2PRSA

Structure and metal binding properties of znua, a periplasmic zinc transporter from escherichia coli
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
284
structure length
263
Chain Sequence
AVVASLKPVGFIASAIADGVTETEVLLPDGASEHDYSLRPSDVKRLQNADLVVWVGPEMEAFMQKPVSKLPGAKQVTIAQLEDVKPLLMKGDFNMHLWLSPEIARATAVAIHGKLVELMPQSRAKLDANLKDFEAQLASTETQVGNELAPLKGKGYFVFHDAYGYFEKQFGLTPLGHFTVNPEIQPGAQRLHEIRTQLVEQKATCVFAEPQFRPAVVESVARGTSVRMGTLDPLGTNIKLGKTSYSEFLSQLANQYASCLKGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords High-affinity zinc uptake system protein znuA
publication title Structure and metal binding properties of ZnuA, a periplasmic zinc transporter from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal transport
total genus 92
structure length 263
sequence length 284
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2prsA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2prsA02
3MFQA 3TNYA 4DBLE 1MIOA 5GGYA 4WN9A 1MIOB 1H1LA 3ZK8A 2XY4A 4WN9B 4WZBA 4K3VA 1H1LB 3ZKAA 5KOHB 3MWGA 4WZBB 1PSZA 2PS0A 1M1NA 2O1EA 1N4AA 1M1YA 3AEKA 5M29A 3EIXA 1EFDN 1M1YB 3K1AA 3MD9A 5M3BA 3AEKB 3HXPA 3K1AB 4WESA 4HMOA 4INOA 3G9QA 4WESB 3LI2A 2PRSA 4ND8A 2YNMD 3AEUA 2XUZA 4N01A 1K2VN 2PS3A 4LJSA 4TKUA 2XV1A 2AFIA 2PHZA 1L5HA 4TKUB 5I4KA 4M7OA 2AFIB 2OV1A 4OXRA 3ZTTA 5JG7A 4FI3F 4NNPA 2WI8A 5KHLB 2XQVA 5GGXA 3MINA 2R7AA 2M6LA 5HX7A 3PSHA 3MINB 1FP4A 1N4DA 4OVKA 1M1NB 2MINA 1KAEA 1ESZA 4WNAA 1FP4B 1M34A 2MINB 3TLKA 2X4LA 2M6KA 3ZK7A 4CL2A 1G20A 1M34B 4B8YA 4XPIA 5BVGA 3AETA 5CX1A 1K0FA 4UDOA 1N2CA 1G20B 3PSAA 4XPIB 5BVGB 3NU1A 3AETB 4FILA 3LHSA 4MX8A 1KARA 1N2CB 3HH8A 4FNAA 4WZAA 3EIWA 1KAHA 4ND8B 4WZAB 4INPA 3AEUB 1QH1A 4MO9A 3BE5A 1QH1B 1L5HB 5JJ5A 4UTPA 1XVLA 5B58T 4MLZA 5BVHA 3AERA 4H0FA 2WHYA 4BBPA 1K7SN 5BVHB 3AERB 4IRMA 4UTOA 3GI1A 4WNAB 4HMPA 5HDQA 3HJTA 2OV3A 1QH8A 4GICA 4NNOA 2AFHA 3R5SA 1QH8B 3BE6A 3R5TA 4G07A 3TEFA 2AFHB 5CX1B 2R79A 5KOHA 1QGUA 5JOQA 4H59A 5KOJA 3MWFA 4PAGA 1QGUB 5KOJB 3UJPA 3AESA 4TKVA 1G21A 1N2ZA 4PM4A 2OSVA 3AESB 2OGWA 1TOAA 2QI9F 4TKVB 1G21B 4FKMA 3PDIA 2XDQA 3AEQA 2ETVA 4HMQA 1K75A 2Q8QA 2XDQB 3AEQB 3CX3A 3PDIB 4LS3A 2PS9A 5FLYA 5AFSA 2YNMC 1PQ4A 4HN9A 2RG7A 2XH8A 4OXQA 4UDNA 5M2QA 5CR9A 4G09A 3U7QA 2Q8PA 4MDYA 5JPDA 5M34A 3ZK9A 3U7QB
chains in the Genus database with same CATH superfamily
1H2FA 5I7WA 2O05A 1BYIA 2Q5LA 4RZUA 3WYCA 1XVUA 3AB7A 5I9NA 4FC6A 5FYQA 3C8ZA 4LGCA 4IS2A 4EP1A 3EYAA 2VSOA 1Y63A 4WINA 3VXKA 4P08A 3ZIAD 1CHDA 3C3AA 4D46A 1B0PA 1IWBB 1QRRA 4UQPA 2GILA 2M1ZA 3LKVA 2IIVA 2NGRA 1RZRD 1YRQA 3DNFA 1DC4A 1GTJ1 4KZKA 5C53B 4A91A 3LQ2A 3KQUA 5I01A 3H5RA 1UMKA 2EERA 2ZUWA 3MMSA 5E2IA 3DT9A 1R3UA 4ZEOA 5TS3A 5DI9A 3TR6A 4XVCA 4RD6A 1R8YA 5REQA 2JFXA 2GM9A 2QUJA 2XYRA 2QVYX 2FPIA 1N7JA 4EMTA 3DBOB 5TV2A 2IHBA 5CEFA 1QHGA 3B85A 1Z4MA 1Y9AA 1PDVA 2BZ1A 2CDNA 2ZAOA 2VHXA 2NU8A 1MPXA 4M3NA 1ZWKA 5DP2A 2GNPA 4PG8A 4HB3A 5LQMA 5DYGA 4PYNA 4R2WA 1HE1C 1H8EA 2BTQA 1LPNA 3NM4A 4DOMA 2CYAA 3LS2A 2C58A 3T7KA 5YASA 3ENZA 2C98A 1WMBA 2XB8A 3SU8A 4C3ZA 4C7OA 1LC0A 4BFZA 1Z8DA 3P2IA 4P3KA 3KTOA 3S3TA 2XQVA 3T3EA 3JR7A 3L02A 3Q1KA 3GRYA 5K0JA 1Q2XA 5IDVA 1QG0A 2P5TB 4GI7A 1VE7A 3KHKA 4MS1A 4KQGA 4K0KB 3PXUA 4NAUA 4MUBA 3U4QB 1XL0A 3O4IA 4JD5A 5H0IA 4O4JF 1IY0A 2XUAA 3CLTD 4K40A 7REQA 3A0RB 4G4SO 1THZA 4V0MA 1F2VA 3LNTA 3GROA 4LHXA 3BSFA 4X1YA 3HA7A 2ERXA 3R6WA 2PH3A 2K4MA 4Q4HA 1DIRA 3ESXA 5JYEA 4EG3A 3PJFA 4H1UA 1UF9A 1E18A 1CP2A 2WJ4A 3UJ8A 1QO7A 1RP7A 1GD1O 1Z5PA 1Z73A 2D2VA 2QTBA 2BRUA 3KZMA 1GPH1 1NHWA 4RPLA 4NZPA 1KH2A 3QLTA 5DZSA 4MW4A 2WHXA 4O5OA 1YL7A 3DMYA 4M83A 4OA5A 1QYWA 3D3JA 1FQJA 4R3UC 3VAZA 4DY4A 4PN3A 4DZTA 4D4LA 3FROA 3GB9A 1OC2A 4CEIA 3BSSA 2RD2A 4MKRA 1LVUA 3FB1A 3V8EA 4ESEA 2QJTA 4FE7A 2Y1WA 3PUXA 2CWWA 4UVHA 1CUHA 4OQXA 1SEVA 2IH4A 1XVTA 1XNQB 4QU8A 821PA 3FLAA 2GCOA 5DI3A 3ZH2A 3OOJA 4U9UA 3IUMA 3VKWA 3ZG6A 1ZZEA 4IXDA 3FHJA 1PEKE 2VBCA 2D5BA 2B3TA 3H0CA 1LPSA 4GEGA 1P75A 4NR0A 1IL0A 5AVOA 4E7OA 3DVAB 4PGMA 4P22A 4DMRA 2XUJA 1SCKA 2OV6A 2ZYSA 5EZSA 2V3CC 1M1UA 5EJIA 3ZVNA 1U7TA 4CLEA 2X42A 1JB9A 4F1WA 1LA2A 3EODA 4EDHA 4F4CA 4H27A 5KX5B 3AEQA 2F48A 4KX3A 3UANA 4EJSC 2V0GA 2XB2A 4B2LA 1NPYA 4BIIA 1W46A 4INJA 1E8DA 3TLJA 1J5XA 1OT3A 1R8SA 4RZ3A 1OFTA 3U81A 4F4FA 2AZTA 2EHJA 3U7QA 2Q1YA 4TSFD 5A7HA 3VR3D 1Z5VA 3FVRA 3IJ5A 4PLFA 4BP9A 4DC9A 5EWMB 2G06A 2G67A 4JQCA 1AKRA 5WRFA 1YS4A 4JASB 2YY5A 1JQLB 1B23P 1WUIS 3B8HA 3ZE9A 5K03A 5LR6A 1X94A 2UVPA 4OXIA 3DLPX 2WKWA 3R7DA 4IVRA 1OI7A 4ZOBA 1Q14A 1OH8A 1JTEA 4K2HA 4QAJA 3E1GA 2Q7OE 3WLHA 1V16B 3ZJVA 4ZVKA 4IILA 1DTWA 1E58A 2ZRPA 4RK6A 5LBIA 3ZE1B 2FSSA 4OQLA 3SSOA 5K6TA 4UUPA 2Y27A 4Y9TA 2GF9A 3NAQA 2P6RA 2E6KA 4P6VF 2GERA 4LHEA 5KDDA 3SJBA 3MOSA 4FM9A 1NULA 2IEIA 2ONJA 2BZGA 2WE7A 2X8WA 4F2GA 3U4MA 1Y1RA 3BQNB 3K96A 3PEWA 2DC1A 2JCGA 3CNQS 4FMCF 1IUKA 1IVSA 5SYNA 4EEKA 4O1HA 2Y77A 1R0RE 4ND8A 4ERNA 3TGPA 3D6JA 3FYSA 3OF3A 1NFRA 4LSZA 1IXSB 1TCCA 1FPMA 4DDUA 3K0CA 4JOSA 3ZU3A 5LNK6 1QP4A 3HK2A 4MS3B 1CF9A 3DAPA 2FFHA 2GO1A 1BTOA 2RC5A 4DDVA 5TQ0B 2JBAA 3WGNA 1JN0A 2DHQA 2DERA 2Z09A 5EGNA 1C3OB 5L4NA 1ODLA 3ESRA 4TLBA 2FN8A 1W44A 1OPXA 2ILVA 4U0JA 1T1SA 1N9GB 2IWHA 1Z0IA 1KY3A 3IIJA 3CE9A 1QP0A 5CPBA 1HT2E 1TVMA 1XMPA 3KR2A 5BNZA 4DR2B 3CB4A 1CYDA 1M1NB 2VRCD 3ASUA 3EVAA 1MA0A 4UEWA 4MGHA 3VPCA 1GKIA 2R96A 1YTUA 1YHNA 4OHRA 5J47A 4RD2A 1QQBA 3IUYA 1UMCA 5BVGB 1I5RA 2R25B 2EJVA 4H1VA 4LCBA 3BMNA 1C2TA 4Y2UA 1P9WA 3HJBA 4K9KA 4CTMA 4ZC1A 5D2CA 5T8KC 1EWQA 1S7CA 1RYMA 3CF0A 4AJLA 1E9SA 2AJLI 2HMYB 1LI7A 3BC1A 1FTGA 3HCEA 4JKIA 4BCDA 4CL0A 3EEFA 1OA0A 2XMGA 4Q03A 2XXAA 3QE2A 1SC6A 4MUXA 1M1YE 1VZ2A 1ZXBA 4OQEA 1YR8A 1SD2A 3OHSX 2VA8A 3VSCA 1J1ZA 1FSGA 2YMMA 3WBFA 1XU9A 2AXNA 3GBVA 4H0FA 3T9EA 4AY6A 1E9AA 4WY8A 1RXYA 5EJ2A 4DV5B 3H1BA 5KYXA 4IR7A 1MU0A 4QYIB 2MU1A 4P53A 2QZPA 3A05A 3JQ6A 1VSBA 3ESQA 4ZAWA 3RG2A 1Z0AA 2FWMX 1THTA 2I34A 4C6RA 1WSBA 2HGSA 4UHDA 1UDBA 1THMA 3ZGNA 1U8YA 1JJBA 2CFIA 1F06A 3N2KA 3O94A 1ODCA 1N5OX 4MEBA 3EA4A 5EC8A 5JZOA 1N5JA 2HSEA 4HD8A 1BJKA 4DCTA 1V4VA 3L06A 4IKOA 3DLHA 1RZUA 3I9MA 3VUEA 3WWYA 2ZCJA 1MH1A 1A9ZA 3WP0A 5LWHA 3V2IA 5DYWA 3V1YA 2N47A 3HB4X 1UQTA 1WZNA 2YJTD 2LKDA 4FE4A 4LECA 3VMMA 4CGZA 4EGCB 4CEJA 4UOEA 1VQ1A 3ST7A 1CZUA 6NULA 1L4LA 2X76A 2P2NA 2A6PA 3G9UA 3NB0A 3RIXA 4P4NA 5DW3A 5AJYA 3IRUA 4EO7A 2IH5A 4AYTA 2XGJA 2DF8A 1ZRHA 2XKJE 2B35A 3IE1A 2P79A 4FFBB 3GDHA 3L0YA 4L4UA 4YJFA 1QIHA 4ZOLB 3X1XA 4XYLA 4PZ0A 4XB6B 2JHCA 3TTUA 1XGKA 5KQPA 2GBGA 2OQVA 4EI7A 3MWGA 1ZD3A 3RHZA 4W1QA 5I7VA 1XOIA 2JI6A 4L07A 4HDMA 2IPLA 5LM3A 1KGSA 3I2KA 1F9AA 4WTOA 4C04A 4E15A 2OZPA 3KM0A 4INAA 4DMHA 2IP2A 3DE1X 5E1MA 3DUWA 4NG4A 3A9SA 2DXIA 4MNTA 1IC6A 1BAPA 1T5BA 3B2NA 1J0BA 2PGJA 2GEDA 3QHPA 1JX6A 3NHFA 3QXGA 4I9UA 5JD3A 3OU2A 5EJAA 3JWJA 4CKYA 2OAP1 2UU9B 2IUFA 3QVXA 4JJIA 1YR3A 1JFLA 4UZFA 1D2GA 3I2FA 5CVEA 4II3A 1NG9A 3N1UA 1UM9B 5GIOE 4PLZA 4F3RA 4OGLA 2DQZA 2BCGY 3D0QA 5KHOC 2IUUA 2JJ2A 2JEYA 3A4IA 2O48X 3EEIA 3RU2A 5I4KA 2NU7A 3EGWA 5AKGA 1K06A 5FPPA 1QZUA 3R3HA 4NNPA 1IHXA 3VZBA 1E3EA 2WI8A 4KWIA 3GWGA 3I4CA 3K4QA 1ZU5A 2D3TA 4A2WA 2GRJA 5DNVA 4BNGA 3A26A 1FP4A 3HEBA 5JD5A 2CW5A 1PW7A 1TQDA 3KYJB 4BFTA 3ZV5A 2L18A 2PLRA 3QVLA 4LVNA 3D3KA 2IYAA 4IEFB 3FKJA 2QMEA 3I32A 3MS2A 1N2CA 1C4XA 3DDSA 3HUUA 1XN1A 3OMLA 4NG5A 4F2DA 1RZVA 1GPYA 2V4ZA 2W2MA 5BNFA 3ISVA 4G0OA 4JQZA 4MRNA 2CE2X 3HJFA 1ISRA 1EVIA 4KQJA 4GG1A 4J90A 1WNTA 1ZFNA 2J31A 3ESAA 4EM6A 5B7PA 2OKGA 1YB5A 4Q12A 3IDOA 5F2KA 1OZGA 5ALGA 2P41A 5G0VA 5LP1A 4L9RA 1XKQA 2Q4RA 4IMRA 3PGLA 4X8MA 3ZDYB 3FFXA 3UFBA 2UKDA 5CX4A 4GIBA 1YFLA 1H2BA 2AR9A 4PS1A 5E4TA 1UBCA 4FMDB 4OX9B 3R9WA 4ESHA 1F8UA 1QNLA 1UM8A 3AERB 1OXTA 3FPGA 4E4TA 1C30B 4W4TA 3IV6A 4YT8A 5ALTA 2WPDD 1SUWA 4CMEC 4F5YA 2AZMA 5DYNA 4CW7A 2WG2A 5IKEA 3FTPA 2ZT5A 2H48A 1V6CA 3ZNQA 3KQQA 1E5XA 5ILQA 3TE7A 1FFBA 5HEKA 1MDFA 5GMOA 4AO7A 1QAQA 2VDPB 1JF8A 2FUEA 3IR7A 4LHZA 3V4ZA 1G19A 1B8OA 3RUAA 2O4UX 4GI2A 4PCAA 5A4MS 2HW8A 4H2DA 1PZGA 4W5OA 4J03A 2W11A 5HDBB 2GN0A 5I9BA 1JDUA 4XD7D 4U2EA 1JEOA 3ETLA 2GPYA 1PD0A 3OICA 2CEAA 9LDBA 3OF2A 1JZTA 4B84A 2ROQA 3MJFA 3NEAA 4IFTA 4KVZA 4CLDA 3VTKA 1YZLA 3BHIA 3WOHA 1WXHA 3WIEA 1M0TA 5HWSA 1JIIA 2XWSA 3C3EA 2EJUA 3MWEA 2OLEA 2R1TA 3QTTA 3UEOA 1SBNE 1RADA 2WIJA 4M7RA 3ER8A 1NVEA 1JTFA 2NU9B 3VDMA 2OP0A 3U39A 3M4YA 1PSDA 1EJ6A 1YQ9A 4CT0A 4UCQA 3TQCA 3B3AA 1P1JA 2AW5A 2R6DA 2A7XA 3R9XA 3DONA 3LC2O 4MVCA 1UIMA 2DE0X 1WMSA 3B9RA 3K05A 3FR8A 3E9DA 3T3MB 5EP3A 3FBWA 1GQOA 3VU0A 2YINC 3KYDA 4DTIA 4GQBA 4ZGWA 3F5SA 3CNNA 2PS0A 4XCXA 3RABA 5CFOA 3R5HA 2QX9A 5JYBA 1JB1A 2O5CA 4PRLA 1D2NA 1FJXA 1XRRA 2CNWD 1FU4A 1NBME 2ORIA 5DB4A 4C3VA 4DEVA 3LOQA 4N6OA 4ZWNA 3HMKA 1M7HA 3AKEA 3KZOA 4QGHA 1G6HA 4L5BA 3RV3A 4RCZA 5CHEA 1Q5PA 4YRIA 5T57A 4JUIA 2OV4A 1XXLA 3FWHA 2VP2A 4X66B 3UWSA 4EYKA 4HEA6 2FV8A 2A8YA 5AI9A 1NI3A 1F14A 3SC4A 1OB5A 1K8RA 1Z22A 4DIFA 4PRKA 3KETA 2V3VA 2GJSA 1IQ0A 2YMQA 3EA0A 1C9KA 4MRMB 4DKXA 3AG6A 4MKXA 3G0GA 1JKMA 5AJVB 2QU7A 2XKAA 5AOAA 5F52A 1AU9A 1GUBA 3A36A 3EXHA 2E3JA 2B2CA 1YCFA 3MINB 4HADA 4IJWA 5FWDA 1PVVA 4ERXA 5CBKA 1QBKC 1XMXA 3NO4A 4LTNA 4BFXA 2IITA 3MJVA 4EA6A 2HA2A 1Z6YA 1GARA 5C35A 1CEYA 1I3LA 3W7BA 1BE8A 2I6GA 3CVUA 1FLVA 5JAUA 3TK1A 1LFAA 3G1WA 4GE0A 1F0YA 1KZ7B 3OD1A 4LHYA 2MSWA 2GSDA 2YFKA 4HNTA 1E9EA 3PJGA 4OL0A 2XD9A 4FQ7A 4WCFB 3DHYA 4O0MA 3GBPA 1KRHA 2OO3A 2VJKA 4XYMA 5KKNB 4L0QA 1Z38A 2AMYA 3IX7A 2VNAA 2WIGA 1YRYE 3H4TA 3C5VA 5JARA 2HNBA 4HY3A 5HTKA 4QSMA 2GT1A 3SVLA 3Q6NA 2FZLA 3C14C 2HRCA 4MQFA 1C3XA 9ABPA 5HQ3B 2XZLA 1TD1A 1FYVA 2MHCA 3L6DA 3W1EA 4AY5A 4P7FA 3ABSB 2FMFA 4KQEA 2F8TA 3H9EO 2A1UB 3EULA 5ITWA 1QX4A 3I01A 1V11B 1P4AA 4LZJA 3OY2A 2JJQA 2HLPA 2ZT7A 4JMPA 5IC6A 3S0JA 4YX9A 1UDAA 1Z18A 4TKVB 3HB5X 1R9JA 4NYIQ 1KJZA 4ZDKA 2IDMA 4A8PA 2VZ0A 4MUAA 3VKUA 4U3JA 4WACA 4A2QA 3FTFA 2HDHA 1Z45A 1SZPA 1DAEA 5K0BA 2QUAA 1JIXA 2PUJA 2YS7A 1DC3A 1EG7A 1YKGA 3A7DA 1HTWA 3IEMA 1SXJE 1KJIA 3EK2A 1WVGA 1O95D 2PIAA 2O23A 3Q9UA 4HS9A 4HZUA 4NJEB 4E1AA 4YP5A 3LA8A 5FORA 2Y71A 2R4UA 1DKLA 5HM6A 1KAOA 5LOVB 4QM6A 3U6KA 1KU0A 4ZANA 4JI0B 2F1JA 4X6XA 4LZWA 3QIAA 1D7AA 1QYDA 5EJEA 3WNDA 4Z51A 2BBOA 2OQRA 3LF2A 1QP7A 3WB9A 1U3DA 2FPKA 5IH7A 4MVXA 1NV8A 3GLSA 4ZGBA 1DJOA 2O7VA 4QT0A 5TGTA 1IVYA 2ZI5A 3T7JA 1NRWA 2ORYA 2VHZA 4RTMA 2XECA 2VNJA 4HVTA 1P0FA 4G5XA 3D8NA 3ROFA 4BU1A 1P1RA 3EF1A 4REOA 3PWSA 4CUZA 3HUDA 4RVHA 2C3OA 3K71B 4P54A 1FUYB 3JPYA 3WI7A 1RQGA 2SKDA 1H5UA 1AO3A 3F4KA 2CJYA 4JNCA 4LXTA 3U62A 1MKYA 4BP1A 3UH0A 1E79A 1YVDA 2AFIA 2O8BA 3TGLA 2DKOA 5BYJA 4JMLA 4C43A 5CW1A 4DBZA 1IBCA 5LBUA 1XAGA 2CVHA 4FI3F 5FPTA 5KVSA 2NSDA 4RPJA 2VNSA 2PZAA 3T7IA 5EVCA 1CU1A 2P0YA 1X1AA 2HGZA 2V5UA 4NZYA 3RHTA 1KDRA 3P0EA 3DFMA 4JKYA 2PUCA 2X58A 4HXEB 4G6ZA 3SJ7A 3CUWA 4FCCA 3ROZA 4WK6A 4ACAA 3IQDB 1I01A 2GTHA 2P67A 3CKMA 4ND3A 4DUGD 5IM4A 5FOXA 4UM9B 4OY3A 3ZDEA 2XHZA 4QM7A 2FW8A 2RHWA 4MW6A 1WCYA 1VLLA 3M5PA 4GR9A 2HHHB 2Y1LA 1H4QA 2B78A 3SHOA 1W87A 3LCRA 3O8LA 3IBGA 2OQIA 1X0XA 1J00A 5F4ZA 5KSOA 1MTZA 1JV2B 4UU1A 1UH5A 1USUA 2JGNA 3EVNA 4RENA 1UDWA 3KAQA 1P0IA 3HXTA 4YCBA 3RC9A 1GPNA 1ZD5A 1XQVA 3HADA 5H68A 3KALA 4R81A 1AG9A 4RD1A 1G64A 5ALKA 4BV9A 2B37A 4Y2GA 1BGXT 3P0RA 4FOOA 4HWPA 1A8IA 1L2TA 4GPIB 4HBGA 4BO8A 1BRMA 4PGFA 4TV8A 1O4WA 3LPMA 4M9QA 5JNUA 1U8ZA 4AVYA 1H2AS 1DBVO 2QT9A 4HUQA 1WOYA 2YJ4A 4LY0A 1Z2PX 4Q15A 1QQTA 1MEJA 1UJMA 1FP1D 2OHGA 2DT5A 4JLKA 1SB9A 4BFWA 2XMSA 2NO6A 2ZJ2A 2HBQA 5AI8A 2N1BA 5BOSA 1AK9A 2WIDA 3I8SA 5EKSA 1ETUA 1XXHB 2PD6A 3ND9A 3QEMA 3KJXA 4MTLA 4C22A 2EKLA 2IW3A 2DR0A 1OLUB 1WDLA 2QU8A 4DCUA 2PGNA 3GEHA 5AKZA 3R3WA 3Q98A 4YQYA 4IJ5A 2P27A 3QI7A 4TTJA 5H5JA 3UJCA 4PQYA 3UMGA 4G09A 4FSHA 4GZMA 1W1UA 4ZVOA 1ZC4A 2HT6A 4C0LA 1SNYA 4ZMRA 1OPRA 4RY2A 3V1TC 3F9RA 4UUMA 2JGKA 4MWDA 3MERA 4DZRA 4NJOA 2AW3A 1AXGA 1CR2A 2ZJYA 4LNUB 3UXEA 4EB0A 1NI4B 3ZKWB 1R12A 4I5FA 4F5DA 1T1RA 1HWYA 3P52A 1CJSA 1G98A 1NJ2A 1EVZA 2QJOA 3W06A 3HJUA 5AWFC 3W8FA 5GVRA 1JR3D 3H16A 4PRZA 4DIOA 5JSQA 5AUNB 3GRKA 2OB1A 3LP6A 1BKSB 5CLLA 1RI5A 2ZXFA 2J3IA 3HBFA 2X8LA 1PYDA 3HO8A 3ON5A 3QBEA 4KO3S 3OUTA 4KSYA 4RIEA 3WBJA 4ZMSA 1KSFX 3BYZA 3MCVA 4H6WA 3ISJA 1VLJA 4F93B 1WETA 3UJ3X 3WKDA 4KQXA 1ODFA 2YQ5A 1L3IA 3EIEA 4ARSA 2GBLC 4DM3A 1TKAA 5K0LA 2AK2A 5JH7B 3UAGA 2GN8A 3JR3A 3U0BA 3SBOA 1PBTA 2ISSD 2IYWA 3RUIA 2W37A 2XLBA 3VR2D 1GAXA 2PHZA 1T2EA 3TVDA 1J8YF 3W9UA 1EWRA 4BO5A 1WBDA 3U1VA 5I48A 1ICIA 3AIIA 1VXOA 2G77B 2G7MC 3WLIA 2FETA 2QAGA 4J07A 3ZI4A 1U9YA 4AJEA 2BFCA 5AVWA 3H9GA 2ID9A 4KQ1A 5IVDA 2HCTA 3TMYA 5JMWA 5DEIA 2HQOA 2OR3A 3BVPA 4OB6A 1PG2A 4C4SA 4F84A 4RF2A 5ICCA 2JVKA 4XLLA 5GM1A 1EA5A 5A3JA 5T3UA 3GIWA 3FPBA 2BUBA 4ZCMA 2FOIA 2CB0A 1DXYA 2XTZA 2BUAA 1U8TA 2QX7A 1JLLA 3GRAA 4GX0A 4PHFA 3J7TA 1J8QA 1PEAA 1AE1A 1JQAA 1RLTA 1U7UA 4TN1A 2O5EA 3HKCB 4ZEWA 1R6BX 3DEIA 3L49A 1QH1A 2DSNA 2ZUDA 4OK3A 4QTUB 1ZH4A 2O3TA 3IMCA 4MJ3A 4P86A 2Y1FA 4DPMA 4RTPA 1DG1G 3INRA 2DULA 3OZGA 1XVLA 2PLWA 4G41A 3RARA 4KK4A 2Q3HA 3E9ZA 3PA6A 4TTSA 3PC7A 1R6AA 3U4GA 4ZJPA 1QOPB 1M8KA 2CVZA 2J0UB 3OT1A 1A9TA 1Q12A 3CLSD 3JARA 3OM0A 4EFMA 5JZVA 1AB5A 1NJ1A 2PYZA 5EZ5A 1SM4A 4C5CA 4C6HA 4D44A 4PN7A 4W9MC 4M86A 4UHJA 4EPYA 3LGSA 1HDEA 2VOEA 3VU9A 4CMGA 5C9ZA 5KOHA 4YBZA 1UFRA 2ZYVX 4Q3KA 3K15A 4RK5A 4UHHA 4D7AA 5LOVF 3PZBA 2YV2A 1GXSA 4XWGA 2PMKA 5FWXA 1W5SA 3FXAA 1F8YA 3N6XA 1P7ZA 1L7XA 4KITB 2Z8XA 4TWJA 1RVDA 1AQLA 4GOLD 1RRMA 3M6XA 3JAWA 4GVPA 2EQBA 2WABA 4XE5A 4P98A 1NXXA 1SUPA 4F4IA 1W7AA 3E18A 1FVFA 1K7YA 2O1SA 3HI4A 4RM3A 3UAYA 3S7ZA 3C5HA 1Y6QA 1LB1B 2R6CA 1HL7A 2IXEA 2JFFA 3NS7A 3CV3A 1PSWA 2PVCA 5HBRA 5KOYA 1KORA 2F3UA 1RYDA 3JYPA 2I33A 4RMNA 5ALPA 3BGVA 3WGMA 5AIBA 1U0HC 4PLCA 3UBTA 3DFIA 2UYYA 4F96A 3GY0A 3HI6A 5EHZA 2F90A 4ND6A 2QNBA 1XEWX 3LM8A 1OB2A 4QASA 2J3MA 4HLUA 2JJYA 1YI0A 4OSOA 1P0PA 1U90A 1IHYA 3JQFA 5GTDA 1Z2DA 1LI5A 1N8SA 2IYZA 3R6TA 3B89A 3MNFA 5B1YA 4BDTA 4YXWA 2H9AA 1QK5A 4X3PA 2EFGA 4LC1A 5DHFA 1INLA 4PSUA 4LOIA 4QTXA 4W63A 5COBA 2ZBEA 3MT8A 3OA0A 1NW6A 1WA5A 3RAEC 2QZ9A 4B76A 4I2VA 2H16A 5D3ZA 3W4IA 5IVHA 3IHTA 4LXIA 4LMBA 4UU0A 1SXJA 4JT9A 1KZHA 2JKYA 2XADA 3ZE7A 2I29A 1H2XA 1H2EA 1VJRA 2XZPA 3OZAA 1I7DA 3AVVA 3NC4A 4J7CA 2I03A 2HJHA 2J9RA 3FNEA 2GZDA 3DB2A 3K5WA 4D8TA 3BOSA 5AKJA 3AGQA 1NP3A 1R5JA 1TMYA 2HB6A 1FZQA 3FGPA 1FDSA 2FEXA 3U09A 2Q1TA 3KOUA 1VJTA 5JRJA 5E6RB 1UAGA 1FTQA 5K3AA 2X0FA 2H4FA 2HJWA 2PKQP 3RJZA 1L5GB 4DLTA 2BCEA 3L6OO 2LRHA 3ASZA 1SD5A 4I1YA 2A5JA 2HV8A 3ORQA 5F3RA 3GA0A 3BH6A 4Q82A 4EKDA 2WB4A 4WADA 3VNSA 4XGKA 3C3YA 3HFGA 1H3EA 2B8WA 4RLQA 4MUNA 5U4XA 3ZLUA 1DMRA 4U6SA 1DCTA 3GJ8A 1H4VB 3VR6D 4EKNB 1CJTC 2H1WA 4EW6A 3T15A 4OBBA 3CUKA 2QLTA 4KPYA 3KP1A 2PZKA 3KTDA 4X3OA 4KKXB 1V39A 2VWHA 3HDTA 4YXFA 3A6PC 3H4MA 1I7PA 1XDDA 1YASA 3I3SR 4MULA 5CA0A 2ZB7A 3ZGOA 4RH1A 5BWCA 3L5KA 2QV0A 3C7KA 3QPVA 3C6YA 3H5LA 1B8NA 5AHKA 3AKDA 1G3UA 1XFDA 3IESA 2PT7A 5DCYA 3V1LA 5JS2A 4EABA 1UFQA 2YJ6A 3IPXA 1HC7A 1ZN8A 3AEXA 3G2PA 3LYLA 3NC0C 3PNQA 4F8JA 1AUVA 3LT2A 2ADFA 3E9NA 1JI3A 1G0OA 2IHJA 2VEOA 1PZFA 1QUEA 3NBXX 3PC4A 4BZZA 2IPNA 2H85A 4QEZA 3AF4A 3HNOA 5C2JB 3CU5A 1RYZA 4FYIA 1T2FA 3HLKA 2G36A 3DKVA 5IDYA 4BEWA 1F20A 3IS3A 4Z2AA 1U63A 2HREA 2FOLA 3CEMA 2ZJ8A 5DX1A 4AIIA 1VJCA 2OSVA 2D7JA 2WWHA 2JH9A 2ZWAA 3NT2A 2B4TO 2WNIA 1YBMA 4YHBA 2PXHA 1XP5A 4A0GA 4PWZA 2J85A 4UEOA 3EQ2A 3VC7A 2RI6A 3HWX1 3QPUA 5JHHB 4MR8A 4A8TA 2CVPA 4G1FA 5HFNA 2R8RA 3HBNA 2YWGA 4I9NA 5FTJA 5ERGB 3IILA 4MYCA 2EX0A 2YC2C 2XDYA 3L1KA 3MFQA 3DZHA 2VYVA 3IXMA 2WSSA 4H7EA 5JFOA 5C7OO 1JJ7A 1A5AB 4KV9A 2PX0A 3DE0X 1XMOB 2CXUA 4QDZA 1HOXA 3GD7A 5BXYA 4UU7A 2J5XA 3VKGA 5TPWA 1L6IA 3C7DB 4OH7A 4KNYA 2OOSA 2Z8ZA 3PGVA 1FS5A 1GKLA 1YO6A 4FGKA 4JQYA 4KK3A 5F9MA 6ABPA 1EKXA 4R98A 4B4OA 3EG9A 1L4GA 2CXTA 3C3MA 3W6OA 5U4QA 1XA3A 1ZGHA 3ENKA 5JJKA 5JZMA 2VNKA 3AEZA 2HA3A 2ZB8A 2PMEA 3BXGA 2ZQZA 1EINA 4KZPA 5CK5A 2VH1A 1PJLA 2VF2A 4QYTA 1K97A 3GARA 1V3QE 3PPWA 4LOJA 4KXFB 1UJ6A 1ANKA 3KBBA 3IO3A 4DFDA 1JJFA 1AHIA 2JA1A 2SCUA 3B6ZA 1Z2NX 3L7OA 1Z26A 3DZKA 3BULA 2O54A 2RCNA 1VCNA 5G1OA 2IKQA 4Z9BA 3QFFA 5LZ4A 4D74A 3GXOA 5I7FA 4ARBA 1TVKB 4D4KA 2Y05A 3AHHA 1R4ZA 2YHAA 3CVXA 2HBRA 4I4LA 4OOEA 3KYIB 1O7JA 1E2LA 2VAWA 2Y1XA 3PENA 4OQZA 5G2OA 1R4NB 4UJ3A 2JCBA 1YU9A 4I19A 3E22B 4PWYA 3MS4A 5KJEA 3MQFA 4HCJA 2W93A 4B35A 4Y6OA 2WTBA 2JAOA 1COWA 4YUWA 4D81A 2HTFA 2ACWA 3LUFA 1IB6A 1E5TA 1VBFA 3H2HA 4J8PA 2AN9A 4TM8A 3UMCA 2Q5EA 1K27A 3PFHA 2FFBA 2DPGA 2HU8A 4U9IS 1G8PA 5BV7A 3PRJA 4ABYA 1CERA 2Y0EA 1OSNA 4D9HA 2KS6A 4ENVA 1NWHA 2P2SA 2AG1A 1P3JA 4LDZA 4YRDA 5JFTA 2XNHA 4H6XA 1CNFA 1KERA 4EIWA 2GBIA 5CNIA 3RVSA 2PO5A 1W2WB 1WEHA 1DDIA 2ZVDA 1XCOA 4JQSA 4CKBA 4E51A 2JFUA 3P9KA 1TEHA 3JQCA 4KO4S 2NADA 2NTVA 1WP9A 4C88A 3Q8XB 2IS6A 2ZU0C 5D87A 3UV6A 2OAGA 2X5XA 3P2MA 4MKIA 5G4KA 2F8SA 1C9NA 4UDXX 1NRXA 2V7PA 1LWNA 1R00A 3LK6A 4HYTA 3M1LA 1EE2A 3WDKA 4BX0A 2ODWA 2OGSA 5HS4A 4K81B 2KSQA 1F1BA 1NVXQ 4J0KA 1UFVA 3D02A 4EVRA 4DJJA 1WE2A 5LXTB 3WAJA 1N32B 4WY5A 2VQDA 2RGDA 1WUYA 5AIAA 1JMKC 4K6MA 3ACBA 1PJSA 3RTGA 1RRKA 2VHCA 1F60A 3SAJA 3PVZA 3NBZC 1YJBA 3HBLA 4RA6B 2QORA 1H2YA 4AZ3B 2C9MA 2X1HA 4RDHA 3HCRA 1KH1A 4UM8B 5EIBC 2QL6A 4LSGA 3IT0A 5KYWA 4ESVA 2JIMA 1XYGA 1H0SA 4JOCA 3KG2A 4HB2A 4W1SA 3W3AA 3DOFA 3OEHD 3MCAA 1PEYA 3GFSA 2IS2A 1XRJA 3QKUA 4TTVA 4X97A 5L3SB 5KOIA 3WGYA 2J3HA 3K6SB 1K68A 1EEXB 3HKBA 4WZBA 1GGMA 1L8AA 2H51A 4LJ8A 5D84A 5TEWA 5CB0A 5CDFE 4RORA 4UXIA 1KMHB 5D3KA 5C8YA 3ER9A 1U2PA 2HHJA 2YN2A 2QBYA 1J24A 2QEQA 2YXPX 2WKSA 3ULKA 2NIPA 4CG3A 3U4HA 4MVJD 2YQZA 1IPEA 1XEFA 2DHRA 2C3PA 2QSZA 3WK6A 3E84A 3K1AA 1NVKA 2X9QA 4DSAA 4BAZA 5CT9A 1JFFA 1MB2A 3W7AA 1IDN1 2IEZA 2KWIA 2OK8A 4EI2A 3OPNA 1IPHA 4NY1A 3GFOA 2ZFUA 2A1TR 2LVBA 5ARBA 5JAHA 4J7UA 2A57A 4DEYA 1B16A 3GD5A 4YUYA 2WVGA 1NM5A 2FMKA 2GZSA 3G2OA 2BVNA 3KVYA 3WLRA 4EQ6A 5SZKB 3M4NA 4DLXA 1BHSA 3M9WA 1V7ZA 4OXRA 5C4GB 3MFYA 2F59A 2BR5A 2I1WA 1COZA 1DBPA 3OKPA 3QUCA 4NEHB 3LO5A 3NBYC 3MTAA 1XPRA 3L9XA 1CJVC 1A7JA 3ETHA 2WF9A 3LUBA 1K3TA 2BP7B 4Y98A 5BSMA 1KP2A 2WSIA 3DQQA 4HDKA 1C0KA 5D5HA 2ZANA 2ZDQA 3WK4A 1NBWB 1SA0A 4WFJA 4GBMA 2CVOA 2CL7X 3IV7A 1SPBS 3MUOA 1ZY2A 5F98A 3LDUA 3ZXXA 5EINA 4KR9A 1WF3A 8ADHA 2Q2WA 4IHJB 2DP4E 4NOMA 1QIMA 1YGYA 2PAAA 3JD1A 3NU1A 4IRXA 4KXQA 3LOUA 1LK0A 3BHJA 3OWHA 3VM6A 2NNLD 2P2DA 4MVYA 3EDMA 2VJOA 1XROA 1YULA 4RF4A 1NY6A 3STTA 4EARA 1IEWA 4QXOA 1VPDA 1UKYA 3RH0A 4EHIA 1G7CA 1TYBE 3HJHA 1OYVA 3KAPA 4FHZA 5C8YF 3OJ0A 1RCFA 1GA1A 1GSIA 5D8DA 2C4MA 5FUQA 3O8QA 4JDUA 3TR5A 2QJWA 4CCAA 4XIIA 3WZLA 2FSVC 5E8RA 4B3MB 4M55A 1I3MA 4ZQHA 4PZEA 1VLVA 4X8OA 3WXBA 3JSXA 4D41A 1Y6JA 1DQYA 1JNXX 1TPZA 2VJNA 4UBKA 2GAIA 1WZCA 2W6CX 3WLTA 3ZCVA 1CTQA 1HURA 2O5VA 4HQLA 2GN2A 3NBMA 4YNBA 4BMXA 2GEUA 4CCYB 1Q15A 1T9GS 3EFHA 3D4LA 3F5DA 1H2WA 1H9BA 3MWFA 3BD9A 5DE3A 5DLPA 2QIOA 3TECE 1JRLA 2X5OA 3GLGB 5H8WA 4M1OA 2FXIA 4JL8A 5DF1A 3L41A 3BGWA 4OB8A 5DWDA 4XIJA 4HAWA 1PQPA 1DPFA 4LIPD 3W1VA 2JF0A 4XFKA 1DX9A 2HEGA 4KMSA 5EWLB 4GWGA 3TAUA 1EAMA 3BRQA 3PDCA 4CR7A 4N7JA 1KBOA 3GEGA 4AUKA 1KO5A 2AD1A 2PX4A 3ZCRA 2IXGA 3BMXA 1SVUA 2ZAGA 4EDFA 3VYWA 4TRJA 1NNI1 4N03A 3S99A 4BB0A 1YR6A 3RF6A 5I5EA 1FSSA 4ARIA 5C5DA 3ELBA 3DXYA 1Q11A 5I7UA 1JVBA 4W8OA 4K9LA 1ZP6A 2QZJA 1CZNA 3G7SA 4P3OA 1RHMA 2Z5FA 4REMA 1KI9A 2V9PA 3N0TA 1Z7WA 4YECA 3NIWA 3QXCA 3ZYCA 3OWXA 2CT8A 5E3JA 1QCDA 2XB4A 1FDUA 2GBCA 4EF5A 4ZREA 5IRCD 3SF8B 5AQ1A 3FOFC 2JC3A 1NASA 1DT3A 2FRDC 2JIZD 5AQEA 1RBQA 3QWFA 1E2QA 4K6KA 4RXUA 3STYA 5H80A 1N8KA 3AFMA 1E64A 4KJZA 2J9XB 3DLIA 4F45A 3EUWA 1M2GA 4ZT3A 3ENVA 2R751 3Q8MA 4XM2A 4MYDA 4I1VA 5DHSA 2I4LA 3IBCA 3PLNA 4C7XA 3GCDA 4RQTA 4WJLA 4DIEA 3KQYA 1FBNA 1FQOA 1UUFA 3I6ZA 3IPYA 5H3CA 4X6LA 4BGUA 1WDMA 6REQA 2ODPA 5K4GA 1SOMA 2HCBA 4CLRB 3U49A 1BXGA 2O7QA 3HR4A 2WM2A 4JJGA 2I7CA 4ZU3A 3F5QA 2PV0A 3ABIA 2WHPB 4L2IA 2R6HA 4RFVA 3ZYZA 4IOMA 1RP1A 2VYFA 4NMLA 4HGNA 4BWFB 4U00A 4OQPA 1DPGA 3KYCA 4RVFA 3HS3A 2ZYRA 1NOJA 3TNFA 4QUIA 5JASA 4R2MA 4Z1MA 3HL4A 1N6PA 1AA6A 2FPIB 2Q5HA 2QY6A 4X8HA 2BEUB 3RRNA 3GLFE 2AL7A 4R9UC 4I2NA 2VHJA 2Q41A 1E3JA 1V2HE 2NU8B 5I9LA 2F3RA 3AW9A 2CXHA 2VNIA 1J9GA 1P4RA 2ERCA 5I5GA 1F6BA 1PUXA 2QMUA 1L5NA 3BRWA 5TQ2A 5K6AC 1ULSA 5IYZF 1C9MA 4GT1A 4ODIA 2FZGA 4JEMA 2IHVA 1C7RA 3P0HA 4MUYA 4PU0A 3T6KA 1TUBB 2J3KA 2OC9A 5DYYA 3T99A 4P7KA 1LLQA 3IMEA 4KO8A 5EPEA 2C3YA 3ZV6A 2HH9A 4YP9A 1BHJA 4MAAA 1OZHA 5CCBA 5FJJA 2QJRA 3REQA 2MJLA 1Q1EA 1W59A 2WJIA 2YZGA 4PZZA 4AWAA 3LUHA 1GQYA 7REQB 4TRRA 1WXXA 2FW9A 4YIHA 5KQMA 3VVCA 3Q2OA 5KYYB 4OQQA 2PT9A 3FDJA 4LRSB 3P5BA 3U61B 2ZRDA 3EYWA 3LLUA 3MM4A 4Y2PA 2NPFA 4B33A 2I71A 4DQVA 3DGEC 5A5FA 2Q28A 4OP2A 3O73A 3O90A 4NARA 2XUIA 1WHSA 1GG2A 1Z6AA 2H63A 3I9LA 1H23A 3TOXA 1O57A 2EF0A 3W4KA 3L0OA 1YJAA 4NV1A 5BSUA 3WADA 1OLOA 3KT3A 1YVRA 1MJHA 2RI0A 3WL6A 2NG1A 1G4UR 3A9WA 4TMWA 3DQZA 3A4LA 4MAMA 3GG9A 3GLHA 3SXPA 4R0NA 4HGQA 3EXAA 1KEEA 3S1SA 2TMYA 4I9GA 3E0QA 1Z2EA 4Y7DA 4GMFA 1SUCA 3LC7O 4DADA 3RUDA 1RIFA 1S9HA 2VJDA 4C1BA 2B21A 5FA8A 2BFBA 4XA8A 5HNKA 1LSSA 2JZNA 5E7QA 2REQA 3DNMA 4JS0A 4KR3A 1XWIA 3AK4A 4Q66C 4F04A 1NUUA 3VR6H 1MQ8B 1BMTA 1PSZA 3AUKA 1GO2A 2FSHA 2VJLA 2W6ZA 3JQAD 3KV1A 5HRCA 5KWIA 5KVVA 3EXIB 1QX3A 3BE4A 4I3GA 4E88A 4H1WA 3NNNA 3FOBA 1J97A 4MVWA 4RZQA 4WZ6A 4EVQA 1FS4A 1WCV1 2EJTA 4IG4A 2HDWA 2I80A 2AYZA 4Z7JA 2D0DA 3K1YA 1T4CA 3HFRA 3LHIA 3LW7A 4PPGA 4CKCA 1W8DA 1LC3A 3V48A 1KJ8A 1U4OA 1V5IA 2PRSA 2Z98A 2ZP1A 1LNZA 3M34A 3C15C 1PR3A 3HM2A 3L4EA 4GR4A 4NBTA 4TVSA 2I22A 4IHJF 4C6SA 4FVTA 5LLTA 2QD2A 2QTVA 3GELA 1X0VA 4P7BA 1NP6A 4IKEA 1TW3A 2O3QA 1H6CA 1WSWA 2JLZA 3M5WA 1T0JB 1T25A 1E1MA 3VZQA 1GCUA 4AQDA 3QF4A 5BRAA 1E2UA 3C6KA 2ZIAA 3NHLA 4FK8A 2QG6A 3F8TA 2DJ5A 1FF9A 2VCEA 1QHNA 2Z1NA 1QO9A 2E4WA 4HTFB 4IVNA 5EPOA 3T38A 4CM1A 4IX9A 3G8DA 1K4MA 1RAIA 1FFWA 2YV1A 2OHVA 5AI5A 2RHOA 2ZJFA 5K51A 3PUIA 1QIFA 3HCWA 4ZTZB 5AJTA 3LRTA 3HH8A 3UHOA 2B36A 1FU7A 4KDRA 4NFSA 4ND8B 4ARVA 3REGA 1ZIDA 5FO1A 3QA9A 3QVJA 2QW8A 3O6VA 4IVQA 3W77A 3GUUA 3PCTA 3SHWA 3PFKA 4W9NA 2OXCA 6Q21A 1UK7A 5FAKA 2PSFA 3BKWA 4NABA 4GBED 4UNQA 3VQTA 4AJ4A 4NU8X 4RKEA 3NIDB 1QORA 3EDCA 1RKQA 4DCGA 2CK3D 3K35A 5JXWA 3L1HA 3D8SA 1D1PA 1XD2A 1Y8QB 2BGJA 2H9IA 2XX3A 4MV4A 1YIOA 4IRMA 2OA0A 4A7PA 1N0UA 5HKBA 1SU6A 4W5JA 4CN9A 3TRIA 3HJTA 1PP4A 2JCVA 1H4SA 5ADVA 3NEJA 4KG7A 1IXRC 2XTMA 5GWXA 2QVLA 1PK8A 1XIVA 3BMNB 1Q3KA 2O2GA 4IOJA 4NMWA 5AICA 5HUQA 3PPVA 5K3EA 1F4PA 5KIAA 1I24A 5E3IA 4BMCA 2YCLA 5LMZA 1EP1B 1KEVA 2IVZA 4LOLA 3TBKA 3WGHA 1H2HA 4AW9A 3IKJA 3KO8A 4QGSA 2XDQA 4ETWA 3KAJA 3DYIA 4PICA 4NZOA 1ZM3A 2WTXA 3LHKA 1KYXA 2PSJA 3G5TA 4YDRA 1R8QA 2WOOA 1IEXA 2QRPA 1O77A 2GJ8A 2IF0A 3C8MA 3T7RA 2C2BA 5JCXA 5HMLA 1XU4A 2N0SA 2BMFA 3SM9A 5JWRA 3F6SA 1ABEA 1M1XB 3RUPA 3WIOA 4NOJA 2IIBA 4MUEA 1NN3A 2D5LA 2X5JO 3W8DA 3EXFA 3IA7A 4NRDA 4R1MA 4KFSA 1FMJA 1WXEA 3OEED 5BW4A 5HQJA 3AHDA 1ZOOA 3LGXA 4YJGA 3MD0A 3PC2A 4FDVA 4Q3EA 4YRJA 3EFOB 4E6EA 2F4VB 2I2FA 4B79A 3ZH9B 4AF6A 1Q44A 1UEJA 2IYRA 4K88A 2XEXA 3NALA 3KKZA 1OOEA 1DWOA 1D2AA 3FTEA 3K9BA 1JHQA 1EI9A 2LP4Y 1NI5A 3CY6A 3FVWA 2YHIA 3AM3A 5IT0A 3LE8A 3W2FA 1BD3A 3BSWA 1GGJA 2JFHA 3UKJA 2C2XA 3K2QA 1U2DC 2PMWB 1C1XB 3KIPA 4F6LA 1EFKA 4HWSA 3IEUA 2CYCA 1VFNA 3EMDA 4RDIA 1Z88A 2OO7A 4IJKA 5EYPB 1S4MA 3DOHA 3N0VA 2NZWA 3DMTA 4OX9Y 1VYHA 1QF9A 3KQMA 5JG7A 4KAAA 4YP7A 1U8EA 5FEMA 3NH9A 2HA4A 3K6RA 3O9VA 1NMZA 2FLKA 2J9GA 2PL9A 3I6IA 4HDMB 5IHPA 2CC2A 4QBKA 1Y1KE 1BQ3A 3Q41A 1UBFA 3O83A 4WN3A 3VTZA 4BKQA 2YBDA 4IDNA 3PB3A 3PCXA 5BY2A 2QTRA 3K20A 4K8RB 4WJKB 1GZ7A 2GZ3A 1OH5A 1PWYE 1CQJA 2JFNA 1NQWA 1XCLA 4OSPA 2ZBPA 3EB9A 4TMXA 2C2WA 3IP1A 2DCMA 3ZY4A 5C7YA 1TJPB 3FG9A 1SCQA 3AVUA 3THXB 1GNRA 2XA2A 2UYOA 4CTNA 1NDQA 3I5MA 3WV4A 4JSTA 3ZU6A 2ZGVA 2I3GA 2R8PA 3O5AA 5JJ5A 5K0SA 1JZSA 1VLZA 3TF5A 4UCXA 1TECE 3IB3A 4HDAA 3TQQA 3WR5A 2KYRA 4DA7A 4NBNA 2BE7A 1FNNA 1J99A 1JSXA 2IUTA 2ZI6A 3A6JA 2HWKA 2OZEA 3OETA 3TX6A 2AFVA 4D56A 4MVJH 3KYBA 2C7QA 3A3KA 1I1QB 3CX8A 1QLHA 4HNUA 4FMBB 1S8AA 2F1KA 5C31A 1C0EA 4IDGA 3CR3C 4D42A 3WISA 4POOA 1OUMA 1PTJA 4UASA 3VSAA 1GU1A 2GEVA 1HFKA 1Z62A 4QELA 3UAZA 1A8PA 4UVEA 1MOZA 5BQXA 3ZBUA 1TM5E 4XWKA 1P1FA 5AD1A 4C0QC 1B6GA 3G5LA 3O3MB 5AM3A 1RC8A 3GW8A 1CUCA 4PG4A 5FT9A 1VIYA 3LCCA 2XT9A 2B92A 1E99A 3SBEA 1QAOA 3GF4A 3ZHUA 5DNUA 4B6PA 1ZIPA 2C4KA 4XJSA 4QD3A 1II8B 1KMCA 3GP5A 5IAOA 3CNLA 2PBLA 4Z3DA 3LX4A 4YPVA 2HI0A 4E2XA 3BCUA 1L5WA 3MLAA 4CLOA 3R74A 5KWVA 3N28A 4LJ4A 4E4YA 2ZRLA 4Y0NA 1UCFA 3PUYA 4R54A 4KN9S 5I8PA 2KLBA 3RD5A 3FUVA 3AFOA 4ZI7A 1X15A 4RWEA 1R7RA 4QXPA 4CMIA 2A0KA 5LP6B 4WLUA 2C9OA 2HADA 4D82A 5CG1A 1QQ5A 1YMQA 3E7FA 3H2YA 3ZUPA 4N3CA 3AR9A 2G6TA 4R9SA 3CH4B 1DTSA 3WV5A 5ETJA 2LD4A 4M0PA 5G1PA 1UC4B 1O4VA 3SVTA 4L27A 1U8XX 1DBSA 4Q1CA 3HBAA 3K8ZA 3UOAB 3A28A 2HSWA 3MGCA 1AJEA 5IF9A 5AYVA 1P81A 5IXYA 3CH5A 5IH3A 3WRWA 5DHQA 4U39A 3KFVA 4CDMA 3O26A 3D7MA 4NOLA 1QHYA 4LJYA 4UNIA 1PJ2A 4YRRA 1KK3A 3U60B 3QJYA 4X24A 5FF9A 1QR6A 1T8TA 2ALJA 4N9WA 1RJDA 1S2LA 4HZGA 4N01A 3WP1B 1TF2A 4GAEA 1SZDA 4WX2B 4RD4A 4FWBA 4MARA 5JHGB 2VHUA 4J7AA 1FTWA 2E2WA 3FYUC 4RQAA 4DRZA 4M22A 1ZRSA 2CUTA 5SY6A 2CGEA 2OLJA 3H18A 1UEXC 2ZVJA 1ZD4A 3IQEA 3PF9A 1I51A 3DCYA 2IHKA 2DYKA 1QB8A 1E0KA 1ECCA 1LS1A 2H54A 1AGRA 2VDLB 3C3XA 3O0DA 3PX2A 4B73A 2JLWA 2ZPAA 3EDYA 3CYFA 3HBMA 1BDHA 1JAXA 1QYIA 2EBFX 1NQUA 1P1BA 4NQZA 5C1BA 5LN1A 2FX3A 4I4TA 1XYVA 5LZ2A 4MKHA 4ARCA 2Q2QA 3EY4A 2I6SA 3F9CA 3OJFA 1V8DA 3Q0TA 2B8EA 1HK7A 1NW4A 1SBQA 3H19A 3AHIA 2YN4A 4FR2A 2XLCA 1N2SA 1YCGA 5JVDA 2IXBA 3UUEA 2XR1A 5A5GA 1EHIA 2F17A 4KCGA 4ZI7F 4GXQA 1KO1A 3VVLA 4AZSA 1Z56C 1Y6ZA 4OREX 2H7VA 4YHHB 4B34A 3K70D 1TAHA 3TSYA 5HMMA 3R9KA 3ROEA 1SXQA 2GASA 2IDJA 2NTYC 2O2HA 2QGZA 3QFSA 3F8SA 1OHHD 3DDHA 3B13B 1U4NA 1SK8A 7YASA 2QL9A 2OBYA 9LDTA 4W1RA 3KQWA 3DM5A 1PEDA 2PMBA 4P4GA 3RWOA 1OYOA 1U3GA 3OCJA 3RADC 3IQIX 1NW8A 1T2DA 2B2XA 3IB6A 4NNOA 2AFHA 5E9JA 4C5AA 3IP5A 2NVWA 3AX6A 2DQYA 3ABOB 3W78A 1G3MA 1DSSG 1H0HA 2WW8A 4WKPA 3TLGB 2BFFB 4QECA 3FZEA 4P4LA 1VIAA 1VIMA 3AESA 2BBTA 3CPHA 3GCXA 4FDUA 4NU6A 1G21A 3NV7A 3NG1A 2VPPA 3WBBA 4AP6A 4DXDA 1I1OA 2W6ID 3BXFA 1LK5A 5HGJA 4BQOA 1I94B 2I7TA 2FAXA 2C04A 4G0YA 1OFVA 1Q50A 4BNFA 2WDPA 4CKZA 3ZV7A 1AMUA 1Y4ZA 1ZJWA 4DCVA 3PEYA 2R6JA 1ORRA 4TTRA 4UDNA 4XVHA 3QEAZ 2UDPA 5DLYA 1XG5A 1NBOA 3GGDA 3MQ4A 3VUFA 1Z6TA 1JDTA 2Q0QA 3IUSA 5CH3A 4X90A 2XCRB 3AI7A 3M6IA 3DB1A 4ZT6A 1TZMA 4I4TF 4M0EA 4FKZA 5AVZA 3U37A 2IOYA 5F7JA 1I0LA 2PM8A 1RMQA 2AMJA 2XY4A 4BO0A 1CPYA 4X8LA 4Z7OB 5CFQA 1VG0B 1DAGA 2JLQA 3D1JA 1Y5RA 4R2IA 2GF2A 1WV1A 3KEOA 1ZIYA 1P8JA 2ISCA 1U3VA 3B2EA 3CONA 3L0DA 1N4AA 3WBKA 1ID8A 4N65A 5FWNA 1E9CA 4HLQB 4MWSA 1M1YB 3WWOA 1FEZA 2ATVA 1JR3E 1GAWA 3QOWA 2ZYGA 2X77A 2YASA 2BYTA 4FOTA 1KAQA 3LI2A 2VWGA 4BHTA 5ICGA 1E63A 2JZOA 2K2QB 1P6QA 1W9MA 4POAA 3VYSB 4MUMA 2NTNA 1EGVB 4I1PA 2VZEA 2ZRCA 3MT7A 4HZUB 3ITKA 5CITA 3EIUA 2BR3A 3MJ4A 1KEWA 1QP8A 3DFFA 1LBTA 3LCMA 1WPXA 4BNNA 3THWA 2H4JA 4HZIA 1Z5ZA 1V7QA 2GCGA 5J4LA 2ZWPA 3RBXA 5LNK1 3C1UA 4CODB 1SQ0A 3PE3A 4WKBA 1NDUA 4B17A 4KHPB 2EIHA 2L42A 3RTAA 3OG9A 5IDQA 2XDWA 1L5MA 1US8A 1IZZA 3IUJA 4IQGA 2O4CA 1EESA 1XPOA 3ENQA 1GN8A 3ZE6A 4WKOA 2IBMA 1IZYA 2DTEA 4ZHQB 4TL8A 3NGMA 3A1TA 3QRWA 5ALUA 2B2NA 1AQUA 4HQOA 1YK0A 3IMFA 2FEOA 4XVUA 2WSYB 1J0XO 1XHEA 1KYVA 1EX6A 2ODAA 1Z7YA 3ODPA 2QQGA 1MAHA 3R3JA 1XMIA 1EK5A 3DBRB 1RWPA 2C4WA 4KEAA 4QBTA 5DWQA 3TRJA 4BZWA 2O8BB 3G5AA 5F5LA 1Z3IX 1EFRA 1KVQA 2B0CA 4MQ5A 4XM1A 4BLVA 4GPTA 2B98A 3GLQA 1UBSB 2JRCA 2Z3WA 5CVCA 2ZQYA 1N3BA 3F71A 4G9GA 3HWWA 3RYFA 3C1OA 5J59A 4IG9A 1PR0A 3Q3CA 2F9LA 2Q7DA 1RBZA 1XJ0A 1XDSA 4BGVA 2K6GA 3SXUA 2C82A 1XU7A 3IHWA 1XQYA 2OHHA 3IXQA 2H1FA 3QPWA 4AMUA 4P0QB 3D6AA 4BBZA 4DJAA 3L4KA 3ANSA 4OMFG 4U5XA 1OAOA 4BVKA 1PFUA 2L0XA 1O0BA 1WM1A 1P1CA 1R64A 2Z58A 3KQOA 1R4AA 3KKOA 2OPHA 4ZDJA 1A9OA 2WFAA 2RGXA 3AI3A 3B38A 3PX3A 1VIVA 2N9UA 4RTKA 4FZJA 4PC7A 1MO5A 4H9GA 4WVFA 3L0CA 2NLOA 4QARA 1RXSA 4P9NA 1S2OA 3OFSA 4FMPA 2CD9A 1T3HA 2NO1A 4Q1AA 4WVLA 3ROQA 5BNTA 2E6UX 2CJPA 5IKXA 1Q77A 3C41J 1VGRA 4QDJA 4WERA 4CL3A 1MUUA 4QOFA 4KGXA 3NH6A 1WMAA 3CBQA 1SKBA 2XI4A 1R3DA 3FE2A 1MGOA 4EECA 5JDIA 3TUZC 4KAXA 1KJ9A 4WI1A 3QG5A 4TQGA 4R1PA 3VA7A 3L46A 3AJAA 2ZSAA 5D7BA 1FK8A 1W29A 2WD7A 4BLPA 2HO5A 3WYEA 2WTNA 4JIMA 1M2HA 2HUNA 4E21A 5LMUB 3E82A 2W4QA 2WY2D 3C5CA 3MJEA 1CEXA 1QRTA 4EBBA 2VWQA 3HEAA 4ZZ1A 1P29A 4AXBA 4JK3A 3C7CB 3T9AA 1VP3A 5IF3A 1PV4A 1FXWA 4DV7B 421PA 1DBQA 1KHHA 4BFLA 1PS9A 3VJRA 4M1MA 3M9XA 4ESOA 2DGDA 3K92A 3MJHA 2AEFA 2J08A 5HCIA 4DRXA 1QTRA 3W05A 4QUAA 1OBVA 5E9WA 2WJ6A 1BKYA 2IOFA 3PTZA 1Z13A 2B4KA 4EGAA 2WUFA 4KQFA 1IZ9A 4A2PA 2FP4B 3EGVA 3MWYW 3I9JA 1SK9A 4M1EA 2KQUA 3ZU5A 5AW4A 1ESEA 2EARA 4FSXA 4J43A 1GR0A 4G4JA 4KXUA 4M87A 4ZO6A 3ZR4B 3DBLA 4KE7A 4X64B 1I3CA 5IJ9B 5IKPA 3ADOA 4DLUA 2VTEA 4RFSA 2J1LA 3SSAA 4NK5A 4DRYA 1CRPA 5HA5A 5FIUA 3NORA 3AINA 2BMAA 1WPGA 3HNPA 5EXXA 5CXSA 3ZK7A 1LZLA 4EJSA 3D59A 4LMAA 5AOBA 5FPQA 4BLWA 3CKYA 4F11A 3EGCA 1IM8A 3KLPX 2J3JA 2BM1A 5DNDA 3DG9A 1CZOA 1CF2O 2MYTA 3A3NA 2V4MA 3LXXA 4TWAA 3TZQA 5AM0A 1XZPA 1RACA 3BMCB 1SCUA 4AICA 1SVMA 1QF6A 1BSVA 4HP8A 3OTGA 3B52X 4RKYA 5I8WA 4MWGA 4LXGA 5ULLA 4AG6A 3OT4A 4YYEA 1NN5A 1A8HA 1J6UA 1TT7A 3MW8A 1T1IA 3HSKA 4AK9A 2PX5A 3M8KA 4RHCA 4OIMA 3TH5A 4N6GA 4FWTA 4C21A 3QU4A 3FFAA 2AC4A 3S81A 4XIYA 2Q2OA 3GYGA 4G84A 5B7GA 1M5UA 4ZZ2A 1EX9A 5E0OA 2C94A 1O5IA 2VUIB 3ZD6A 2GLXA 2FA9A 2OB2A 2P6PA 3OQIB 3PQ5A 4M53A 1MB3A 3EVFA 4BQSA 5HM8A 3OCZA 4G1CA 5C32A 5C8XA 1RKVA 2G9UA 3PUJA 4FN5A 3OLYA 4KFTA 4AULA 4BAUA 2ONCA 3PNKA 1E1CB 2VCHA 4HAZA 5FV7A 2W0MA 3B9QA 1CYEA 3WY9A 1L3BA 1SIUA 4A0FA 3GLKA 4MUJA 4OU4A 3RVMA 2ACVA 2YUTA 4BV2A 3UPUA 2PU5A 2Y0PA 2WWTA 2FRVA 4KBFA 1E2HA 2HPHA 3C43A 2D06A 3G2QA 1NNUA 1Y7TA 3RFCA 5A5EA 3T52A 1K9SA 1E77A 5DGDA 5EUBA 1GNVA 1KYQA 2GAOA 2VCYA 2WK1A 4OXNA 4W1PA 3QWIA 5DISB 2AE2A 2C29D 3HY3A 4ML3A 2FPRA 1X13A 2WJJA 2OFWA 2V58A 1A9YA 3AVWA 2VYCA 2B3DA 2PH7A 2JFWA 2VF8A 3OT1B 1QZXA 4GKVA 4O4IA 1C80A 5FNVF 3ROKA 4D9CA 2PL1A 4J4HA 5G1NA 2G0NA 5ADHA 1L5QA 1UODA 2GPBA 3O4RA 1MV5A 1F17A 3GVIA 3IBYA 1H1LB 2GBPA 2YZ7A 5E6UA 4GZLA 2BFNA 5KOHB 1GTSA 2IUYA 2JLRA 4UHCA 4G8JA 1DEXA 3WNZA 1W25A 3BMQB 4GYKA 3LIPA 3PUZA 3QPBA 3FFBA 2WILA 4RV4A 1JQ3A 4WXYB 5FWXB 1JU4A 1MC5A 2Z1MA 1RC0A 2FU5C 4MAFA 4TV9A 3UJHA 3MD9A 4UNRA 2OFOA 2RH8A 1S3IA 1MR3F 1I2CA 5DGTA 2DBVO 5E9QA 4AN1A 3U44B 1U3CA 2QHXA 4YRCA 1XMSA 3SQXA 2C31A 4JLUA 1EK0A 2FWAA 4OJMX 1ONPA 3L7KA 2BM8A 2QE7A 1ZG3A 4L6AA 4XWOA 4K9RA 4NCJA 2RG1A 2A94A 4ZHQF 2P4UA 1N5RA 1ZVKA 1M6YA 3L7AA 4Q48A 1OXUA 2XV1A 4PHGA 4DQKA 1BJRE 4LZLA 3QKRA 4M60A 3ECSA 3MPOA 1ZH6A 4MRRA 4JEUA 3LY5A 4YRAA 4N8SA 1XK6A 3T7SA 3WHLA 2BJHA 3QNMA 1B1CA 4Y6QA 1JHDA 1KVRA 2ZSUA 3RKRA 2CDRA 2AI1A 1GG9A 1U1EA 2NO0A 4PCLA 1XTBA 2IUSA 3K9LA 4MUKA 3VDXA 1WD7A 1RM0A 1XF1A 3E3MA 5B1HA 1G3IA 1JR3A 1D5CA 5HRAA 1WABA 1JEJA 4OHMA 4UTZA 4YRLA 2EP8A 1QMPA 4KXWA 2DHCA 2HFKA 1VKHA 3HCDA 5BYBA 3L93A 5JAZA 1SPXA 4R7ZA 3KB1A 4FGSA 2Z2ZA 2GTIA 5CIWA 1SXJB 1PGJA 5GZ3A 1GZHB 2IK8A 4KNWA 1WCIA 2UYQA 2A0UA 4O4IF 4ZKEA 4RCYA 1CSEE 1A9SA 4YJ3B 3QLUC 2DWPA 2XNCA 3A9VA 3WYFA 3WL5A 4CG1A 5HKKA 2GZMA 3NNSA 3T9FA 2IZOA 4C01A 3D4BA 3FTCA 3I0NA 4AUNA 2PZJA 3WYNA 1FCJA 1BMFD 3VPXA 3B1YA 5U1PA 3UWDA 1ST3A 4I3HA 1DQSA 3M4XA 4D45A 4C76A 1H0RA 3M4ZA 3QOYA 1GCAA 1YAHA 2XWQA 4F21A 4RETA 2IW1A 1DT5A 1EUZA 1YZYA 4RW0A 4TV9F 4ER7A 3H97A 3UT5B 4LXXA 5A4AA 4QUJA 3TEFA 5BPHA 3ZEAA 4ZV4A 1VE5A 3PNSA 1OBOA 1PJ8A 3TL6A 2LV8A 2I8CA 3IULA 5FLEX 4LK3A 3U40A 4BQNA 3ETCA 5KTOA 2GNOA 2AJBA 1SHKA 3RT7A 2Q5QA 1MF7A 4GPEA 3VH4A 3ES9A 1KEUA 2Y1DA 5ESDA 3TEJA 4E30A 5LKAA 2GEFA 4FI3C 3LX6A 3V00A 1WPQA 4CMCA 1JLHA 2X2EA 721PA 3TIXB 4XWYA 5BSEA 3H99A 1WTCA 5CXUA 3HZOA 4BQRA 1E1LA 2CFCA 4Q1VA 1EPUA 4ZCRA 4FX2A 4OQNA 2V65A 3EZGA 3TQOA 2EQAA 1VBNA 3PUWA 2PSSA 1V9LA 1K8XB 2G9RA 2B7LA 3SX4A 4QICA 2OVFA 1MX5A 1YJ5A 3HY6A 1ZMOA 2PD3A 3I2JA 4OHOA 4Y9SA 1L1RA 3HA3A 1RYYA 4JJZA 2XF8A 4O3MA 2IEYA 3B7WA 1L7PA 4DWVA 1XLUA 5AVUA 4LOHA 2I7VA 4JOBA 2VNHA 5E6SA 3QENA 4LVUA 4PC3A 4H7HA 2FHPA 3BD8A 4C0JA 4Q9HA 1EHCA 3I04A 4B0PA 1RXVA 3FIUA 4L1KA 3ERCA 2NUPA 1QDEA 2R65A 2PZEA 2FPGB 2P35A 3FCSB 3LBIA 4PAQA 1LX6A 2ZR9A 4YQEA 3ZPXA 3UAWA 3G23A 5T8KA 4MVJE 3SZ3A 3C4JA 2VF4X 2NV6A 4JBGA 4MR8B 1SHTX 2JH8A 2G25A 2WA1A 3VU3A 1RLIA 3K94A 4FQ5A 1YDFA 4EKGA 4G9BA 1DC6A 5CB4B 3ABZA 3CA8A 3RANA 3RK4A 1MV8A 3JQGA 2A9JA 2AQKA 2AX3A 3BQ9A 4EA9A 2PZGA 2XBUA 4CXMA 1MABA 1DOHA 1O94D 1FNMA 1A97A 1ESCA 1YTLA 1NJ6A 1PGOA 1B00A 2QR5A 5TPWB 3SEAA 3WQHA 3BCSA 3ZQUA 5AK3A 4C30A 1H2RS 5ARDA 5HX7A 2CL6X 1IXZA 3QH4A 5JMOA 5KVAA 1KIAA 2CMKA 2H31A 2PNFA 3EGDA 4OBXA 3U1BA 3E03A 1I13A 3FCXA 1ORDA 3IP3A 4UQOA 1M76A 2ZBDA 3DMNA 4MIEA 4NPAA 1JYFA 4EZIA 4P1ZA 4K46A 4Z49A 1YB6A 1O97D 3AXSA 3L07A 4URWR 4GC5A 4GECA 4J0GA 1K6EA 1DUIA 5HG0A 3DKIA 2JKVA 2X9VA 4I6EA 4JSYA 4UPVA 2ZKIA 3RVPA 1A9RA 4QFDA 4B9AA 1Q1NA 4QGGA 1Y5LA 4HDRA 4BJ3A 3OZXA 3RPEA 1C2YA 1G55A 4J4BA 2DSTA 1NZDA 2GNAA 1NX6A 4KLCA 1X42A 5BMVA 4TLEA 4RHFA 2D3WA 2Q6TA 4CTOA 1LJ8A 1XA0A 1O6ZA 1UADA 2VZ8A 1Y8AA 4ED9A 1GSAA 1V1MA 4Q1DA 2O7NA 3LUCA 3DZIA 1H8ED 1F9EA 1CB0A 5AXCA 1JAYA 3UJBA 4CMAA 2AI3A 2OGUA 1E0DA 2P4QA 3D6FA 1FFSA 4G85A 1CQIA 4ZOCA 1JSZA 2AR7A 3NXSA 4UUAA 3VC2A 4EKIA 2HK9A 1APBA 3KT0A 1TT5A 4JUDX 2ZSBA 4FS8A 3L18A 3OCXA 4QOHA 1MB9A 1U7HA 3KUUA 3LT0A 1BRTA 1QGUB 3FDZA 2C2MA 3N8KA 3WTCA 4NVRA 2QIPA 2QM0A 3TI7A 2JCXA 1IE3A 2GZ1A 4PIPA 4WCFC 4WK2B 3DTVB 3ZHBA 3PXDA 4E0BA 3VU9B 3A1NA 3UQYS 5JRZA 5FLYA 5F7XA 4YMSA 3WZ2A 1NSFA 2PS9A 3NGXA 1GZ3A 4H3SA 4HYQA 4J7XA 4NIMA 5G0WA 2AKEA 2W8ZA 5IWCA 1EMDA 4FU0A 5BT9A 1ZHFA 3SZLA 4V0NA 2BJWA 3BQMB 4CIAA 1IU9A 4ECEA 1MHPA 1Z5OA 3ZDZB 2CVQA 2PZ8A 3MB5A 4UC0A 5B4TA 3NVDA 5AI0A 2H92A 3BWMA 5THQA 3WWEA 3KSBC 3OBIA 2ZR7A 4KUHA 3ESCA 4TWRA 2NACA 5BRJA 5KHAA 3B1XA 3JVEA 1K5PA 3TCXB 4DXHA 2BY4A 3C3KA 5GM2A 1KYWA 4DM4A 2JD0A 3FY4A 4NCXA 4L51A 3TSWA 3WNVA 1FB5A 4AU1A 4C2AA 4L6IA 3T5TA 4C0SA 3MRXA 3QLJA 4HQFA 2ZIXB 1SG9A 3NT5A 3BJEA 4UFNA 1KNXA 2Q7XA 3NGLA 5BN4B 2FFAA 3BREA 3CRZA 5ALWA 1RS0A 1CDEA 4BL5A 4GYWA 4RH3A 3N2GA 3KOMA 1V6AA 3TR0A 3V8VA 4EPVA 1ZMBA 3EQ6A 3GJZA 2OO5A 1K88A 1CRLA 4QREA 5KQLA 4JB2A 4QYXA 1XZDA 4Y9DA 3W8EA 2ZRAA 1DQZA 3A9TA 1SG0A 4BUJA 1ZD1A 1Q0QA 3WJAA 2A5DA 1D0IA 1NQXA 1ZXXA 2H8KA 1DKPA 1KVUA 1TUIA 3BMOB 4QGAA 3MJDA 5AW2A 4OEHA 1FNDA 2O2EA 4LDAA 4X94A 4XQ0A 3LHDA 2GYWA 3CWZA 1S0UA 1N6RA 3RC7A 1ZA1A 4Z0HO 4J1NA 1OXBB 2P2ZA 1UBLS 1VHJA 1X7ZA 3EXG2 4U7JA 5KDOA 2NVOA 4YJ3F 1KQOA 1OR8A 1XBTA 4XQ9A 4KOEC 2F8LA 4CMEA 2V9CA 1YUNA 2VTBA 2GN4A 1ZJYA 2OOKA 5BV2P 2BD0A 2C0CA 2QAGC 1E2IA 4ZU6X 4B40A 3OFJA 3FHCB 2GVDC 4ND7A 4QG3A 2MR5A 2HWYA 1R5NA 5CX1A 3VGPA 5CYGA 1CR6A 1EK2A 2VPTA 3TQIA 2V5AA 3LHSA 4M0FA 4QUEA 4DA4A 2J45A 1I9CA 2ZE7A 1PWZA 3KUDA 1GP2A 1E8NA 3N53A 3NCTA 3HKDB 1USWA 4X1IB 1OLXB 3GVCA 3Q5GA 3B70A 2HF8A 3ZGZA 3S27A 2OL4A 1BJTA 3DOJA 4OGFA 2FWBA 4K0RA 4EYSA 4Q02A 1JXOA 5ESWA 4QXQA 4EQ6B 2L82A 2IBTA 1YQWA 1QVWA 1EH5A 2AEMA 2NV0A 2XUPA 4PX5A 5TR9A 4FB4A 1KAGA 1G6KA 2VF7A 3S2EA 4EZBA 1I0IA 1M2JA 1DWQA 4IQ8A 3AI1A 4OA8A 5H3HA 1E9FA 3WB2A 3ADPA 3BIWA 3DE7X 5E1BA 3EPPA 4F71A 1XN4A 2BEVA 3OIYA 4HDKB 4YCCA 3SFVA 4F7WA 5IX8A 4UE6A 3E5RA 3FOAA 3PIDA 3VFDA 1DC5A 3OTQA 3QKSA 2QTFA 4DSZA 4G07A 2GRUA 4OLFA 1WW3A 3RQIA 2VFAA 3IVXA 1YE3A 2VL7A 3BB3A 1RXIA 3IEKA 3THRA 3RRFA 2HSDA 5J9FA 3OIUA 4JV5B 3DKKA 3OLVA 2CHEA 3NTXA 4KPFC 2BM0A 1V9SA 2VSYA 3I9V6 1CE8B 2H11A 1JMVA 3UMBA 1T15A 1GPJA 4R4JA 3SR3A 5CVVA 1ZCAA 3SP1A 5BW8A 5JYCA 2VAPA 3JQ7B 5KSYA 2PKRA 1JSCA 3GAFA 1W48A 3PHIA 3GUZA 1QGZA 2Q4DA 2W7TA 3JTEA 3D3QA 3DQPA 3HU5A 3JQBA 1NY5A 1XEAA 3R76A 2XZOA 1V47A 2CBGA 2DEUA 3LKDA 4HWGA 1SUSA 4I5EA 4YRQA 3RB8A 2QZ4A 4DCNA 2O3UA 1AGNA 2Q6KA 2XT6A 2E4VA 5ECGC 3PXGA 4EA7A 1RXUA 4QTTB 4TYPA 5KSZA 4TM7A 2PUVA 2Q3DA 4ZN6A 2PZLA 1R9NA 1K8ZB 4E70A 1ZL2A 4NCNA 2WBLC 3U9LA 2Y76A 5AW9A 5ESRA 1U3UA 1ZO8A 3JPWA 3KVNA 2AN5A 2I2BA 4YWJA 3TZHA 5FWYA 5D7NA 4MXDA 2BKUA 4L16A 4LA4A 1KZ6A 2HDNB 2C83A 2WKPA 3G17A 1SVNA 1ZX1A 3G79A 3K16A 3UMSA 4F3KA 1GM5A 3T4EA 2VH2A 1FA9A 1EZ1A 1NXSA 2G71A 4RVGA 4XD2A 1MX1A 4OHFA 1AKYA 1FUKA 4HPJB 3UWOA 4MQ4A 2GCPA 4HDSA 5KO2A 3FOZA 5BNIA 2OMEA 3QVWA 1A76A 1NVAA 2PANA 1GYPA 2XTJA 1UJBA 1GFSA 1NX9A 2XE8A 3A9UA 3O8BA 1UWKA 3FM9A 3Q3HA 4HF7A 4XIGS 3SGLA 4XGNA 3T3HA 3THYA 4KR7A 1U1GA 1QH9A 2UZ1A 5F3DA 1QPGA 4NCBA 4IMIB 4XPZA 3AVOA 3ZLTA 1JVNA 1Y80A 1DRUA 2HM7A 3EW7A 5DFAA 5HIAA 1YHZA 4KV7A 3W9BA 1JFTA 3GGCA 1J2RA 4IBOA 3STVA 1C0PA 3OLXA 4CLXA 4YMHA 4CL8A 3CW8X 3FTNA 1T0UA 3ZI7A 3UXMA 4DMMA 4N9QA 4YUXA 3FZNA 3GNQA 1Z17A 3TM4A 1T9CA 3HVUA 4FFOA 1QYCA 2ZSIA 1LRLA 1HY3A 3D0KA 4R8KA 3V7YA 4LFBB 2DQSA 2GETA 2OVBA 3SLKA 4AS1A 2V45A 1EVEA 5BW5A 4OBEA 2M2IA 1CS0A 3A0UA 3PV0A 2UZ4A 3P27A 5IT5A 1JXAA 2ZWIA 5JI2E 1E2PA 4UBOA 2N1MA 1CVRA 4GMHA 3DBIA 5IJ0B 1EXNA 3KJHA 2AQHA 3LXMA 4E6PA 1NAIA 2HU2A 2Q99A 3JQEA 4Z86A 2WJGA 2ZRKA 4S0ZA 1YRHA 4U8HA 1I4OA 3RNOA 1YVPA 6REQB 2OWEA 1QBGA 4FIDA 3WL4A 2A78A 3K0KA 1IOWA 1E4VA 3ZHTA 5EJ5A 5IDXA 4Y2SA 3IA2A 2Q9UA 3M0EA 4FLMA 3R7WA 1SVIA 3CVOA 2TS1A 4PSKA 2YXBA 1A88A 3GGJA 3OP4A 3S2IA 5JS6A 1LU9A 1VL2A 1T3SA 2ZXUA 1S8OA 2COKA 3BIJA 2AEJA 1X1DA 2JJ2D 5FUYA 5IC4A 2JHAA 3SYLA 2VHTA 2HT1A 2G5GX 3GC6A 2CJFA 1W75A 4KIFA 3O31A 3QJ5A 1UZMA 1LXCA 2B83A 1FDOA 2W8BB 1N1MA 3QKIA 2GJ4A 2NZUG 4L3WA 4MI6A 5C1IA 2GN6A 2LR0A 1W49A 1ACLA 1N6OA 2BUCA 2PK3A 3RSLA 4E13A 1N34B 1YA6A 2HKIA 4PAGA 4YH1A 4DTCA 1ZI6A 1K3UB 3TS1A 2PDAA 3QUTA 1GL9B 1KI6B 1Q91A 3ITNA 4P4SA 1Y1QA 4GRDA 2YFYA 5DOZA 2I4TA 3PE4A 1U4SA 1MB0A 2B25A 3HUTA 5HJ2A 1ECGA 3AKCA 4QPDA 5LB2A 1S9DA 1KDPA 2H2DA 3F5FA 4DY6A 5BQ3A 1H3NA 4X44A 2QL7A 2YNMC 2GMWA 3AXTA 3N3BC 2XH8A 4TLLB 1YOVA 4Q9IA 2WQZA 1Y82A 5CR9A 8AT1A 1ZISA 4UHEA 2YW2A 3DE6X 2A35A 3QUQA 3RODA 1XTKA 3GPBA 3LG2A 1J70A 1TTPB 3REQB 3FMVA 3JATA 1MA3A 1FTSA 4GNKA 5EHXA 3VR0A 2DPMA 4YJHA 4WKGA 2A9VA 1K86A 1ZVQA 4B87A 2AK3A 2FW7A 4IDAA 1YKSA 1X74A 1QS0B 2E87A 3BIFA 1DUSA 1Z47A 1ZIXA 4ME6A 5DYTA 2HIMA 3R7AA 1N75A 2BHTA 2HQSA 2VR1A 1JUDA 2VZLA 1TK9A 3AJRA 2J41A 4PYMA 1YI1A 1NMSA 2V6MA 4CQLA 3GFTA 1AQIA 1H6AA 2CJXA 4QBFA 1ZM7A 3GDFA 3NBUA 4PO1A 3UYLA 1A4IA 3IH5A 3KKKA 4MLCA 1M83A 4OXYA 2B5WA 4TGLA 1E6UA 1GPKA 4CG0A 4JP1A 3HZRA 3HRKA 4RLSA 4C0HA 2MYUA 2PEZA 5AI4A 5HK8A 4UU8A 3SS9X 2FWRA 1KEEB 3DC7A 2HF9A 2Q49A 4KQWA 3PFBA 4YS6A 4S05A 2QMHA 2QXTA 2FQWA 3B8EA 3HNRA 3SR0A 4DN6A 1CUEA 2NZJA 1SVKA 4IZ6A 2BFBB 1WCXA 1KY4A 2R84A 1RWMA 4OXKA 3V1MA 5FBRB 3RC1A 2GGSA 4GBGA 2FPPA 1KDTA 1PX2A 2BI8A 2C0QA 4G37A 4QVGA 4U7PB 2ZRGA 1M6NA 4IFIA 2HD4A 1CVLA 2IYXA 2VPWA 4CCSA 3H8JA 4WE3A 1C1DA 2VK4A 3H05A 3VKFA 9ATCA 2ZTHA 5I4BA 5ENDA 2HWXA 3OPXA 2J6HA 2WF5A 1T4CB 2IUEA 2V4UA 2BMWA 3GWZA 4AKSA 1GPAA 1ONOA 2RC6A 1EVJA 1M6VA 2WT8A 5JCJD 4NK4A 4HNGA 1GT6A 2PJRA 4BYMA 3NMUF 1UPUA 5KJCA 2IYSA 3V4OA 4BTEA 4YAGA 2SECE 3V7NA 3LH5A 2Z6QA 2ZUEA 1TYAE 1TKBA 2E5FA 2X5NA 2BDEA 3IUNA 1V6SA 1W4LA 4F4UA 2YY7A 1JG2A 2JBHA 4EHHA 3ETNA 1U0OC 2YR0A 5EFZA 2Q6IA 2VJCA 2QG4A 1W35A 3C3CA 2O7SA 1QV7A 3RSZA 2OYRA 1NATA 2XZTA 5FKJA 3VNRA 1T2NA 1TTQB 2H08A 3LRXA 4JLSA 4OTZA 5CT4A 4HNAA 4D3ZA 5JAOA 3H1TA 2NQ2C 4EHBA 3GN2A 5EUMA 2PQ2A 1KH3A 2W4IA 3WOVA 2EJBA 4LHSA 5EJFA 1DINA 1I10A 1Z6GA 2B7BA 3EGXB 2R7MA 4FLEA 4GZ3A 3T06B 1G41A 2ZOSA 4EJ2A 4NEQA 1ZOPA 1DEKA 4BASA 3C39A 3HU1A 5IJAA 1VL8A 2UZIR 4JGGA 4G5QA 5IZ4A 5KC9A 5L3ZA 1V5WA 4DUYB 3DCJA 4A8JB 1F2UA 2O2IA 2PIDA 2RAFA 2X4GA 3OPYI 3TBFA 5JSHA 1PK9A 3JS5A 4N3AA 4EY8A 2V7QA 2VDNB 5FOUA 5AFSA 4J2TA 4HH0A 4RVNA 3EUAA 3RYCA 2GBLA 3EGOA 3OOHA 1B42A 3OO1A 3IDQA 3HM9A 1JLRA 1QKIA 4KWTA 5JNVA 4DB4A 3MGGA 3V8NA 4A5SA 4B5LA 5AVTA 3IERA 3AFNA 2OBBA 3HLYA 1MIOA 3OHPA 5AJHA 5C37A 2WICA 2JFOA 3NBFA 3F7NA 3ZQ6A 4MW7A 3NUGA 3O75A 4X71A 1Z63A 4PZAA 3A4TA 3KDSE 4ZA2A 1SU4A 4I4IA 4JYPA 1TAUA 4DLVA 4IOLA 4LJ5A 5EA2A 3O2NA 4MPRA 2JRLA 3L7JA 3NRCA 1BCSA 3N8NA 4N7MA 3AOEC 3COJA 3ZS8A 2KPOA 4BRWA 3V7WA 4ZIRA 3HG7A 3IKTA 3SQOA 4U2KA 6PFKA 4DNFA 3MGBA 2QRLA 4ZXPA 4H0NA 2FEMA 4LRXA 3T5CA 2BC9A 4FC7A 1W73A 4H35A 3C0KA 1O3YA 4KN5A 2Y93A 1QKJA 1KTIA 2PUEA 4YV7A 3LZCA 1CJCA 1NVBA 1YZNA 1AHHA 3ONFA 2R62A 4RE5A 1V45E 3CLUD 4ZQGA 3AL0C 2YWJA 2NZYA 3U9TA 2WNHA 3VU8A 1SBTA 1B76A 4BJ1A 2VQ6A 5D01A 2HXSA 2VF5X 3VTAA 4PW0A 3CXUA 1T3GA 3EWIA 1ENOA 2XUKA 3F90A 5F23A 4HRVA 3BL5A 3K09C 4PSAA 4YJGB 2FK8A 2ZDHA 4P0PB 1OTHA 2VAVA 4I6JA 5FXMA 3UFXB 3ZXIA 4CTKA 1FW6A 4TS3A 3MMZA 3NHZA 2OXFA 5C3UA 3S1LA 5FPKA 4HNRA 1RNLA 2NAFA 3DFZA 3LX8A 1RZ3A 1Z37A 3EZFA 1GG5A 3PR2B 4G0NA 2IV7A 2G1JA 4JX8A 4LYFA 5ILOA 2VDWB 2E85A 3D6TB 3KPVA 2QTWB 4FUQA 4YIKA 4O4LB 5H1YA 3V8BA 4YRSA 2P77A 2XPCA 4Q39A 5B6PA 5JMTA 3NFYA 4K26A 1DG3A 2IYPA 1XTZA 3EWSA 1XZAA 5CNJA 1Q22A 5BN5A 3BFXA 2D00A 3JD0A 1HE3A 1TMOA 3QUBA 5FPYA 3LCJA 7MDHA 8ATCA 4MDHA 4LX8A 4UMVA 4HKTA 2GK6A 2FG5A 1OU4A 2QDKA 3E05A 3AI2A 3P19A 3OPYA 1TEVA 4HEHA 4LGMA 2D1FA 3U3DA 3WLLA 4KUGA 1FX0B 5AKKA 1AX9A 2Q5OA 2V8BA 2ZTSA 3GJRA 2CKDA 4JBYA 1M2VA 4P32A 5C5IA 3Q7TA 2X0KA 4BMPB 1U7DA 5FR2A 3OZUA 1NXVA 2FG6C 4XX0B 5J4VA 2FX5A 1W4ZA 2ORWA 2AJ8A 4M99A 4MR7A 3CNOA 4HH1A 1XI2A 1E79D 1CP3A 4JU8A 1B15A 2HF7A