB 2D0PB 1BCSB 1VCNA 1QWSA 4C3OB 1T34A 4BNGA 4FW8A 1QGUB 3F6PA 1M1YB 1MH9A 1TCCA 1XQXA 2PLNA 3IHTA 4NATA 3RFTA 1ZONA 1KZ6A 1W8IA 3A2NA 3FF4A 4GG1A 5I7RA 4QHSA 2F55A 2J4DA 4DQUA 1MVLA 2NQ8A 2YXBA 1WMBA 1GFIA 1AUXA 1G6OA 3OZVA 4JBLA 3RCBA 4EHKA 1SXQA 3E2PA 4KDRA 1XRLA 2NNWB 4ICIA 4FKBA 4UCQA 3L05A 4WFQA 4YDHB 3EODA 4C3VA 4EI9A 3PKZA 3CLUC 1S96A 1XD2A 1XDDA 3HEAA 1OZAA 3BSWA 4DLZA 2Y0CA 3K9HA 3C48A 2CUNA 3KALA 2GJSA 4LXYA 4HVLA 4DMRA 3MSXA 1ZQ9A 2G5PA 4C6TA 1D3AA 4L8YA 4UQPA 2H2DA 3K9GA 2PKEA 2FETA 3VR5A 3T7CA 4GWGA 3RU9A 2JGKA 4CQJA 4K0RA 1N6OA 3R41A 1IJFA 1TQ2A 2X2EA 2UVPA 4HSGA 5T6BA 4A2QA 2GD2A 4OP1A 2Y92A 3A10A 2YBDA 5E4TA 3ITEA 2JZCA 4H35A 1UJBA 2QX6A 5DNCA 1BN7A 1QHGA 2A3NA 2I7DA 5ULLA 2QTGA 2FYTA 5EUBA 5CAEA 2BZGA 1W49A 4MYHA 5DYYA 1JMKC 1DRUA 1E79A 3B60A 4YI5A 5ADWA 2P30A 5I47A 1KEEA 1IB6A 5F76A 4MV8A 4URYR 2V6FA 1Q0RA 2W4MA 1U4NA 1IOVA 1OW3B 1IVYA 4L8FA 1FUYB 1X6VA 2WJ3A 3O5AA 4BFZA 1NJSA 3RSOA 4IMIB 2AG8A 2RCNA 5KPJA 3CKMA 5EYPB 1J7JA 1E9FA 2W93A 4B3TB 4QUJA 2CZQA 2XNSA 1A4RA 2FN8A 1E2QA 2BMVA 2H11A 1HXHA 2NO5A 5JCZA 4HUQA 1D4OA 3CXRA 1K86A 4WKNA 3LF2A 5JXIA 3JASA 4JASB 3UBMA 2Y9MB 1YOVA 4KXLA 2JLAA 4RZUA 1OX6A 3OJ0A 4QBIA 3B3JA 1OFVA 3FOCA 5D7BA 3ZQJA 1JEOA 4IQ0A 4LS3A 4BGIA 2R8ZA 4XWTA 4ZCSA 5HQ3B 5LP6A 2VSFA 1AKYA 1JB1A 1XZKA 4FUQA 4ZJYA 5G4LA 3FSGA 3OQOA 3R8FA 1XDZA 3KUXA 1A3CA 3HM2A 3ZVMA 4RQUA 3WHIA 3PX2A 3ZE7A 3HWSA 5K20A 1UKAA 2AMVA 2DJIA 2YBEA 2WZDA 4JC4A 1SHUX 4LDNA 3HSKA 5K0LA 1AC5A 3F74A 4REMA 1QV7A 4CEIB 2OWDA 2QUZA 3PVCA 5KSWB 2QBYA 3FROA 1P60A 3RJTA 5SYNA 1MO4A 4IS2A 4PAGA 5J43A 2HJ9A 3GFTA 4TL9A 3TLGA 2MDTA 2O14A 3E6AA 4PTLA 3RJ5A 1KAQA 5AOCA 5TY0A 1QQ7A 1II8B 1BHO1 1CF4A 4EFDA 1ADFA 4V1CI 1OYVA 4PVCA 3H1TA 3B6MA 3QXSA 4AZ3B 1L2TA 3IE1A 2JLVA 2ISQA 3BXGA 1RYBA 3IESA 1TAGA 5HIKA 2AE1A 4IP0A 2UV8A 4JQCA 3QWIA 4PXYA 4PW0A 2L17A 3FLAA 2BEWB 4C7XA 2QD3A 1WNFA 1M76A 2L69A 1WKBA 2I7XA 3CPHA 4P32A 4BE7B 2EAUA 5KTSA 1E3QA 2QS9A 2W22A 4P35A 3N0TA 1NQOA 1P9NA 1DHRA 1US8A 4OHZA 3RSHA 1JF8A 4S2UA 3ZHYA 5IU6A 4G26A 3NJ8A 3UGQA 5L6MB 1J25A 1GNVA 4Q3BA 3PGA1 2ECPA 4Q9JA 1SK9A 1TLTA 3BEDA 3HB5X 1QRUA 2R1VB 4YCAA 5KYVA 3DGEC 3WA6A 2X8JA 4RGBA 1V0JA 4G25A 4G3XA 4CUJA 3V2UA 3NC0C 3NI2A 1EAYA 1RZVA 4EQ6B 5I7WA 5JE8A 1AHNA 2D5IA 3RRMA 3PPXA 3WLAA 4YK7A 3PCXA 1OIWA 1OI3A 3EGCA 4EF4A 1D4AA 4U0KA 4RXMA 5FWDA 4C4XA 1IZ8A 2WKPA 1P19A 1X8XA 4QE3A 3HR8A 2V6JA 1OPXA 3IFSA 3KTDA 5FOUA 3SDBA 5FBVB 1YRAA 4DV3B 5FWYA 2QDXA 5EJ6A 4PTYA 4RD1A 4ZI3A 4CR7A 4Y1RB 1WBDA 3NDBB 1H8HD 1AA9A 4OBXA 3DM5A 4FP9A 3I73A 4QGGA 3TW6A 2XOXA 4HAWA 2R5WA 3TQFA 1Y0BA 3GJXC 1LX7A 1P1HA 2CLFB 2ZWPA 3JQQA 3PEEA 4WLVA 4BO3A 1YTUA 4GSKA 1I9CA 1G5HA 3AHJA 4M7PA 4YH1A 5F77A 3W34A 3E9DA 4IZHA 2GBGA 1BQ4A 1RJFA 2MSNA 3O8OB 3TM4A 3W7VA 3P0HA 4CIXA 1J21A 1OXKB 1CYEA 5JNSA 4QBTA 1IVSA 5ILGA 1TI7A 4D79A 3IVXA 3K0FB 1FU8A 1S2GA 4QHTA 2PMBA 5LP6F 3K2BA 2P77A 5LYJF 1QFYA 3R3JA 3DAGA 1OC2A 3KE9A 3LSTA 1BXKA 3M4ZA 3LPLA 1KE1A 3TL2A 3CNNA 3V7YA 4JR1A 2GKGA 2C9DA 3C1TA 1ISGA 4I1YA 5G4KA 5HZKA 2JZOA 2QSZA 2ZYRA 3HABA 3KZXA 2Z6AA 4FJ1A 1YZTA 2WMOB 3M9WA 3R5FA 4D3FA 3NVAA 1UFRA 1ZI8A 3B3GA 2P79A 3EXFB 2R6AA 3RS3A 3LOUA 2VEDA 2I67A 4CUZA 4WN3A 3DE1X 3FNBA 1F5SA 2JH3A 2OL4A 3PUXA 4JSRA 4OQNA 5H83A 1S3FA 2B35A 1HTWA 4ALIA 3SOZA 5K45A 1H1LA 2A2ZA 3WAGA 1UFVA 3CG4A 3NW9A 4BU1A 4Z4CA 3FFTA 2GI4A 4QOFA 1DRWA 4LECA 4C4RA 3HKBB 1L4FA 3CCCA 3T3IA 4AQYB 1ODSA 2C0QA 3OPYB 1BD4A 3QPDA 5JRDS 1UFQA 1HFEL 2LWIA 4N65A 2CNLA 2H00A 4QGBA 1KYTA 2OY0A 2K2WA 3IUEA 5HKKA 3QXGA 1QH8B 4RJLA 2NMVA 2D3TA 1C9KA 2IX3A 2B6NA 1CEEA 1GU7A 3FBTA 3MGAA 5C7LO 4QT0A 3ZDZB 4RD2A 2DR0A 2EL7A 5SY4A 1ZMBA 3TL6A 1T6ZA 1Q1AA 1Z2NX 2ANCA 3OESA 2W0MA 4HRXA 3O0TA 2QZSA 1X38A 1OT3A 4WXEA 1SXJB 4NPAA 2G77B 2FK8A 2KLHA 3O93A 5FADA 3DNPA 5JG7A 2GYVA 3OTGA 3P2KA 1DWQA 2YJ3A 1ISJA 3GLRA 5AHKA 1EZZA 3EAGA 3FYHA 3VYTB 4DDUA 2P9GA 4HN9A 4J75A 4HZGA 2PWYA 4JSTA 1P0PA 1ZFNA 4XR4A 3KT0A 4YJGA 2LZ0A 1N1DA 4LCJA 3VH3A 4W8OA 1YASA 4TL8A 3OE7D 2FPMA 2C4TA 3EGOA 3PHJA 2P5UA 3DLHA 3VHXB 4MV4A 6ABPA 4N0MA 2WW8A 2FQYA 3PCRB 1YQDA 1QVZA 2I6TA 2Q4OA 2IK8A 2WEKA 3QLTA 3AB3A 1MB3A 1YMUA 4BN4A 5K03A 5KTMA 2IE8A 1FJXA 2FPSA 4ZREA 3CZ5A 1HK7A 2PUWA 4KWCA 1TECE 4JXXA 1TGYA 1HFJA 3L7DA 2QT9A 4Z9XA 3I4LA 2AW5A 4NARA 2CUZA 2ZI7A 3JQ9A 2I4NA 5AHRA 5C34B 3OQNA 2V7GA 5SICE 1RAEA 2J3DA 3N86A 4KPEC 4FR5A 4II3A 1Y9EA 1SA0A 1Z5ZA 4PC7A 1N6KA 5C8XA 3ZY6A 3QEAZ 4R1PA 4IH9A 3OIFA 3TNJA 3G79A 5GGXA 3ZXUB 2J0QA 1MX9A 3UM9A 2CDAA 2ZKIA 3CWQA 4Y2YA 4CT5A 5B6JA 5JRJA 1IY8A 3K5HA 5FQNA 3WQHA 4X6YA 3ILXA 3BDAA 1OIXA 1ZR2A 1P61B 4KO4S 3HY6A 2VDNB 2IWHA 4XX1A 3IRVA 3LQ1A 2X1LA 1DWOA 4E11A 4HAUA 1DIHA 1YI1A 3OY7A 4J76A 4NCNA 4G4SO 2CYCA 1U1DA 1HRDA 2XB9A 4N1AA 3WP1B 1CDZA 4KXWA 1TJYA 5E2IA 4AUMA 2H0RA 1MD9A 1E6MA 2BEVA 3OTIA 4OHRA 2NO7A 4UNIA 4BJ3A 4K03A 1HG0A 1AN0A 2FUG1 5LBIA 2DERA 4ZOLB 1DEAA 1ODKA 1N2CE 3HYLA 3TCXB 2MT9A 2Q6IA 3FMVA 4WKBA 4C22A 1ECCA 1VIVA 4CRWB 5JCJD 1N33B 4N49A 1XWWA 4BLTA 4IIEA 2FUG6 2XVAA 2JVIA 3MS7A 1P2GA 3NYRA 5DT2A 5LC1A 1XEWY 5HJEA 1MRSA 2PSEA 2GCOA 4QFDA 3WDSA 3R9WA 2ZDHA 4TXMA 1G6KA 3FOBA 5K0BA 3DMHA 5HGXA 3RDPA 4CMIB 4WOBA 1RT9A 1NRWA 1RCFA 3F6SA 3W77A 3WLJA 1A9XA 4HPWA 4PLFA 5DGCA 2C31A 5CNIA 1NOKA 4NU8X 2OXIA 5IHPA 3GAAA 1LLUA 3E48A 3G8YA 2EERA 3QOFA 2EOAA 3N2LA 5EWLB 1U04A 5LNK6 4MVWA 1LNZA 1ZLYA 2ZBQA 3BHNA 3PUJA 2OOSA 4JT8A 2YWEA 4XLTA 4KAXA 1K97A 4LF7B 1DT5A 1PT9A 1REQB 3CRVA 4XJXA 1B8VA 1OREA 1EDZA 5DYWA 3RWMB 3U3KA 3LDFA 4DLXA 3UO8B 2OZLB 8ABPA 2NXJA 5A3JA 3QEMB 1AS3A 3ES9A 4NMMA 5EPEA 4EYOA 4LJYA 3I0ZA 5EP4A 3UMCA 1XTBA 5TXGA 4C89A 1L4HA 1P44A 4QJ3A 4LBYA 4MWTA 5DHPA 5KWSA 3TIFA 4RACA 3NRBA 3T06B 5JNUA 2X8AA 4HGZA 4OXIA 3SXUB 1L8QA 1OHHA 1UBTS 3S1LA 3NEJA 3MWLA 4HRVA 3E9RA 4CODB 2DUNA 2NV6A 4YN3A 3IAM1 4P5EA 4S0ZA 1OZHA 1KZ1A 4ZZ2A 1NFFA 2ZYIA 3JWJA 5ERGB 1I3CA 5IH3A 4AB1A 4E94A 4NZ9A 5FWAA 5H70A 3QXCA 5DRYA 3W2FA 3EYAA 2HY7A 2M6RA 3MTJA 4KXQA 4GMFA 3O8DA 1BC5A 4Q1AA 1YDHA 2GKOA 5JH7F 3CNOA 2C7QA 5DCUA 3UYLA 2Z5GA 3D3WB 1BJRE 4ZQGA 4DABA 5BURA 5JO0A 1LPAB 1NF3A 5A4DA 4I6GA 2PUGA 3V55A 1GVHA 3IR5A 1DXOA 4KQ6A 2AC4A 3WZ2A 4WN9A 3ZCRA 4E7OA 2SCUB 4JEMA 1NDQA 3CVOA 4ZCLA 4BO7A 3C4JA 3EVGA 2FMHA 3A1NA 3NPAA 1QGAA 3GELA 5K2MA 1JSXA 5AVKA 5HXAA 1KQGA 1FX0B 2EDAA 3F8SA 1UPCA 3UFXA 2G9VA 1XRMA 4HQ0A 2GJ8A 2VH2A 4P81A 5FYDA 3V4FA 2XCUA 1HF3A 3W9SA 1E1CA 2WJIA 3ECAA 4PNEA 4FU0A 3E1GA 3ZV4A 3K70B 4DQVA 1WDKA 4EECA 4B2YA 1C7RA 3QJYA 4HX5A 1F51E 3M49A 1L7EA 1OGIA 1YBHA 2AJTA 4LMPA 2CFSA 4INOA 3HU2A 4CL0A 5AXDA 1O9BA 3LUDA 2IF2A 3ZHRA 4X71A 3U3MA 5ADUS 5ICMA 2EBFX 4LPSA 3LK6A 3F6CA 3PE3A 3NS7A 4UNQA 5K8LA 3K1AA 4COKA 4NZPA 1T4GA 4FHZA 1IWOA 2A0KA 4IRXA 5G3ZA 3ZWPA 2ZS8A 2PJRA 4IUBS 1NVVR 4IIXA 3GU3A 4UATA 4Q1CA 2VZ0A 2I8LA 2VBCA 3AFOA 2CJYA 2EFYA 5A06A 4U5XA 2C57A 4ZU6X 3P0EA 4NYJR 3I30X 3PVZA 3UMFA 3KHUA 4MQ6A 3QU9A 4NVRA 4R81A 1J0BA 4XCXA 1WSDA 1KI3A 3U7QB 3U4AA 2AE2A 2W98A 4BZQA 5BSVA 3KR0A 1V5FA 4LDAA 1P77A 3FETA 2AVDA 2O5RA 2Q6TA 3VZSA 1V48A 1MJFA 2WF7A 4L72A 3JZFA 3D7SA 4HGPA 4BGEA 3O7WA 3OPMA 4B7ZA 5FORA 2WAYA 4Z53A 2LCFA 1Z6YA 3PR2B 4DADA 3LC7O 1X7YB 2RKWA 3JAKA 4N01A 1IWBB 1PGJA 1XQ6A 1C5KA 1SG9A 2FEAA 2GEBA 3RSSA 2DZDA 4QO7A 5GPBA 3TTXA 4B2PA 4ENRA 4Z54A 1H8EA 3X2SA 4KUEA 2ZAOA 3CX3A 3I8OA 2PFSA 5GOTA 1BYIA 1RNLA 2XITA 2OHIA 4DLRA 4JP3A 3PENA 3AL3A 3CUTA 3P0JA 3TGPA 4JJ7A 1YCFA 2QUAA 3EN0A 1OILA 2PQ6A 4KLCA 5U4XA 2VQ3A 2WIKA 2ZKLA 4J0KA 2B4TO 4W7SA 5GZ1A 5ETJA 3H11B 4G2NA 2OHHA 1RBMA 1HQYE 3W2EA 3RYFA 1V1RB 4B3IA 1YQQA 1QH9A 2N0SA 4FZRA 2EIHA 2A94A 1KMIY 3PUKA 1OQAA 5H9VA 1ZC4A 2WUFA 1IN7A 5EMMA 5HF5A 4TTSA 5D01A 4EUNA 4ZYYA 1R00A 4E46A 2OG1A 1V3TA 1Z6PA 5FX2A 1OFUA 1DRJA 4YJ2A 1E20A 4UBLA 1Z4LA 3EVAA 4INAA 1NIPA 4RMHA 4X7MA 3FLEA 2VYND 3GUYA 1HURA 3IXQA 4XD2A 1NJ2A 1RTTA 1QU2A 2NYUA 1BS1A 4UBKA 3PF9A 2WDZA 2GZHA 3KKOA 4ROTA 3ICPA 2XWQA 3QV2A 4HLDA 5E9QA 1JJ7A 2C4NA 4TXHA 4IOKA 5CDGA 5JSHA 3B51X 3ZY2A 2DQZA 3GJTA 5G0SA 1JPJA 1VG1A 1NW6A 5IXYA 3TLMA 2C9OA 2LTAA 3NXKA 5BYJA 2RI6A 1VRVA 2OGWA 3OG9A 4HOYA 4CNQA 2L0XA 4R7ZA 1I3OA 2Q29A 2Y9PB 3RHFA 1WHTA 2HPVA 5LZ7A 4WY8A 5B1IA 2ZVDA 4Y3UA 5JUWA 3QKTA 3W7AA 1UWCA 2RFLA 4NV1A 4BFVA 1ZCBA 4IWNA 1JHYA 1EM6A 1SIBE 2A9RA 4CDGA 5JECA 1O0BA 1TQ4A 2C4WA 5J63A 1ORDA 4R0VA 5G3YA 4UU8A 4DBLC 1L3IA 1QKJA 4QTYA 1BA3A 2HDWA 3HKEB 4MA4A 4W5NA 1BWQA 2YDXA 3MD0A 4W82A 1E4VA 3GJ4A 3U7RA 1E0AA 2X0IA 4OA5A 1MB2A 2P6NA 4ZVPA 1YSCA 2PJUA 3H2HA 2DUUA 3A6EA 3O7MA 3Q7QA 4IEEA 2BCGY 4RD0A 4YRTA 1TM3E 5C8ZA 3L46A 4B0PA 4KKVA 3C7KA 2YICA 3O73A 2ZYDA 2F00A 5LZ8A 5ALPA 2O20A 2JFGA 1X80B 1Q6ZA 2WMDA 5EAIA 1LW6E 1YKFA 4DSNA 4V39A 6NULA 4FNOA 2C97A 3CEAA 1NP3A 4J2OA 5JZVA 2JIRA 5K01A 1N77A 4GP9A 2WKWA 4Q02A 4Y1EA 3G85A 2MSWA 3GDHA 4XVQA 1KRXA 2O50A 5B4UA 5IBCA 1L1EA 3I2JA 4ARAA 2Q27A 1BMFA 4QRIA 3WGVA 1DKUA 1A4IA 1KNQA 5K05A 1CR0A 3AGQA 2FKAA 1O5OA 2PIAA 1L8OA 5ALQA 5BQXA 4XIGS 3A4YA 2AS0A 4JU8A 1B3BA 4UCFA 2PS0A 2JFFA 3WE7A 1ONSA 3H65A 5IYZF 1NTRA 5EIAA 5F35A 3NTOA 3ZWDA 1T4BA 1UJNA 4TWIA 1UDAA 1XJ5A 5KNCD 2JIQA 1ZYUA 2QIPA 2WHEA 3OQPA 4W7IA 3U31A 5CXXA 3CLKA 4DCVA 2PSFA 2V3CC 1PV1A 2RAVA 4IKEA 3DA8A 2IYLD 1DJOA 2IEBA 3GXBA 4RADA 3HN2A 3P5BA 5F2KA 4E5YA 5BV7A 3MBIA 1ZGBA 3SGLA 1Z35A 1FDIA 2EJCA 1XZJA 4C21A 1NJ6A 3DLCA 1T1EA 2VP5A 2CFCA 3ZWOA 4CXMA 4GVLA 2VRWA 4QYWA 1GSOA 3UANA 1U7OA 3SYRA 1X9IA 1GRVA 3PNSA 1NQAO 4U2BA 1BKYA 5DU2A 2VUTA 1QRAA 3EGWA 4G1MB 4XM2A 4BO2A 3SVLA 1M8GA 4PO3X 1A5BB 4CIDA 1D03A 1U02A 5JDIA 3HBAA 4ARZA 3G0GA 1D2EA 2OCIA 3O3CA 3SQOA 5I01A 1M9NA 3EJ6A 1XJWA 2QRVA 1NXVA 3BE8A 3WNCA 2XNCA 3U61B 1DIBA 2HPAA 3JAKB 4MUHA 4ZXPA 3F0TA 1Z74A 3ABSB 1JPVA 1X7GA 3D6HA 4F9EA 3TF5A 4O25A 1DL5A 3MQ4A 3TQQA 3FZEA 3H6KA 4MLZA 1DJMA 1OSNA 4FGZA 4PHHA 3HDVA 4OAPA 2QTMA 4A0SA 2IPXA 3DOFA 3A31A 4FC6A 4LBVA 4B3RB 4LDQA 4G0UA 4CCYA 4DN6A 1NBEA 3CU5A 3HUDA 2MU1A 2ILTA 4PIMA 3S2GA 1ETHA 4ZI7B 2BVNA 1TX4B 5IZ4A 5IP5A 3K0AB 1IBLB 2ZULA 3OC0A 1H9BA 2JW5A 4ZPJA 4HX9A 1UWKA 4YRAA 4ZVRA 4C0LA 4CLRA 2QD2A 1OAAA 4PHCA 4M8SA 4RUKA 2QV0A 1V9LA 1DNPA 2D8AA 2XZTA 3JQRA 3E70C 3QVVA 4ZRMA 1WVMA 4HGYA 4ZJUA 2XECA 3MCZA 4KB5A 4G67A 1NAIA 3V5NA 4FHCA 5GJVC 3RVOA 2VXOA 2GBPA 4WH0A 2KBEA 2JD1A 2VNSA 4AZTA 1Q3KA 1NQWA 3P9SA 1VZ3A 2WHXA 3NT5A 4G5YA 1PD1A 5IWAB 1WZCA 1ZRSA 2XOEA 3TNDA 4D4LA 5FAKA 1H3NA 3PDWA 4D97A 3LVBA 2QRMA 5KSPA 2FMIA 5DVZA 1AH2A 3GG2A 4P4UA 4X94A 4EY6A 1HLFA 3AEQB 1I6LA 2O2HA 1WMAA 1J8FA 1G21A 3AIMA 4BV9A 4WLFA 3U16A 3W5BA 4R9RA 5K0ZA 3NEAA 3LGXA 1BNCA 1U3GA 2MHCA 3OZDA 4Q21A 2R9VA 2AW3A 4DUGD 4EI8A 4ZK2A 3RC3A 1DTSA 1KARA 1OLOA 2EW2A 2H08A 4UJ5A 3WK4A 1CQWA 1QP0A 2IS2A 2VSQA 1RCUA 1XZLA 2E4UA 1DC3A 3B7GA 1NLUA 1YIDA 4NABA 5ENDA 1O96A 5I3CA 4HGNA 3WADA 3VZBA 1I4TD 3E5HA 3HCOA 5EWMB 1ZIYA 2M9MA 2UZ0A 5JCJA 2GPTA 4JYAB 3TOSA 3G7UA 1XZCA 2RBEA 2FN9A 4JMLA 5G02A 4HMOA 2CLDX 2GFIA 1DEOA 5LDGA 3UAYA 5G1PA 4Z86A 2H9IA 3PYXA 1QYIA 1F38A 2ZVJA 5DBIA 1RYEA 5BN5A 4RIIA 1HE3A 1ULSA 4KR0A 4R9UC 3RS9A 1C1DA 3BQ9A 3MYRA 2VNAA 4L5JA 5DM2A 5JQGB 3I3OA 3E8MA 1LRKA 3LM8A 3HU3A 1ULZA 1KOFA 2PS3A 4IF6A 2PNFA 1J8DA 2IEZA 3QPCA 4MLDA 3RG8A 4BNKA 1XPOA 1TK2A 4V38A 4I9UA 1Y9DA 1L6IA 1EX1A 4YGYA 3M34A 2ZUFA 2P2ZA 1PG5A 2H57A 4MVYA 5JCOC 2PZAA 5JROA 2GOYA 3HLKA 1X94A 5TS3A 1E0SA 1VIYA 2FQQA 2O3TA 1YB4A 3FCUB 2FZGA 4HJXA 4IXWA 2AEJA 4JT2A 4JUFA 4ZAGA 2M6LA 1JFFB 3ZDRA 3E0XA 3A28A 5LA6F 3GGPA 3NIWA 2IYOA 2I1VB 1DIRA 1SH7A 2P2YA 3KOUA 3PYLA 4NJMA 5E6UA 2XDAA 5HOQA 4AJJA 4RJ2A 2GZMA 2UXDB 3VKFA 3BFKA 3KJHA 2ZOSA 3PL5A 4ZDJA 2Y27A 1JMYA 4MW9A 4UFNA 3BERA 3JD1A 2O1WA 3WMWA 4ZQHA 5M2QA 4ODIA 4PQFA 4XFJA 4E5UA 1YRWA 2ZYUX 4U39A 3AU8A 4UAUA 4L4SA 3AOGA 4TMXA 1U9CA 1IY9A 2ZR9A 3ZBQA 3LOPA 3AVVA 2ST1A 4H2DA 2J9FA 3N76A 5JXHA 4CN8A 2GUWA 1HYGA 2JJ8A 2ZJZA 3A37A 1WHTB 4HDNA 3WLRA 1YUNA 4F04A 5FPYA 2E6KA 3VNVA 3EIUA 3T3DA 2ASEA 2XYGA 4UFOA 4RTOA 1NBMA 1OAOA 3K72B 3UY4A 2BHSA 1KEKA 2BFDB 3R3ZA 2C20A 2ZIGA 3KETA 5F9HA 2D2XA 3OBBA 2P6PA 3ESBA 4GMKA 2PA3A 1ZHFA 3PI7A 4K9NA 1KBOA 1JQBA 1O57A 2V58A 4Y8VA 5KTKA 1QQBA 1QZ3A 2RDMA 4ESOA 3EF0A 3PJRA 2EARA 2CCGA 3I42A 2XEDA 4KQKA 1YCDA 4KRXA 2HIGA 1ST2A 5FPHA 2VDKB 4ME6A 2A9VA 3EUFA 1XU7A 2O05A 3GLFA 3IAEA 3V7FA 4BZXA 4HGRA 4C0HA 5JY6A 4G4IA 3PJEA 3ZG6A 4UXHA 1V43A 1R4MA 2AMFA 2PH5A 3MINA 5TC4A 2VTVA 3A1DA 5HBRA 1CQIA 3GVCA 1Z13A 3TJMA 1QFJA 1AKTA 2A5JA 5KDOA 5HM8A 3FMGA 5JYBA 2X6TA 4RF2A 1F20A 1WXFA 4Q4JB 4P7BA 1SUIA 2W00A 3O31A 4OSEA 5HOEA 1JZSA 3PUZA 1NQVA 4EGSA 4F9FA 4UZSA 4N0PA 4EIWA 2HRBA 4PLTA 2I7VA 1MRZA 4MCIA 5AKZA 3H0EA 2AHOA 2JHAA 4FE7A 4C4PA 1J5EB 3GZJA 4UMEA 1Z3CA 5TE9A 2IF0A 2P90A 3IJRA 2VQFB 1JEQB 3F67A 1KJZA 4IDGA 5KVSA 3O4GA 1VA4A 1BKDR 2K5UA 4R8MA 1KDYA 2HWWA 2QAIA 5AVJA 1C1DB 4C0XA 1M6VA 1RAIA 2Q1WA 4M0LA 5DBGA 5F52A 4ENPA 4ZZ3A 1E58A 4MVJD 1XUOA 2ZRHA 5BN5B 3VOTA 2G9QA 4NSNA 4EGFA 2PUBA 4NZYA 1I9GA 4MRSA 2UUOA 2FR8A 1H93A 1L4GA 1AHPA 3WZLA 3WGGA 4CT4B 4AN0A 1XRJA 2P2DA 1JU9A 4LYAA 4DR3B 2F9FA 4MRRA 4FHFA 2IDMA 4CM4B 2IZOA 1B00A 1RYYA 2LXNA 2O2SA 4OKIA 2IZZA 1ZMOA 2WPDD 5T4BA 4Q9IA 3IOYA 2NUAA 2GM5A 1UOQA 4UBIA 4DQ0A 3THWA 5DFAA 3ASVA 4MMYB 2BKXA 5LYJA 1A8UA 1BEUB 1NL3A 1JLSA 3FVVA 1ZCZA 4DCJA 1LRJA 2FCRA 3SSAA 1X1AA 3LT4A 4DCGA 4FYVA 3OJOA 1JUDA 1R9GA 2HSWA 3U4CA 1ILEA 4XPIB 1E6CA 3O8CA 5D1HA 2IV2X 3UN1A 5BRAA 1VJ5A 4KAJA 1R3UA 2FP4A 1PGPA 4K2AA 2GK7A 4YRJA 3EISA 1JWLA 2P6OA 1G59A 4F6RB 1ONNA 4QPJC 4RV9A 5DGXA 1TUEA 1R27A 4TN1A 4MS3B 3VX4A 4YRSA 2GPSA 5HS6A 3WY9A 1G21B 1MAWA 3HN6A 1MMFB 4EFMA 4WAUA 3V32A 4ENQA 5LBTA 3DT9A 2FMUA 1P1CA 2F1JA 4AJHA 4TRNA 3ESZA 3KAPA 1E9BA 4UUBA 3ZTWA 2C9BA 1Z9BA 2R6JA 1G38A 3B9BA 3NM4A 1P1RA 4UNPA 1A77A 2RHDA 1DOAA 2VJQA 4K9MA 1AKEA 1E61A 1UK6A 1WV1A 2FX5A 3BSSA 4UNNA 1H4TA 3KSZO 5T67A 2FR1A 3P19A 3VYRB 1NI4A 2PUFA 2H54A 3I32A 1G3RA 1OJ7A 3OCWA 3FAZA 2IU0A 1DCKA 4YDQA 5KU7A 3TZCA 1PDVA 4R16A 1B15A 5BO5A 2GQ0A 3L8YA 4EHJA 1LQTA 2HFKA 3BIOA 4C2UA 3EUWA 3UMVA 3NM6B 2J3KA 2AD5A 3IOEA 5KJFA 3KLPX 2C3YA 1C9JA 4K6MA 4H60A 2EJUA 3LBHA 3WV5A 2FE1A 3NTRA 5EGSA 2C1ZA 3I53A 1QVWA 4I6EA 4KSYA 4MVJM 1L5YA 1WHSB 2XWPA 3BB4A 4PRKA 3GXOA 5TT0A 4BO5A 4D3ZA 4MS1B 5JS2A 2RGEA 1THZA 3L0YA 1Y1RA 5ED0A 1CR4A 1N3YA 1XQ9A 3E9CA 3QGMA 1NXSA 1GPWB 3R0XA 4IDDA 3QYPA 3UAWA 4C6HA 4I81A 3VC2A 2WJWA 1Q19A 13PKA 4XYGA 1KZ9A 1XTIA 4JOBA 1HEYA 1KPHA 5IKOA 1MJGM 4OHPA 3KWJA 4X54A 1COZA 3TKLA 1Z0FA 3WDLA 1OLSB 1NVUQ 4QASA 1EDDA 1FRQA 1OY1A 2JL1A 2OZLA 5C35A 2ZR8A 2ZSHA 1HOTA 1NTOA 3AL2A 4MO2A 1MJHA 2AG6A 2HK7A 1JILA 1G7TA 1REQA 2NZ8A 4PZYA 1TU0A 3RI3A 1WQ4A 2JCXA 3DW3X 4AO8A 3DBIA 2IS4A 4LVCA 2CLOB 3DBVO 3E3LA 4YJ3B 1T9CA 3OMWA 3ZIUA 4F21A 1U1FA 2AQ8A 1SVLA 2VP0A 3ETCA 5GINE 4CEIA 2C95A 4JI6B 3FW1A 2P3SA 4M86A 5DK4A 4OQLA 1EXWA 3F7TA 3ZK7A 2ONCA 1VJ1A 5ALJA 4E32A 1L7XA 3DLAA 5ENZA 1ECBA 2F1OA 3RVDA 5H3CA 4BO9A 4QVIA 2GDZA 4LGMA 3KXKA 2GN2A 1P7PA 3S70A 1Z5NA 4Z3KA 2BFOA 3CR7A 3BMQA 3V4PB 4C20A 4Y9TA 1HI9A 2OHGA 3FOZA 4B6QA 1L5VA 4KDEA 5GZ3A 3N58A 3O95A 4QTXA 4JVSB 4EJSA 2WTUA 2W2KB 4AUEA 1QV6A 5ER9A 2OMKA 3ET4A 1GDHA 1D2NA 1GA1A 3LT1A 3QPUA 2C7VA 2GBIA 3KUDA 3LF1A 1XZGA 1FUUA 1XTSA 4N18A 4O6VA 2CV2A 1IQRA 1FSFA 4U7WA 3AXTA 4IUDS 2R1UA 4YROA 1BFUA 3LCUA 4UZFA 4NY1A 4B6JA 2EFJA 3BF7A 3FNRA 4P38A 2J9ZB 5FA6A 4PQYA 2VUHB 4JLUA 2HJWA 5AXCA 3I2HA 1AKVA 1K6XA 2HD4A 3DC2A 4GZ6A 3RYHA 1NJGA 1T10A 1NDUA 3FGOA 5C7OO 1HR0B 1QQ6A 2R8BA 4DJJA 3VVLA 3FDFA 2W2NA 1T8RA 2A59A 3L41A 1P8JA 4ENUA 3G2IA 4PFKA 3F5SA 4QOSA 4FFPA 4IYJA 2DSNA 4ZU3A 2I6GA 1WU8A 1Z82A 1HYEA 2YN4A 3X44A 3RBVA 1THMA 4I3FA 4F5EA 1A69A 5AIAA 1SA0B 4BNXA 3H5OA 2SKDA 1SVMA 3LTEA 3NOXA 3O1JC 2X41A 4HH3C 1YU6A 1JYEA 2OZPA 1PEAA 2FWIA 2IA5A 2ZQYA 2C92A 1NSTA 4YAWA 5DULA 4ZOBA 1G17A 1J0XO 1EI9A 2JBWA 2RMKA 3CN9A 4L4XA 3GI1A 4AMZA 1NBHA 3I76A 3KVVA 2A4KA 4NKRA 3CVJA 3QVLA 3RIEA 3F96A 4I1OA 3RNOA 4IDQA 2NSLA 3SEFA 2NXNA 1EFRA 1F5NA 1IZYA 1HDEA 2XGJA 2HEGA 2OZEA 3FTPA 3DH0A 5LOVF 4NL4H 3ADOA 3EBLA 3V4VB 1TCBA 1PAUA 1T4CB 1N6PA 3GWZA 4I14A 4DMMA 5EIXA 3I62A 2CC2A 4PLCA 2B8EA 2ZJAA 4LYEA 4AC9A 5CU7A 3KXLA 2QF7A 4N0EA 4DNFA 5F9MA 3FG9A 1AA6A 2Q21A 4LOIA 3S68A 1DDIA 3EAQA 4IIJF 4D9NA 5IJAA 1WMEA 3FKSD 1E1NA 4XVUA 2JGJA 3DBHA 1QRTA 4L5BA 2PD4A 1G18A 3C3CA 4G5RA 4OATA 3V46A 1LUAA 4PCAA 4B4WA 5IH7A 1BCSA 4AQ7A 3BMNA 3L4JA 1E9RA 2DLDA 3AVWA 1P75A 1RWOA 4RO0A 3WAJA 1QBGA 4A8JA 4US0R 4GEGA 1DG3A 2C2KA 2NN3C 1UMBB 4JGBA 5A71A 1WTAA 3ZCTA 3L6DA 4I19A 3AEKB 3M6XA 1QUFA 3IUYA 1SHLA 2H63A 3GFQA 2NO4A 5B3JA 3L4KA 1N2SA 4XSVA 3PA8A 2GNOA 4KX3A 1QANA 1NVGA 9MHTA 1L7RA 5DPMA 4ZAXA 4CMCA 3OE5A 4LZLA 5FT9A 3ZLTA 1CPYA 3MJRA 4J07A 1L5HA 5BR1A 5GY7A 3CMMA 3MOSA 3EDMA 4FGSA 5A9SA 3VNQA 1RHJA 1WDWB 4IOJA 4PBRA 5E6SA 2CFIA 1E3EA 4F5YA 2DWUA 2PGXA 5DWVA 4BNFA 4J9VA 4EGQA 3M5CA 1UJ6A 1VBKA 4ZVQA 3T9DA 2GYUA 4YUXA 3H97A 1ODLA 2QJTA 1MXFA 1FSGA 3X2EA 3RTDA 2C2WA 3VR3D 4A03A 2WTNA 1FSPA 3MXTA 4E1AA 2D1TA 3H2GA 5KTYA 1DUVG 3VR6A 2A5FA 3VGJA 3MW8A 5BR7A 1RWKA 5FL7D 3S2EA 4E5KA 3AETA 3W1WA 2ROQA 1WW2A 2HMWA 2KQUA 4MWZA 1P4JA 4CM5A 4S05A 1PJZA 3KQOA 3R3VA 1UBCA 2Q1TA 5G0WA 4M49A 3ZS8A 1C0LA 3ESXA 2NOAA 1N75A 5REQA 3ESQA 2OQIA 2PANA 1B1CA 1Z7WA 3WNVA 2VHJA 1JX6A 2FR8C 2VH5R 3BXEA 2QTBA 4EB3A 4BFSA 1TQ6A 4OREX 3LQ2A 4UAGA 3H2YA 4WFJA 4NFYA 4R2JA 2HNKA 2F3TA 2VWQA 3OC6A 1JFTA 2GYYA 2BR4A 1XVVA 2F48A 1AU9A 1BX0A 1CZNA 3ZYZA 1M74A 5KQMA 4RPCA 4XWKA 2I9KA 1CCWA 2JKZA 4KQXA 3SE7A 1AD2A 5AXBA 5TQ2A 1SC3A 3DOCA 1Y98A 4MQEA 1QO9A 3T1QA 4EG0A 2LUOA 3K09A 5ITVA 1UL1X 2BM0A 4Z1OA 5HZGA 2P2GA 2O0HA 1XCBA 4GVPA 4RK5A 4G9BA 2WU3A 3VHQA 2Z8YA 1RXEA 3ADKA 1SO8A 1GCUA 2IP2A 3S1SA 4GL2A 1T9HA 2YHBA 3UICA 1BEEA 1NWHA 3A26A 4R05A 1Y3CE 1KMQA 3H2SA 4YRCA 3T7DA 4B84A 2O8FA 3DP9A 4ND5A 1JA9A 4FFLA 4KR7A 1T2VA 5JEDA 4HB3A 4V3CA 4ZC8A 3LDGA 5CB0A 4GPTA 4A26A 1QZXA 2X0DA 3TLXA 3QEBZ 3NUGA 1CU1A 3ZNPA 5BOSB 1RI3A 4N3GA 2OK7A 1G5FA 2IS1A 1G8GA 2EKLA 3COZA 1UPFA 2X23A 2IOFA 3N0RA 4MRVA 2VK1A 1R50A 4IM7A 3K1AB 5FD8A 5TV2A 4HDMA 4NLLA 3CSUA 1XKQA 5JSYA 4LF8B 1EB8A 3NDRA 1L5MA 2G1JA 3S29A 2CFTA 3OTQA 3H5TA 4FLEA 3AUSA 3GLHA 1U31A 2MR5A 4A1OA 3FFBA 2QU7A 1GN8A 2C1EA 2YJ4A 3KYIB 3LBYA 4RGQA 5IF3A 3DL4A 3NOVA 3VZRA 2CW5A 3QLUC 4IFIA 3CONA 5C8DA 2J3HA 1IEQA 3E15A 3OJFA 4ITRC 4OMCA 4Q4AA 3GGGA 3O82A 4FJ0A 2AJDA 1G1AA 3O84A 3L7IA 4K86A 1XIVA 4AZ3A 5M34A 1RYNA 3AERA 1WG8A 4EPXA 4D9KA 4DLUA 4Y18A 3SJZA 4OFBA 3PLRA 3TLGB 4OP2A 3O2QB 4HXFB 1Z45A 4EOGA 1UOEA 3T41A 1KC1A 2NAPA 3PEVA 4MUBA 4GWLA 1SB9A 3R5KA 1ZICA 4QUDA 3F97A 1JDSA 1IAQA 3DHNA 4I3GA 1EGHA 2X7JA 4REQA 1E5TA 2A86A 3UB4A 1JSRA 1QLHA 3OHSX 3HCNA 4TSRA 1XQYA 2VPZA 3BUSA 3HUEA 2L18A 4MUKA 1SKBA 3EVDA 2XDWA 3KUCA 3NIDB 1ENYA 4JITA 1MHPA 4D56A 1H2WA 4LRWA 4C6SA 2WWXA 3PC3A 4HFMA 4AY4A 1XZFA 4YJHB 1E79D 2FUNB 3BXXA 4YC7A 3ANXA 5ALDA 1KGSA 3PKIA 4Q34A 4V02A 1BXRA 5IJ9B 1B42A 4ZALA 1LVUA 1HFWA 5EKXA 1Q5PA 5LLSA 2FW9A 2Q7XA 1ZRNA 1AXEA 4XH9B 5DX8A 4RENA 4EO4A 2PD3A 3FYTA 3L7CA 1W8DA 3PX7A 2GZDA 1HT0A 2V6MA 2ZJFA 1RLTA 1B2RA 4Z3DA 8ADHA 4WCDA 5MN5A 1J22A 1JAIA 1LWOA 1BE0A 1XTUA 2EKPA 2I1WA 2FUEA 1N8KA 1RQ7A 1I7QB 4RS4A 2D1SA 1O5TA 4RGYA 1XCOA 4FOTA 2K4MA 1PRYA 4K6FA 2PH1A 4M7OA 5F4ZA 3COJA 2O0KA 4QUEA 3UZUA 1SM4A 1JZTA 4BAZA 3FAKA 1ENPA 1G66A 4W9NA 1DCFA 3REOA 1R1DA 2QE7A 5HDBB 5IXJA 2O7VA 4BE9A 1NW7A 2JFPA 4UEJA 3D1VA 3SYNA 1BTOA 3LX8A 4H7DA 3NPMA 4O2LA 1XCPA 3I52A 4FN4A 3Q0EA 2DWCA 3ESCA 4O4IA 4PNHA 2GK3A 3QKWA 2XZDA 5CT4A 5THQA 3G13A 1TYEB 1JVSA 1N7JA 1Z12A 1EKXA 2QVZX 1VYUA 4LV6A 1GUFA 5A7FA 2VZEA 5FFMA 2EX4A 1C8BA 2PJZA 3NETA 4MKGA 1UBHS 2PWPA 2O0JA 4QUIA 5E4JA 5M3BA 4A5SA 4MJLA 1GTMA 1N3LA 4J4TA 1FNNA 1W5FA 2BH9A 2MMCA 3IIMA 4RYDA 1GZSA 1RJ9B 2B3TA 3MJHA 1R12A 3EEFA 3T5CA 2BGGA 1CQJA 1W4LA 2AF3C 2XA1A 5D8DA 3KEQA 3JQ7B 4MI9A 3C6MA 2A14A 3GMTA 5JSUA 4BQEA 1PNTA 4ARCA 2JAPA 1IN5A 1CUEA 4ENTA 1LV7A 1QJ4A 4LRTB 2CVZA 1U1IA 4FFWA 4EHFA 4B73A 3V34A 3KSAC 2HWYA 3QVGA 1DV1A 4FDVA 1IQUA 4J7AA 4JZKA 4WDRA 1I0LA 1CUCA 1O95D 1BO6A 2GEKA 3WYBA 4LIPD 2DHRA 1V11A 3T3EA 2KB0A 3S40A 3OBIA 4JI7B 1WZIA 2G80A 4J0JA 3SI7A 3I1IA 5JCXA 3U5ZB 3UH0A 2NZ2A 3HC7A 4EPWA 3OP1A 2X5OA 1UPXA 3ETHA 4YCJA 2WJHA 3IPYA 2PVPA 5BV1A 2OVBA 1QLJA 3HJCA 2PMCA 3OMXA 10MHA 4OEHA 2EYUA 5EESA 2I71A 2CNDA 3O8LA 4N47A 1KJQA 4HAOA 4PX2A 2AYYA 2TMGA 3L6EA 5HG0A 1A9YA 4B2LA 1GHTA 1M2WA 1A7KA 1TIBA 2JIDA 3W8DA 2XH8A 5GADl 4ZARA 4M9XA 3UJBA 3FCSB 3T7AA 2WWGA 2QJFA 5DGHA 3MCTA 1PW5A 4MV3A 4QLOA 2C4KA 3SCZA 1RJEA 2IYRA 2EW8A 4WZBA 2C4VA 3BWDD 3OICA 4I4IA 3JQGA 4XWAA 4EZEA 1PR3A 1BX3A 1UXJA 3GJRA 1FMLA 4JODA 1TL7C 2QROA 3BQMB 4A3SA 3SVTA 4QEDA 4B17A 4HD8A 4WW0A 1AMNA 1BXRB 2WWIA 4P3OA 5EZSA 3D8UA 1A50B 4QXQA 2OBMA 2XPCA 5TARA 1FPQA 4K6OA 1LBEA 3HB1A 1LXCA 5ILQA 4UQLA 1MPTA 3GLFE 2H29A 2B1GA 2WG2A 3TLZA 3NVKI 2ASVA 4J3NA 1WSBA 1TQDA 5AW5A 2NUAB 1XD8A 3KV3O 3THWB 1B3RA 5GMOA 2DKOA 3RH0A 1J2TA 3VNAA 4D41A 3A2LA 2VJYA 3BPSA 3I58A 1I33A 2IELA 1YFKA 3BORA 4QJ4A 4BX9A 2GRUA 3L8DA 1JXMA 4G1CA 1RQ2A 3UAVA 4QM7A 1PV4A 3FYCA 3QK7A 4MWSA 4C08A 4KVZA 4YPFA 1VB3A 3HXTA 3D7LA 2QD4A 3M2TA 4CFYA 4YALA 3VOBA 3LLCA 4QG7A 1FRVA 1R9JA 2Q0XA 1YGPA 3PU6A 3H83A 2NQ2C 3A3KA 1KVTA 4RGVA 1MX3A 4EF6A 1LI4A 3WBJA 3K9CA 4RH1A 1NW3A 4LPKA 1YHNA 3BULA 3OKFA 3WK7A 2ZYAA 3ZZ0A 1EWTA 1AGRA 4NX2A 1JG4A 1NPYA 1YMQA 1UK7A 2XMBA 4IIYA 4QPNA 5CDFE 4X41A 4TMFA 3JD4A 4EGAA 2D8MA 3DLBA 1PDWA 5AKXA 1R74A 2Q5QA 2Q9UA 3OOSA 5E1DA 4EG7A 1FXWA 4TYPA 1DE0A 1ZSYA 3HCBA 5ALVA 3RVJA 1OA1A 4OCZA 5AVYA 4LE0A 1Z2DA 3IPCA 4O2BA 4OBBA 3I9KA 2D0OB 2OAQ1 4OG2A 3ZKWB 4HNGA 1CW2B 2KSQA 4KXXA 1I10A 4G4GA 1YIOA 1X9HA 6YASA 4PAQA 3GDGA 1N8NA 3KT3A 4H3KB 5I9BA 3STHA 3EQ7A 4HQRA 3EXFA 1ABEA 2R65A 5CTJA 4FNMA 5F5XA 4B44A 3H04A 3R7DA 3SC6A 3N0WA 4GX0A 1QHEA 1XTPA 2ZJ1A 2M32A 3R6LA 3IB3A 3F49S 2Y1KA 1BXGB 3G9XA 3KTOA 1SVIA 2GILA 1MAVA 4DVGA 5TPWA 1QGDA 4LOAA 3LHDA 4YMTA 3F8WA 2V4UA 4FEGA 2VNKA 4CG3A 4Z99A 3DE5X 2IYUA 4ATNA 1QNFA 4E33A 1K88A 5IEBA 3EWNA 1N1EA 4HVAA 2ZJBA 2H52A 1XD9A 5F9FA 3GCGA 1U3WA 4LXIA 1EIZA 4LTDA 5HQJA 2C99A 4JX8A 1UBUS 2Z2ZA 4PC2A 3OLVA 1OI4A 4C14A 1Z0ZA 4RXUA 5G0TA 1E8DA 4BL5A 2V5AA 1BGVA 5DNEA 3ETEA 4YUWA 3M7IA 3SYMA 1R10A 4DAEA 2I6SA 5TMBA 4F8YA 1XA0A 3TE7A 4KFSA 2X0FA 1SOVA 1ZM3A 1WP9A 2BP7A 3RBXA 3HA2A 2BKAA 4FYWA 2GJKA 4UD2A 3IEKA 1A82A 4G0PA 4BNYA 1JH9A 2JIOA 1F3OA 3ZVLA 8AT1A 3BH0A 5AKJA 1H4SA 2QTNA 2EZUA 3NWJA 4NFLA 1H94A 1KI7A 4I8IA 4HWKA 1X1TA 3W0LB 1KS9A 2PGIA 2QKYA 1FOEB 2Q2VA 1DJPA 4JT9A 5HSGA 4HC4A 4M88A 2ETXA 2IITA 2BEUB 5KNCH 5GVRA 4TXJA 2RGAA 1T1IA 4U00A 1ZJZA 3OD5A 5AM4A 1G3MA 3TZLA 4TQ9A 3F1LA 1NKSA 2ZAYA 5EE5B 3T3GA 2AN4A 3MRTA 3GZTB 1XKXA 3IVAA 3ORSA 1CUAA 2V6BA 1QS0A 2PAFA 4N5IX 4Q3CA 4WD3A 3VI3B 3VUEA 5GOZA 1JJVA 1ZJJA 2CXUA 3BRWA 2CB0A 4IV8A 4DCCA 2O8EA 4YR9A 3O6VA 1QP4A 1YZNA 4QX6A 1Z6ZA 3DMTC 4AFNA 4LFAB 2XT6A 3JYNA 1RW4A 1N1GA 1P62B 2P41A 4WBXC 3DXYA 3ZLJA 3FHTA 4UKDA 2GPBA 3BWMA 4L78A 2EHDA 4QU9A 3NTXA 3D8RA 4HWPA 4LRUA 1FFHA 3I09A 2WK1A 4BMSA 1VC2A 5B3LA 4K81B 2V8BA 3N3BC 4X1IA 3NVMB 1KIMA 1SCDA 5IVDA 2WYVA 4R1NA 3HNOA 1YI8A 5F7ZA 1ISPA 1S3IA 3EG9A 5TS2A 3SN6A 3DVAB 3G1TA 3HY4A 4JDPA 1DIOB 2ZIAA 1T4CA 4F72A 1PJBA 4ALMA 1ZESA 4EG4A 2C7RA 4QNRA 4U2KA 5BT8A 1KTIA 5DLQC 3D4LA 1D9XA 1N5IA 2IU3A 1K5HA 4YBZA 3KJGA 4EKDA 4V2IA 3IMCA 4GI1A 2QJRA 4Z0TA 1VGQA 3AI3A 1C7JA 1Y6ZA 2ZSFA 2EG9A 2FN7A 1KO4A 2IYYA 3JASB 3KCNA 3HKCB 4PRLA 3FPHA 4CEHB 1Y37A 4MVJI 4RZ3A 4RCYA 5DOVA 4PQRA 1B41A 4W1QA 4PYMA 1RC8A 3CH6A 3FA2A 1FYWA 2BM9A 4L0DA 1E77A 1N0VC 4H7EA 3NHLA 3TBKA 1J9EA 5T64A 3WIUA 4DR5B 1R8JA 4IO1A 1XLTA 1R4NA 2GSWA 4QUKA 2P1DA 3CC8A 1V9SA 1C80A 1G8MA 2ZYTX 3FPJA 3QVTA 4IICA 4PF1A 4UTXA 3VAZA 4F93B 3WTCA 1Y6JA 3A32A 4AO6A 3B1JA 3JZDA 1A0OA 3TIXB 5HIAA 1I3LA 1YAHA 1C9DB 5FO0A 3AINA 2I6XA 3JX9A 3G59A 5U9CA 2CVOA 2Y2UA 2E89A 5IK2D 4MR7B 4RTNA 1A04A 2YY7A 4DDVA 3GCWA 2FJPA 4G5FA 2ZSDA 3UW1A 3PFFA 2D00A 1ZG3A 5E9WA 1I4WA 4FZJA 2B98A 2QTCA 3QF4B 2GGSA 2H5JA 2PJDA 2F90A 1YVPA 4W5QA 1WKCA 4MHOA 1MB9A 3O4VA 4N7JA 3RGWS 3W2HA 4BVAA 2HBRA 1ZH8A 3VM6A 2PUHA 4EEZA 2HXGA 4BQNA 1R4AA 4A5OA 5FPKA 1UCFA 3VJLA 4LF4B 2JJ2A 2CLKB 2FWPA 2YC4C 4F4FA 1C30A 4D96A 3PQ7A 2ZIXB 3AF1A 1PWZA 5FP0A 4S3MA 3WIBA 2C8KA 3CISA 3BA1A 1SY7A 2PT6A 3DV2A 2JGMA 5ALUA 5BVHB 4Q3KA 2NTJA 2REXB 1NW9B 4WQMA 1K7CA 2E9SA 1LSOA 4JH0A 1YNSA 5HK8A 3PQ8A 1JJBA 3QSGA 1NYTA 2Y2VA 1FXSA 1YE3A 2C5FA 3LXXA 4JBIA 4CZ2A 3D8HA 3ANLA 5FUXA 1ZGGA 1KC3A 4TYQA 4EHNA 1URPA 4JLMA 4YJ3A 3X1DA 3H18A 3CGGA 3OJXA 4HS4A 4I4CA 4RA6A 1E1MA 2WNHA 4WOPA 3BX1A 4IGKA 4HS9A 1AQ6A 2BKUA 4WKOA 1F60A 2ZSIA 2X9GA 4HAIA 4HPXB 3ZWWA 3GRVA 4DNPA 1ADCA 5F78A 3NGLA 3BZWA 3RSCA 2VPYA 4TUYB 1YCHA 1OI2A 3K0EA 3Q41A 1JEDA 3LW8A 1EPUA 4YLYA 3DLIA 1WBBA 5THXA 5EEGA 2XRFA 1RPZA 1JE1A 5ENVA 4TWBA 5HDQA 1N5KA 2IPMA 1SQ0A 4DIOA 2EW1A 1E0JA 4MRAA 2H2WA 3R4VA 2QN3A 2IXTA 3IVRA 4XGKA 4CEHA 1RLUA 1PUIA 3M6VA 4AWXA 5BV0A 3H8SA 5FCDA 4WBNB 3T38A 1JBQA 1K3TA 1VBNA 2DP4E 1JDZA 2BFEA 2ZR7A 1G55A 3CLRC 4FFBB 3KJQA 1NE7A 1SUPA 4G8CA 1WHSA 1KIFA 4M0DA 1PR6A 5DHRA 1KSGA 3A0RB 4Y0NA 4U3JB 1H42A 4KSBA 1W5BA 1RRKA 2Y0DA 4PZ0A 2CFRA 2GASA 2ZTSA 2LCQA 5F2NA 2XWJI 3ANTA 4TTVA 5FTNA 3WDMA 4KX5A 1D8TA 1ZVVA 2XOKA 3MD9A 4W1RA 1DAHA 4NECA 4DSUA 4XW2A 5C31A 2IXGA 2JDIA 4BNWA 2DPGA 2A5LA 1O95C 2H4XA 3VPBA 4WACA 3NKVA 4Q6BA 1MNQA 3I6QA 1W19A 1GQQA 2FG7C 1P6XA 1XXHA 1XVTA 4MH0R 3TH5A 2CXTA 4YCSA 1KMHA 1U0RA 3G0CA 4TYYA 3ZXXA 2HLNA 3T3OA 3K2EA 5AJYA 2H17A 2Z04A 2Q2NA 1JECA 1LTQA 1IY2A 2IX9A 1S89A 4FT4A 4MR8B 3T5MA 3T3HA 4XDHA 3WGIA 1X3SA 3OCXA 1IDN1 2HQBA 1JJIA 5J2UF 1EMDA 3NBXX 2HKIA 4WY5A 5KQSA 2I62A 3ZD6A 3O1HB 2R60A 1NFRA 5I4BA 3KWFA 1ENOA 1XF9A 3ZGVA 1P2VA 1P45A 4JJ6A 3EIQA 3AZPA 4Q9NA 3A6DA 1TT7A 2R11A 2VP6A 3I4FA 3MGCA 4MQUA 1HKHA 4IV5A 1UEJA 1QX3A 2PH7A 2H0AA 2W6ID 2D4AA 2W6NA 3KRTA 2GJ4A 4NG4A 5CVEA 4MHTA 1A72A 3GT4A 1IE3A 4FYPA 3H2BA 3BFPA 3M6FA 3L0ZA 4Q5IA 1UP6A 2NUPA 3FPSA 4XPIA 3SHQA 3VAYA 3H86A 4ETNA 5CA1F 1LDBA 2HHHB 5F98A 4GLLA 1YFLA 2PH3A 3HG7A 1IXRC 5JJBA 1AGXA 2CDNA 4CDRA 3AKDA 5AW2A 3Q3IA 2CSXA 2ZCJA 3CRW1 3F1KA 2QN6A 3SSNA 1GZ3A 1M1UA 2GF9A 3R5SA 2VPIA 1PZXA 1I80A 1H4QA 3AUFA 1CSEE 1PWEA 1JYFA 1S02A 3D4BA 3DOUA 3O4IA 4XOIA 1GL3A 2VKQA 5IT4A 5LWHA 3CJTA 3VISA 2O3JA 5JNVA 4HCJA 2OM6A 3IAM6 3TX6A 1GRCA 2QRLA 2RKOA 3T8YA 1Y3HA 1SCUA 4WCFC 2RGCA 3O8BA 1GR1A 2G17A 2I1LA 2SKEA 4RETA 2O2ZA 1TPYA 4EY3A 1U1EA 2H8KA 3WYEA 1LBIA 1V3UA 2WUWE 3E18A 5EZ6B 3PQEA 1F9EA 1ZMXA 1EVIA 1UBSB 4ZOQI 5AM2A 1XDBA 1X15A 3LXMA 1JEYB 2F8MA 1TW2A 1EVEA 2ZI3A 3OHMA 1H1TA 4G0QA 3EQZA 4LE1A 5F4BA 4AZVA 2ZYSA 3CUVA 5CJ2A 1GPJA 2FWBA 4MQFB 2M2IA 2IEAA 3ZHQA 3RYCB 4UVIA 4WXHA 4ZMSA 3CS3A 1XLVA 4F5WA 4R3UC 1JHQA 2FCAA 3KKKA 4E2WA 5GIOE 5IT9A 2AUTA 3EASA 3UHJA 4JYZA 2A9KA 3QNWA 3F3MA 2IC5A 3I8SA 5A4FS 2CLIB 1U0FA 3HMQA 1DTEA 1JALA 1IBMB 4YUAA 4TYWA 4CIAA 2IHJA 3WJ1A 2Y71A 4U2DA 4OD0A 1ZUNA 1YVEI 4GGOA 1MTZA 5EVJA 4TKVA 1MF7A 2VHXA 2A57A 4RDIA 1A97A 1EVYA 4A10A 1T5DX 1OXBB 2WPDA 1F2VA 1GKLA 1CX9B 2P40A 4JOSA 1B76A 4P54A 5IDWA 2QYSA 3JR7A 4OQEA 1H5NA 4QIHA 4JENA 1BRMA 2C5GA 2BFDA 1ST3A 4CU2A 1W59A 1QCCA 2V7QA 3FXAA 1GA4A 5CT9A 1UBLS 2RHOA 3IQXA 5LUAA 2IYNA 1O0SA 3IR6A 2Z1NA 3MWGA 3WHPA 3ZZ1A 3SBEA 1AIPA 1X7YA 3RAGA 4G0OA 3ZE6A 1EA7A 2IUSA 1B6RA 3U13A 1JXQA 1HZJA 1V2HE 1VSQA 5AVZA 1N5RA 1NX6A 4BVJA 3V1YA 3DW1X 2IE0A 3OZGA 5AUQA 3HBLA 3H1BA 2H2IA 3V8EA 2Z4TA 5B2EA 2JFXA 5J2UB 4OLAA 2HA6A 2QVBA 3GC6A 3I9FA 4BRZA 1MIHA 3EPKA 4G65A 1GZ4A 4CHTA 2PS1A 1A4XA 1O8CA 5CLQA 1VP9A 3A3PA 3LQRA 3OOJA 3AOEC 4DIEA 1U0EA 1Y5LA 4DWOA 3KJIA 5JI3E 2O59A 5DHQA 2AFRA 2OV3A 2YWFA 1ADYA 3QI7A 1KAOA 4FYHA 3DD5A 4WJLA 2YVUA 5J5VA 2ACVA 2FEMA 5CHEA 5CM2Z 1QG0A 3KO8A 5E1BA 3DM9B 2HK8A 1DKNA 1LSUA 3WGNA 1QOPB 3GUZA 1SOUA 5DE3A 3A9CA 1FP2A 1KU0A 1NOJA 3B2EA 3Q5EA 3R0ZA 5ALRA 3JCZA 4ZO6A 5TVKA 1XV5A 5TJ9A 4K8OA 4RVFA 5EGNA 1Q1QA 2VJPA 3FZQA 3KJNA 3NP7A 3KXIA 1W5EA 1QFZA 2WUEA 4X20A 1KVUA 1U7UA 2PMKA 3VZCA 3SEQA 4ZVVA 2G36A 1XOIA 2PWBA 1NR7A 5CVCA 4M7WA 3ZHUA 1SCKA 4OJKA 1I5RA 2QIOA 1ZQ1A 3GGDA 4U4AA 3CBGA 3R0QA 3R7FA 2F62A 1GAJA 2FQWA 4DEYA 3L7MA 2XAUA 4KZPA 4CEJB 4L85A 1QGED 2FG5A 3LT0A 2JLRA 3V1TC 3U0BA 4OY3A 1C0PA 4FCCA 5F23A 1CUZA 4YCNA 3SKYA 4E3ZA 4ZT6A 3QEJA 2DFDA 3NT4A 4DGSA 2FQXA 1U0SY 5D3KA 1YULA 5AI6A 2FDCA 3HFJA 4R5HA 3ZXSA 2E1PA 2JB9A 3X2FA 4OXNA 3IAXA 1LPMA 2VT3A 3AIIA 2AOVA 4G5HA 4WNAA 2V7PA 4M0PA 4DDMA 3AY6A 3WL4A 1W7AA 1T6NA 4DYHA 1AQYA 5CRIA 4M9RA 4BLWA 5IWCA 1CUUA 3OCJA 4PZUA 5DI9A 1IZZA 3JWGA 1VE3A 3ZD9A 4FN5A 2WJ4A 3PNYA 4RD4A 1YMVA 1YE8A 5B7PA 3D0RA 4REOA 2AXPA 2FEKA 1ZGZA 3IOMA 2B30A 3LFHA 4D8YA 1JQLB 3VKWA 4R6WA 3ONNA 1QYCA 4XWWA 2FZEA 4X20B 2BDUA 1OWPA 2Y76A 4NBWA 2E48A 4P08A 8GPBA 3K7EA 3N7TA 1I4EB 2DHCA 4B8WA 4UW9A 2QORA 2EFCB 2PYZA 1GNSA 1L6RA 3SHWA 2WY2D 3CLUD 2Y99A 4GI2A 5K3AA 4BB6A 4FHEA 2H1SA 4D8WA 3IBSA 1C0IA 1DUIA 4P4NA 4RQTA 2ZIVB 1K89A 2DT5A 2J7KA 5DTQA 2BGUA 3V6LA 2CL6X 4B8ZA 4BX8A 1ZD8A 3EIWA 2OYCA 3G2OA 3TEFA 2YJGA 3IKVA 1P2UA 3A27A 3WL5A 4HNTA 3ET5A 4KODA 1Y9AA 4QWWA 3MERA 1TYZA 3KEMA 4PG8A 1K66A 2OV2A 3IV9A 3MTIA 3FE2A 4ETIA 4DWJA 3AR7A 4OVKA 2EKDA 1YACA 4KR9A 3AGPA 4FTWA 4GU5A 4D44A 3BSFA 3A06A 1HC7A 4LZAA 2I2WA 2O7NA 4YJKA 4FMPA 2Q3HA 3OF2A 3TQHA 4X92A 4YR7A 2C9YA 3T61A 2W90A 2YTZA 3AKEA 1JHZA 2AUMA 4XX0B 5LQRA 5EKDA 2X5NA 4H3HB 3TVYA 2DOKA 1FU4A 5KOJB 1C3XA 4R2IA 4HQKA 2TMDA 2VUUA 4FNAA 4U7PB 2PRIA 5BNIA 5JAZA 4EMBA 3LMKA 2QMHA 4GYWA 4N3AA 2XNKA 1I7LA 4CQMA 4OL0A 1UQTA 3EVEA 3OZXA 3C3WA 2JI9A 4H4CA 2B9VA 1YZQA 4FKZA 3ZWYA 2FVXA 1UC9A 2WA2A 1SIWA 1DO0A 3PFCA 5AK0A 1LI5A 1NAHA 2XD4A 3BTVA 1YV9A 3U6KA 4ITUA 4IJQA 3SLKA 4I2VA 1SUAA 3Q9UA 5CVTA 1ZK2A 2VPQA 4L5IA 5I9NA 3TJZA 4B6OA 4RHYA 2YZ2A 1MC5A 2QTFA 5CLGA 5CX1B 3AT1A 1S1CA 1T3TA 2PPLA 4BBAA 1E2EA 1L7QA 1S6YA 3EGXA 1TF2A 1AX9A 1LS1A 1OGJA 2AMYA 1SVNA 3VDNB 4HDOB 2I76A 4TKVB 5EXSA 3RIMA 2BN4A 1SUDA 3KOXA 1XZMA 4XEUA 5IT0A 2WNIA 5A9TA 2IDJA 1T2UA 1NBMD 1VHWA 2XTMA 1S8FA 2Z57A 4F12A 1LPOA 3O2JA 4I1VA 5IJ0A 4WKPA 3D2AA 1JDBC 2EFHB 3IT2A 1I6KA 2C03A 3H9BA 4Z8XA 1JLLB 2YY6A 3QOWA 5EHNA 3ASYA 1BROA 4KH1A 4LXQA 1OHHD 4R2KA 4YYEA 2ZT6A 3K5PA 4M9UA 1PK8A 2RHWA 3KC2A 4D6YA 3HWWA 3K0CC 3IMFA 1ONPA 2UVDA 7ABPA 1P3JA 1E2NA 2Q4TA 2QI9C 4IYRA 2CLHB 1DQPA 2E4ZA 2PRYA 2VPWA 3U26A 4IHKA 3OZCA 3VNBA 5HKKD 1JEYA 4B80A 1MCZA 4MP3A 2RGYA 5HUHA 1GPAA 1Q50A 2OGUA 1OTHA 1EWKA 1KY3A 1IZ7A 4KC0A 1V8FA 3B3AA 5EHZA 4IGAA 1EESA 2NVWA 4OSPA 1QH8A 1QYVA 4R8RA 3Q12A 4YRRA 1NVTA 2R4UA 4TKMA 3WO0A 2ODAA 3EZYA 4JBXA 1C3LA 4KCGA 4WUTA 1JHRA 3EB9A 1JIIA 4Y0VA 2O4UX 2Y4NA 5J9FA 3JVVA 2BEUA 3MCUA 1EDBA 1J70A 4N7MA 3TM5A 2B0CA 2KE5A 1U80A 4P5DA 3UGKA 5B55A 3PBKA 3L92A 4YECA 2IOHA 4QNMA 2WI8A 4F2HA 1EGVB 3E2IA 3F6EX 3RASA 3OE7A 4TZKA 4FI3F 4XUCA 1W4ZA 2BEKA 1KHTA 4HH4A 3KLMX 4ERXA 2A0XA 1C4OA 1QHNA 3NUZA 4F3RA 1N2ZA 2Q3LA 1L9XA 1Y1PA 3HKEA 3MJDA 1XG5A 3JS5A 4OU4A 2IIBA 1VLHA 1U7WA 2PKWA 1T0IA 2NPOA 3PHCA 5LXTF 4CIYA 5AM0A 1QE0A 4CG0A 3PK0A 1OFTA 2DH5A 2BP7B 4GLBA 4H15A 2VYNA 3NUQA 4PPQA 4Q7EA 5JZMA 4R9VA 4EL0A 4J1TC 4L4ZA 4OHKA 4BJ1A 2P2LA 5FNZA 5BXYA 2AMLA 3ZR4B 4UBNA 1E5DA 4RVUA 4F4JA 3SIRA 1FNDA 1L5FA 2WAAA 2OK8A 1SG6A 3OQMA 2NTNA 3FRJA 3L40A 3PJDA 4FYXA 3AHGA 3JQDA 2Q3DA 4YDSA 2X2OA 4KQ9A 1Z47A 1QHSA 1U28C 2RGNA 2XADA 1PX0A 1HLPA 4GYJA 4RVDA 3KSDO 4RORA 4ISCA 5AHOA 4EG6A 1K7YA 2OBNA 4P86A 4JU9A 1JA1A 1NV8A 1N5JA 3SSOA 2W37A 5KYXA 2FSHA 4K1XA 2OBLA 1HL7A 2QRPA 4JXJA 4QFCA 1EUCB 4IIGA 4FR0A 3MS2A 4ZHQA 2GT1A 2J6CA 3P71T 1AZWA 4CL2A 5SZIA 3ENZA 4RVNA 3KZNA 4RLFA 4NNJA 2YWJA 1A9RA 1MQ9A 2QL6A 2UZ1A 4MQBA 4P5PA 5CNMA 3TD9A 2WM3A 1E63A 3OZTA 5DBHX 3X0DA 1P2TA 5FI5A 3HCAA 4RPJA 3GW8A 2IV7A 3TBHA 4W9MC 1MXHA 4U6SA 3LUPA 1PJTA 2X8JB 4U3JA 2J85A 4HNRA 3RYFB 2QWXA 3REQA 1K7EB 4B4DA 3VTFA 3O91A 3QA3E 1Q0HA 2EQAA 1H6AA 1USKA 4F3YA 4RVHA 3P8ZA 4ECEA 4LMRA 1QX4A 2GO1A 3L1UA 3T52A 3WLEA 4BP1A 3TTSA 5KQGA 1YZFA 3D6UA 2AK3A 2AOUB 4DLKA 3JTEA 5ESWA 3OUTA 1M5RA 4XLZA 1YJXA 4S1WA 1NSYA 2CF5A 4U7JA 4INZA 4H3VA 1DO2A 1LQUA 3P9KA 5I5GA 3RJMA 1RQPA 3MCVA 1Y9ZA 2DTDA 1J8YF 1ZS9A 2HDNB 2XKBA 3D81A 4FCVA 5EMJA 3MOIA 5KJEA 4WESB 3WIVA 4C1BA 4IMRA 1V6AA 1P80A 3IJPA 4RF4A <