2PS3A

Structure and metal binding properties of znua, a periplasmic zinc transporter from escherichia coli
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
284
structure length
265
Chain Sequence
b'AVVASLKPVGFIASAIADGVTETEVLLPDGASEHDYSLRPSDVKRLQNADLVVWVGPEMEAFMQKPVSKLPGAKQVTIAQLEDVKPLLMKSHGDFNMHLWLSPEIARATAVAIHGKLVELMPQSRAKLDANLKDFEAQLASTETQVGNELAPLKGKGYFVFHDAYGYFEKQFGLTPLGHFTVNPEIQPGAQRLHEIRTQLVEQKATCVFAEPQFRPAVVESVARGTSVRMGTLDPLGTNIKLGKTSYSEFLSQLANQYASCLKGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords High-affinity zinc uptake system protein znuA
publication title Structure and metal binding properties of ZnuA, a periplasmic zinc transporter from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal transport
total genus 85
structure length 265
sequence length 284
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2ps3A01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2ps3A02
1ESZA 3PDIB 4K3VA 4WNAA 5HX7A 1K2VN 5HDQA 3ZK7A 1KARA 1MIOB 4WZAA 1M1NB 2XY4A 1L5HB 5KOJB 3MWFA 1G20B 4INPA 5JOQA 4WZBB 4MX8A 5M3BA 4LJSA 2ETVA 3CX3A 1N2CA 3LHSA 4DBLE 4M7OA 1KAEA 1QH8B 4TKVA 5I4KA 1QH1A 4LS3A 1EFDN 2QI9F 4CL2A 5AFSA 2OV3A 3K1AB 4WESB 3AERB 3U7QA 3BE6A 3PSHA 2R79A 1K75A 4TKUB 1QGUA 1G21A 4N01A 4NNOA 4PM4A 1H1LA 3TLKA 5KOHB 4NNPA 5GGYA 3GI1A 2PRSA 1N2ZA 4INOA 2AFIA 4G07A 3PDIA 3TNYA 2MINB 3AETA 1FP4A 3AEUB 5M2QA 1PQ4A 2AFHA 5KHLB 1G20A 5BVHA 3LI2A 3MFQA 4OVKA 2XH8A 5CX1B 3AESA 4WN9A 3HH8A 3MINA 2OGWA 5BVGA 4XPIA 2OV1A 4ND8B 1QH8A 4MLZA 2Q8PA 4OXQA 1M34A 2PS9A 2WHYA 1PSZA 4IRMA 3EIXA 3NU1A 1K0FA 3K1AA 1N2CB 2XUZA 3MD9A 1M1YB 4FI3F 5GGXA 5FLYA 4BBPA 4TKUA 3R5TA 4PAGA 2X4LA 4TKVB 5B58T 3AEQB 4HMPA 4B8YA 1TOAA 5CR9A 3ZTTA 3MWGA 5M34A 1XVLA 3AEKB 1MIOA 2XDQB 1M1NA 2OSVA 1QGUB 1KAHA 1L5HA 5KOJA 3UJPA 1G21B 2Q8QA 4MO9A 2YNMC 4WZBA 3HJTA 3EIWA 5JG7A 4WNAB 2M6LA 1H1LB 4UTPA 4FNAA 4UDOA 2RG7A 2XQVA 3ZK9A 2R7AA 4WZAB 2AFIB 4HMOA 3PSAA 3R5SA 3AETB 4H0FA 1FP4B 5CX1A 3BE5A 2AFHB 4HMQA 4ND8A 4UTOA 4WESA 3AERA 5BVHB 4H59A 4FKMA 4MDYA 3AESB 1QH1B 2O1EA 3MINB 2YNMD 4WN9B 3HXPA 2M6KA 2WI8A 1M1YA 2PS3A 4HN9A 4UDNA 4XPIB 2XV1A 3ZK8A 5BVGB 5KOHA 3U7QB 3G9QA 3AEQA 3TEFA 1M34B 1N4DA 4OXRA 5JPDA 3ZKAA 2MINA 1K7SN 4FILA 1N4AA 3AEKA 3AEUA 2XDQA 5JJ5A 4GICA 2PS0A 2PHZA 4G09A 5M29A
chains in the Genus database with same CATH superfamily
1QS0B 4L4UA 2GD6A 3M6IA 5CU7A 4PZYA 2WKRA 5BP7A 4KMOA 5CFQA 4OREX 1CRQA 1EDOA 4OBBA 1OLXA 4HLNA 3DE2X 1OTHA 2PYIA 1FA9A 1N2OA 4E4RA 5JDCA 4AIIA 1TVEA 2PD3A 2ARKA 4G24A 2PPVA 4A4DA 4R0MA 4UEKA 3T9DA 2Q7OE 2VDKB 4R05A 4XCVA 4E2WA 3CH5A 5B37A 2MSNA 3H9EO 3WYDA 2IXFA 3HKCB 5IC6A 1IEQA 1APBA 3CVUA 1QCYA 4MCJA 2D5LA 1W6RA 2IK8A 1A9QA 3ZTWA 2M32A 3MXTA 4F04A 3ND8A 4UULA 2X9VA 2QTCA 4MIEA 4KWHA 4WEQA 4LF8B 4ZOCA 2DH5A 5HGJA 4KREA 2OMKA 3RBAA 1GNSA 1S3FA 3KQSA 3MYRA 3UOAB 4Q4AA 2GVZC 2ACWA 1BAPA 1PJ4A 2FRXA 4FDLA 3DOOA 4ZQBA 4CMIB 2PMEA 5T6MA 5KJFA 3EH2A 4ZOAA 2Q3FA 1ZDMA 1V43A 4OB7A 5KEIA 1GG8A 4S1WA 2PZ8A 1I3MA 4PAOA 5FT9A 1L5YA 1V39A 3RAFC 2W9XA 1TT5B 3H9QA 5G0SA 3CEMA 4ESHA 1GU0A 3ITNA 1AB6A 3CKMA 3RSLA 1A5TA 2QQFA 2AWNA 2YOFA 1VJRA 2DUNA 3A1UA 4LSMA 4PVDA 3TCNA 4D4HA 5K0EA 5GOZA 1UZUA 2PLWA 4M9UA 4Y8VA 3EIUA 3UXYA 1SUPA 3KAPA 3WL4A 3K9LA 1P33A 3KU4A 1ORWA 3PKIA 3H0EA 3REOA 2YFQA 2C9ZA 4ITRC 2RK3A 4C76A 1Y81A 3K0CA 3E22A 3LAWA 2PJRA 2FSSA 1HRKA 1U0TA 1C1YA 1RYNA 3NU1A 3UG7A 5JAHA 4WOCA 4FHDA 4FSHA 3ULKA 1MB2A 1JLRA 1YA8A 2RCYA 5GGXA 3I04A 3VR6H 4ARZB 3IL2A 4AZSA 1ESDA 1W4BA 2OBLA 2Q0SA 2YZMA 2O0LA 2X7HA 1ABFA 3KVRA 1OBVA 3LY5A 1LX6A 3KU1A 1OZHA 3DXFA 4TYPA 5DI3B 5JALA 4U6QA 2HSEA 3FB1A 3Q98A 2Q2NA 3F90A 3F8SA 1U02A 5FNZA 4Z2YA 3RF6A 2OMEA 1RWWA 2CXXA 3OPYA 2JIOA 4V0ME 5EHQA 1PCXA 1P4AA 2ZI7A 3EZ2A 3OMWA 4DVJA 1VI6A 4HQFA 2JAXA 2QP4A 3U17A 1FL9A 3EZ7A 1EFPA 1JZQA 3H1EA 2L2QA 4FNAA 4MVJH 4X20A 1H8ED 4JOCA 2OQVA 5J58A 1WXIA 4OEHA 3UAVA 2Y1LA 3N7UA 4G1BA 2E4ZA 1UR5A 2BMVA 2ZCJA 1M74A 2IU3A 3VNUA 3VTKA 2IYNA 2CNOA 5HRUA 2VDLB 1GNRA 1JZTA 1HQKA 2ZJ4A 1R5OA 3AFHA 3CO5A 4AMYA 4TRJA 1OGIA 2ATEA 3S8MA 4K6MA 4EZEA 4Z49A 5K0JA 2QRNA 1O2DA 1JIXA 2P6NA 1RMQA 1YVRA 4FYPA 2N0SA 5H9VA 3FM9A 1HF3A 1OLSA 2G9UA 2E82A 5PGMA 1DHRA 4RA9B 4GKVA 4HTFB 2Q5OA 5EIHA 5FUWA 5C5CA 1ONBA 4NTZA 2Q6TA 2PH7A 3HCWA 5HEKA 3DLCA 4U2FA 1GPNA 3I05A 4TUYA 4C7VA 1E66A 2H4XA 5ICFA 2Q3EA 2QYHA 3I30X 3PT5A 3AF5A 1Z2OX 4TTPA 5FBWB 4ZZIA 2BONA 4UPDA 3HP4A 2YV3A 3KPYA 1RLOA 1T0PA 1MG5A 4GR4A 5EXPA 3GDHA 1DARA 1U0HC 3ROZA 4U3JB 5DZSA 2DR2A 4J75A 1KR2A 1N0WA 521PA 4IRXA 3RVKA 5A5DA 3A4VA 3RFVA 4V0RA 4IHJB 2J5KA 5LYYA 1C3OA 2VP3A 2RE8A 1QF9A 3HY3A 1KYVA 4KRFA 2VRCD 1T10A 1GUBA 2C5BA 2IYXA 1P3Y1 2C0QA 3IE2A 4MTLA 1VM6A 3VNVA 1LLFA 3GL9A 1K6JA 3NNDA 1SOMA 2C84A 2QI9F 3HNPA 3JD4A 2CB0A 4M22A 4NJEA 4RY2A 1ZK2A 1Y8RB 2UXCB 3IQWA 1JGTA 5IW8A 4B32A 2VQFB 5D2CA 2VJDA 4RTQA 4DV2B 3ROGA 3T7EA 1SC4A 3KJIA 3SHTA 4HAZA 1Y8CA 2Q2OA 4F7WA 3Q3CA 4JZYA 4K9SA 2CVQA 3WBBA 3KAJA 2B4QA 4HF7A 3KG2A 1JFVA 4K9QA 4LYYA 1YR7A 4N7RA 2W8ZA 4N5DA 4B40A 1QS0A 1N6KA 1GAJA 1MRZA 2H59A 3LY9A 1HYEA 2FEPA 3C1OA 4ZTBA 1UBCA 2P6RA 2M1ZA 3B70A 3K9HA 2F9FA 4M98A 4MPDA 1I7LA 1Q21A 4CEHB 2IUTA 2J9FA 3ZGXA 4FJ1A 3H2ZA 3RTDA 4QXQA 2CXUA 5KYWB 1MGOA 4DCTA 1UKYA 4RTMA 1C4XA 3D7MA 4JA2A 5J5CA 3TSCA 4BJ5A 5IXJA 5KTOA 2DU8A 2IPNA 3AR7A 5IKPA 2EDCA 1JXMA 5KX5B 1U04A 4TLDA 5TGDA 2CMHA 4CV3A 4LBYA 4Y2GA 5ICMA 5JSFA 1VE6A 5THQA 3WNZA 4TL9A 3R9XA 1XDGA 1MO3A 5IT0A 2GK4A 3PFKA 3PXXA 3R3ZA 1C8BA 3T38A 4C03A 1NBMD 3PWZA 4OJYA 4AC9A 4D9IA 2P2YA 3B20A 4D0GA 5J2TB 2ZAGA 2PFKA 4I1VA 5LKRA 3UWDA 2IX3A 2KB0A 3S2EA 3ECAA 4HLUC 1TK9A 5J9FA 8LDHA 3U80A 1E5LA 3N2KB 2FEXA 3VX4A 2R7AA 3LA8A 2VTBA 3KPVA 3MBIA 3AY0A 3PRKE 2IU0A 1WP9A 1L4KA 2OLEA 3NWEA 3NALA 4C7OA 1XK6A 1NMSA 3O92A 3QBJA 4NYJQ 1L9KA 4NCNA 2OM2A 2AD1A 2JVKA 1GKYA 1CR4A 1IY8A 4MV8A 1KRXA 2XQGA 5EXEA 1E2NA 2E1RA 3ED1A 5SV2A 1A2BA 2BKUA 4KBFA 3KUXA 1ZOLA 3RYIB 4EHNA 1MDBA 4BX0A 2JLXA 1YRBA 1J0XO 1KZ4A 1NVBA 3KL4A 2WUVA 2W6CX 3ZQ4A 5HRCA 1UP7A 4ARZA 2HFJA 3CLTD 4W8GA 3IKVA 1XFDA 5LJIA 3OZFA 3JTMA 1X7WB 1ML4A 4CTNA 3L7AA 5DI3A 3BERA 4F5WA 1E2KA 1BVYF 1DXOA 1DJMA 4PR3A 3RANA 4ZHQF 2WJHA 1DMRA 1V5GA 2EW1A 1LA2A 3BYZA 3F9CA 3OWXA 4XVQA 4ZVSA 4DJDC 4DTIA 2DVMA 3DWIA 2O8VA 2WWHA 2IL1A 3SQMA 3WX0A 2VDPB 1NXOA 4U2EA 2EJWA 4G0ZA 3MJEA 4HQOA 3CBGA 4PYIA 3PNOA 1JVBA 1W87A 2VA9A 4A0HA 5C4MA 1BS9A 3VYSB 2VJMB 1REQA 4HGZA 1VIDA 5AUOB 5L3VA 1W36D 3ROTA 3RKRA 1MRNA 2YHBA 3RI3A 1GRQA 4OQMA 1PS8A 2FE4A 4HLDA 1LQTA 1OFTA 3TSYA 5EIEA 1NVVQ 4BB6A 4KE8A 5JNSA 1PEKE 1T5TA 4LVNA 4DA0A 4MRRA 3OJXA 2DHCA 2CBZA 3QX7A 4RORA 5AT1A 1M6VA 3ZLJA 1KDTA 4OIFA 2VKTA 3HU3A 4GQAA 4TYYA 3CX6A 2A67A 1LSJA 4AZWA 4EHBA 1E3IA 1OHHD 2PNJA 1CR1A 2G4VA 3E8SA 3TKAA 3PC4A 4X7MA 3WNBA 3JZAA 1M0WA 3ZHYA 2QX7A 4F11A 1NBME 4UXJA 3V32A 4Q02A 2FV8A 3PUHA 1ID8A 1EYZA 4U7HA 3HTXA 1YONA 4INOA 1EFRA 1W59A 3CUWA 4KDEA 2CY0A 1KY4A 3ZZNA 1YE8A 2FMHA 3LFHA 3NLLA 4Z5XA 3ABOB 3BWYA 4MQMA 1T9KA 4RH3A 4YCLA 2QPLA 2JRCA 4U3JA 1Q0RA 3T5BA 1SR8A 2C07A 2HDWA 3BIJA 2JLSA 1XTPA 4NESA 3WQBA 5KU7A 2VH2A 3HADA 1A7JA 2W90A 3HR7A 3F78A 4I1OA 4EEXA 4IHJA 5C8XA 3UATA 1IQUA 1IBMB 1SCJA 3SE0A 3MEQA 1XMOB 1PJQA 1Z06A 1G41A 1QYVA 1YJXA 3O3CA 4YV1A 5J43A 3HUEA 3H1GA 3GEBA 5AW2A 3M6XA 4B4VA 3Q8KA 3FVWA 4DSAA 3GT3A 3L6RA 3QE2A 3QKUA 5FBKA 2AJLI 3T9FA 1DC8A 5BMVA 3S68A 2FOLA 1IOWA 2FDXA 1M2JA 1FUUA 2RAPA 2WYVA 3EGIA 1UDXA 2XOKA 2VQ6A 1YHNA 1GQSA 2J3HA 4LE1A 3GFSA 4CF4A 2YHUA 4HNVA 3MOIA 1T29A 1TQ8A 4UUBA 1XELA 3W3AA 2Q9UA 1TDJA 5AXBA 1U0NA 2R7KA 2I6GA 3A6GA 2YR0A 4LC9A 3OUZA 3V8PA 1IZ8A 1E1DA 1I2ZA 3L8DA 4U7DA 1EXNA 1HX7A 3I5XA 1T0HB 2FSPA 4MV1A 5I4IA 2IYAA 1CJTC 2YFKA 1RRPA 4YIKA 5A6SB 2PSHA 3V33A 1TTTA 3WFJA 1PTJA 4AP6A 3TPFA 1UBUS 3G5MA 1CJKC 4J1SA 1RQGA 2ZYAA 4LJLA 5KYWA 1ADBA 1O9BA 1CEEA 1LPBB 2Z43A 3IAUA 2QMEA 2VP5A 4O4HA 1XZIA 4UEQA 4WKNA 3X1WA 1XZNA 2P9EA 3GG2A 5BW6B 1KOFA 1C7RA 1M8PA 3MGGA 2GUWA 5ICEA 2GJSA 3ISTA 3OPMA 4K9LA 4O29A 4QAQA 1C8LA 2EOAA 4F6RA 5C2JB 3HJFA 3ZS8A 3BRWA 1GKIA 1HE5A 1N75A 2V7QD 3LTEA 4GVLA 2N3ZA 3EIOA 4CKEB 5ALOA 2V0GA 2V55B 2QW8A 4UJ5A 3JQGB 4M21A 4US1R 3R0QA 4OU4A 4DC1A 9ABPA 2JVIA 2KWIA 5J2TA 1H1TA 1OH8A 1PJCA 1RWKA 3BDVA 1WZ2A 3UXHA 1ULTA 3GH3A 5THKA 2EL7A 2XXAB 2OFWA 1HTBA 4ER0A 1TMKA 2GRJA 1ZUD1 2WG2A 3OZAA 3PRHA 1ZM2A 2ZJBA 1Y3AA 2I4TA 4D81A 2X4IA 1T2NA 3VPSA 3D5TA 5L51A 1EFLA 2QDXA 3N05A 3K0HA 4I9FA 4INPA 3EARA 3DCJA 2PUVA 4MW0A 3G2KA 5JC8A 4YP6A 3E7DA 3M3DA 2W2MA 4AMUA 3SBDA 4EFLA 2WHRA 3RYIA 1XL1A 4F60A 4QOSA 2WTMA 4Y67A 1XPJA 2HW8A 1CBUA 4EL0A 3T12A 3NHSA 2DQSA 3OEED 2X3YA 1LTKA 3RCBA 3VSEA 5I7HA 3ZH2A 2XT9A 5GJCA 2BISA 4AX4A 3GHYA 1WB9A 1GDTA 1X7WA 4PRYA 4WX2B 2GZAA 5BSFA 1W5BA 3EEQA 2DY1A 2INGX 3MPUA 4L27A 4PFKA 3T06B 1GL9B 3MJDA 4UHCA 3H8WA 1V16B 5AP9A 3TVDA 2BF4A 1ZK0A 3PLRA 5JSZB 1Q11A 1BMTA 1NR5A 4KVZA 1GUDA 5IRCD 4TX1A 4Y1RB 4AY4A 2ZLBA 3KWJA 2I6QA 1WVMA 4LECA 3RADC 4TL7A 1RRVA 4MGIR 3CXRA 1I7QB 5KTTA 5ISMA 1K7CA 5IJAA 1W0JD 4RO0A 2OKCA 3TN7A 4JDUA 5A0FA 3KT8A 3R4CA 2ZSBA 2MSCB 3JVIA 2FNAA 4MIKA 1SD2A 1R4MB 1OFUA 3ONEA 3L1VA 3A4NA 4OKIA 5TT0A 2OZPA 3A37A 3EC1A 3UJDA 4BO0A 2FPXA 4MP8A 3IP9A 2PS9A 3FW1A 4K6FA 1N2BA 4OSEA 3DULA 3L7DA 5FH9A 5TPZD 4D43A 4U39A 3EMBA 4FKZA 2AN4A 1CD5A 1JMYA 3RAJA 1BZYA 1Y8QB 3QHAA 2R7NA 3BREA 1X1EA 4F72A 2DUJA 3NATA 1BYUA 5E8RA 3W7VA 1QTIA 4HVLA 3HFSA 5IF9A 4LYGA 4PX5A 2JC3A 2CV2A 5HUHA 4RU1A 3WLIA 2AFRA 4RCVA 2VCEA 2BMDA 3U16A 4OB6A 1NSTA 2P9BA 1B8OA 3RC9A 3C5VA 4V1CI 5H4GA 1JR6A 3M6VA 2WU4A 4HXFB 3EZLA 1KH1A 1A5BB 3RQSA 1U63A 5I7UA 1KVSA 1Z0UA 3C3JA 1KYWA 4KR3A 5FV7A 2GESA 5DBFA 3H6HA 1R6BX 5T4HA 1A8PA 3JWJA 3LC2O 4E31A 4AZVA 3NT5A 2O5CA 3D3JA 2NO1A 3G89A 4GGPA 5C81A 4H27A 2A9QA 1GCAA 3CN9A 2OZKA 2BKXA 2WZQA 4C7XA 1KEEA 1NG9A 2DFLA 3GB9A 1T8TA 5CFOA 1FRVA 3OM9A 3AKYA 3RRBA 3SHOA 4F4HA 3A04A 2E85A 5CVEA 4G63A 1XEWY 4J90A 5DGIA 2B5VA 4BNHA 2FQXA 4EBBA 1MW8X 2BI4A 3CLSC 3PL5A 4RKWA 2NYRA 2VH1A 2Q49A 3U48A 4OGLA 1SXPA 4AUNA 3CT4A 5I51A 5EN4A 1XA3A 2WAYA 2IIPA 1XKTA 5B12A 1I0LA 3PQ4A 4XEUA 4L4RA 5COBA 3CVVA 1XTQA 1R0WA 1U2GC 3GA5A 3CTMA 2VYND 4HAWA 2FN4A 4QE3A 4Q9JA 2NZYA 3D59A 3HKBA 5FKJA 1G0NA 1VPEA 1L7QA 2P78A 4MO2A 4BO4A 1R88A 1T2EA 3D7RA 3T54A 4DGQA 2MSEB 4DWWA 3DL0A 3DTVB 2V9ZA 2ZRQA 2WMNB 4MOWA 2ZR9A 5LYJF 2WF9A 3S1SA 4JVMA 4G0QA 1R0RE 2D8AA 3OJFA 2OCLA 4JVOA 3CONA 4HEA1 1VJTA 3PC8C 4QJIA 2JBAB 4TMVA 1GYPA 5AOAA 2ODEA 2R25B 4WFJA 4ZO6A 4C4SA 1XF1A 1RZVA 1CJVC 1TJ3A 1RBMA 1WBJB 4RZ3A 5IAOA 2P79A 1RWXA 4EK9A 4LZAA 1MW9X 2HXGA 3O4FA 3OLWA 4UM9D 2ORWA 3K70D 1YA4A 1GADO 4CKEA 1O58A 2H4FA 4CIAA 3DSRA 2F17A 1L8AA 1RWBA 2QAGB 2Y6VA 4AWBA 3GRVA 3IUQA 3L4EA 3NYRA 1HZJA 1USUA 1IN1A 5LD2B 4P32A 2JW5A 3SR4A 3DE5X 2XXAA 2ZROA 2V5AA 4LW8A 2Y1FA 2OYSA 2QXYA 1XO1A 1ZM3A 2P67A 4URUR 4FX5A 4KJZA 1W88B 5DNVA 5E6SB 1XU7A 3W5SA 1YR1A 2DWUA 4YQFA 4YUZA 4L0QA 4TZKA 3MBOA 2HMSA 4HVTA 1GN9A 4KO1S 5CNIA 4YJKA 3RS7A 3VAAA 4YR9A 1PJ2A 4RTOA 1VCOA 5JQGF 3O91A 1XXLA 2YWFA 4EVSA 1IE3A 1H8EA 4N1AA 1M8FA 3KZXA 1XBTA 4CMAA 4XFDA 3ETGA 1E2EA 2FPMA 5HUQA 4GLOA 1SK8A 1M1XB 1F3OA 5DMXA 2VT3A 3DE6X 4UATA 1ULBA 3BWCA 4DA6A 3QX8A 4QT4A 1TMGE 3VO8A 2NNWB 1Y3CE 1FYEA 2HK6A 5BQXA 1OXUA 1AZLA 1L5LA 1U7UA 2ON6A 3PE6A 4AO6A 3OIGA 4MWEA 1GPLA 1N6HA 3GJQA 5DKFA 5CLIA 1TM3E 5A04A 3TIVA 3FBGA 3NVMB 2AQ8A 1F2UB 4UREA 4HAUA 1JE1A 1TW2A 1CUZA 2D7CA 2ZSDA 3CUVA 4IHQA 4GKJB 2O8EB 2ZIFA 3N8KA 1M0EA 1L7DA 4ND7A 4C0QC 1QK5A 5KWVA 1ZHFA 4JR2A 5B1DA 2HY7A 1L1QA 1RI2A 4NV0A 4UHDA 5FPYA 3IAAA 3B7WA 1PZEA 5F1PA 1RJDA 3HY6A 4BV9A 3K53A 1QH0A 2EHJA 2X0DA 1BS2A 1Q84A 1Q0ZA 4ZT3A 5TV2A 4HT3B 1B8NA 1SBYA 1SCAA 4NCHA 4ITUA 1E7MA 4IIVA 5KVVA 3H6GA 3ESQA 3U4CA 2JIRA 4BASA 1ICIA 4RHEA 1NW5A 5CB6A 4OP2A 5K5EA 1Q17A 3OCCA 1BXRB 5ETJA 1VJGA 4FEYA 4MR8B 3VSBA 4CHTA 1JNXX 4R0VA 3LXMA 2G1PA 3TGLA 4F4IA 1R7RA 4ARBA 1TUIA 5DHSA 2C4WA 4O2RA 3MK31 5JU6A 3V1NA 1GGHA 2JCGA 3PUYA 1QG0A 1DI0A 1S1MA 5DFAA 5DTQA 3O8CA 4H60A 5JHGB 2DC1A 1W8DA 4PYLA 1TZ2A 1W9HA 3EULA 4PFQA 1MHTA 1GLNA 1ESMA 2R4QA 4YRZA 5LA6B 2Q5LA 2E4AA 1F9AA 2WHPB 1Y42X 4MPTA 1XCJA 4LA4A 3KQPA 5ELLA 1EA5A 1GRNA 2HGZA 4FFRA 2A5FA 3U3RA 1UKZA 5FB3A 3DVRX 3D6TB 1M1UA 1QBKC 3KKLA 4JJ6A 4M9XA 4WNCA 3TUIC 4C6SA 1XDUA 5K8IA 1TI7A 3A0RB 3I37X 5BYKA 3ZDAA 2JFNA 1PEYA 1OY1A 5CVCA 1RTTA 4BO6A 1PHRA 3DVAB 4CL2A 4HB0A 4NSNA 1SKAA 2GEJA 5C80A 5FWNA 4YYEA 4HNTA 1RWPA 2GYYA 3RSCA 4RZUA 4P86A 2X9QA 3MHPA 4BIIA 1QGUA 2GNOA 4EEKA 4I1PA 2DTEA 2HRZA 5IK2D 2QTVB 3HPQA 4FEGA 5C34B 1CNMA 4EUEA 4KO2S 2VEOA 3DJYA 1BWRA 1N25A 2ZI5A 1FX0B 2VUHB 3M5WA 4M0EA 3L0OA 1FRZA 1X15A 4C08A 1SULA 1NBMA 1OF1A 1G8FA 1KJ9A 1W94A 1L7NA 1BWSA 1VJ1A 3ESZA 4GPTA 2WPDA 2DWOA 4C2TA 1FMFA 3J80A 1TQHA 4PGMA 2R8RA 1DWOA 3OQBA 1QF7A 1RZUA 2FPOA 3HCNA 2B5OA 4L78A 2PBLA 3GUYA 5D3QA 4MA4A 1WUJS 2JBAA 3FNBA 3GRAA 5EJ7A 3KQMA 3D8UA 4P3XA 1HV8A 4IVNA 3DZCA 1O9HA 3OWHA 2AN5A 3FTDA 2WZDA 1XKQA 4A03A 3JALB 3Q3GE 2EERA 3BOSA 4GKBA 4TQAA 2EJBA 5ALNA 1FNDA 2BGIA 3VMMA 1HDZA 2BEUB 5JCPA 2Z5FA 1N2IA 2ZULA 4V2UA 4XVUA 1E62A 3DJFA 3HB4X 4KQEA 3SSAA 3VAZA 4DHWA 2DPMA 2G06A 4Y6RA 3QKRB 4GU5A 4WUVA 3AEQB 2QAGA 3M6WA 4WLNA 3AZOA 3R7NA 3SWWA 3ZHRA 1CRPA 4QSMA 5HZGA 3ENNA 1V7QA 3WZMA 2H5IA 4JBNA 3ND5A 1G3IA 2R6AA 1JHOA 5AJHA 2N47A 5BPFA 5K01A 1PZNA 1T5BA 1XC7A 1XP5A 3TZCA 1V3UA 2VZEA 2CLEB 2ZATA 1KR5A 1PR1A 2EZTA 3F7OA 1NFRA 4R1NA 4OGWA 5E6SA 5FNVA 2JPDA 1CUIA 1ZBDA 4OQ4A 1U7WA 1CRZA 2LV8A 2WY2D 5CVTA 5HM8A 2A0KA 3FCYA 4ZT5A 3MC1A 3QTLA 4K86A 5IBPA 1WMEA 3BJMA 1KZ7B 1PL8A 4LF4B 3B9PA 3ZV5A 2XUHA 1SWWA 3LFUA 2JAHA 4WKPA 1ZHOA 2IYTA 1R2QA 1T1JA 4JBWA 4I50F 2X8AA 3TUJC 2RMKA 3AI1A 2GN0A 1MF7A 2AG8A 3FUVA 3EC2A 4MRNA 2K2WA 2NO5A 1JFFA 3SZGA 4EYKA 1KDYA 2O57A 1TEXA 5FL3A 3M2TA 5TY0A 4GYJA 4ZCSA 1H5NA 3MCTA 1NXPA 1T34A 2DCMA 1U90A 2VUSA 1LBIA 2R6FA 2QWXA 3KE8A 1PK8A 2VHTA 4HSEA 4YMUA 1L4MA 5I7AA 1OGYA 4RVNA 3V1UA 4JLOA 5J1SB 5AW9A 1CUCA 3CUTA 1YD7A 3DOJA 4TKZA 2OESA 2WMOB 5ICGA 1HNWB 1TIBA 3SDBA 3P0EA 1NT4A 1ZSNA 3HA2A 3IP3A 3MB8A 4RNDB 5FPPA 1GZ4A 3EG9B 1T5DX 2TYSB 4K3UA 4NE2A 2GA9A 2HRCA 1A96A 3MYYA 4XAQA 3DONA 1GQOA 4RHFA 2PSJA 5LZ7A 1FVHA 1TUEA 3TSOA 3ZI0A 3ASVA 1JHZA 3AFNA 3BIOA 2QX9A 1ZL0A 1SEVA 1ZD3A 3PU6A 3U39A 5DE3A 1JDJA 3O90A 3OJWA 1I33A 1QCZA 3IQGX 4FFPA 4MVJM 2FJPA 2YWGA 3KHTA 3R9IA 1FC0A 1XQVA 1EBFA 2QKYA 5E7MA 1P91A 1NP6A 4UHJA 4ARSA 4YREA 5CM9C 1MOZA 4MEJA 1I3CA 4UCQA 1TAHA 1YZLA 4V0OA 3D3KA 3IB3A 3NGMA 4MR8A 4ZJPA 3FMIA 3QBDA 1F1BA 1IBRA 1X8LA 3OD1A 1QVAA 2QNRA 2XUDA 4MGHA 2CL0X 3DZ8A 3EDOA 2Q3JA 1OAKA 3WLEA 3G17A 3OQPA 4AJEA 1LEHA 4YDQA 5LOVF 1UMCA 1X3LA 4YJFB 4CM9D 1B6SA 2IYQA 1Z6XA 3Q85A 4DPMA 4EF6A 5HKOA 3WKAA 3UK1A 1K5GA 1Z39A 3AILA 3LLSA 3TZHA 3MILA 3GI1A 4ZAYA 2J5RA 1PJ3A 3DQQA 4J0EA 4D9JA 5CLFA 1ZMOA 5G0UA 3ZY2A 5BW5A 4F91B 3MB5A 4OBEA 4GX5A 3RJ9A 2QBYB 3ZLBA 1FVOA 2ERXA 2WHPA 1QFJA 3EE6A 3L7KA 3BTVA 1KEUA 1P73A 1LI7A 1PKEA 3K15A 2BBOA 2HBQA 3G7UA 1RXVA 3BTUA 1GGNA 2YWJA 5JH7B 5HDBB 4NOKA 2IS1A 3O2QB 4J16C 3D43A 3QVXA 3P2OA 1BIFA 3A9RA 3SSNA 3WJ1A 5CDSA 4TN5A 1OYWA 2IEGA 3LM8A 3DVAA 5A2QA 1K0FA 1QRAA 3KYIB 4NULA 4YJGB 2Q62A 3SR0A 1R12A 4B73A 1G3QA 1F4LA 2K6GA 2HSJA 2X76A 1X1CA 3CNOA 4L4SA 3DG9A 3R3XA 2COUA 1RYEA 5CA0A 5CJPA 1RLJA 4AUMA 1V6SA 3NHFA 5JAIA 2CNKA 1O4WA 3U5TA 1Z0ZA 5CB8A 5FUYA 4CDNA 2W4MA 4WFQA 2ZPUA 4BFCA 3HUUA 2NP7A 3CM0A 1MC5A 4PXYA 3U3JA 3CZRA 4B8WA 3IQDB 4P3YA 1BMDA 2HCRA 5FUMA 3DH0A 4OAPA 2BP7A 3E9DA 3G1UA 1J2EA 2B83A 3C8DA 2LKDA 3NUGA 2P7HA 4DCVA 1LH0A 4ZCRA 4A10A 1X8JA 3BE5A 3GOHA 3DDUA 3LQRA 4QG3A 4LJ5A 3T1VA 3NHLA 2R6ZA 2XYRA 1KSHA 3JALA 3O4IA 2JI9A 1GGEA 4IDEA 4M38A 4CTOA 5JSHA 3JWIA 3E5NA 3N75A 2YNMD 3CXUA 2ODQA 3GA7A 4HAXA 3UAXA 4B3RB 2AQHA 4M89A 3VM6A 5JE8A 1E1NA 2J3EA 4CIXA 3AEQA 4MRSA 2GN4A 3CH7A 3KOUA 5B1IA 4A3SA 3AVQA 1KU6A 1YRAA 1Z2DA 5I5GA 3ZY5A 2FRVA 4PC3A 2ZIWB 4NU0A 3WGNA 3RJ5A 1F8UA 2JS7A 2QVCA 3FMFA 4D4MA 5DLEA 1AIPA 2DF8A 3IDZA 5D87A 5A4FS 2NWQA 4A2QA 3GHHA 3MCWA 1KOJA 1HYQA 3LC0A 4KXVA 4RKRA 5I9NA 2VOJA 2IZ1A 3K4PA 1E69A 1STOA 2O7SA 2E6KA 2KBEA 2IEDA 1X1SA 3CUKA 3O3OB 3QXGA 5LMUB 4WBNF 4OHBA 3RS3A 3NFYA 3V00A 1M1YE 2OGUA 4JENA 5TDHA 2YMQA 3RIGA 3HSYA 3L02A 3EPPA 4R54A 1J07A 4Q4JB 4EF5A 3I5UA 4YPFA 2OV8A 1V2HE 1Y7TA 3NC0C 3R8FA 6CHYA 3GP5A 1RJFA 3A3YA 4B75A 3PP8A 1A1SA 4FIDA 3SYTA 1I7NA 3V4VB 2H08A 2Y76A 3WGHA 4G5OA 3W3AH 3K20A 3T1OA 1PBTA 3R7WB 3BM5A 3PSHA 1U3FA 3ETLA 4M6WB 4QODA 3KQHA 7MDHA 1OH5A 1WOYA 3KKEA 4HNSA 4CV1A 4DMUB 1U0FA 4LRQA 2OYRA 1T2AA 4OKSA 5INTA 4N5LA 2ZZKA 2C59A 1V1RB 4PCAA 4AY3A 4IJUA 1XVIA 1ZRMA 1ODLA 4R1MA 5FOWA 2DZDA 2ZT5A 3QQ5A 4IDHA 1QV6A 5EPUA 3WTCA 4B4KA 4Z6KA 5AI4A 4J49A 5LMZA 4IZ6A 4YO8A 3X43A 4Q3NA 3GWZA 3K32A 1U28A 2DE0X 3A7EA 1N6NA 2AMVA 4G0XA 3AIIA 3OCXA 4HWSA 3OUUA 4IXMA 5CDGA 3FWNA 5G4KA 4F71A 5FQNA 4LZWA 5BYAA 3UM9A 4LG1A 4EM6A 3BWEA 5DRYA 4CM6A 1J9GA 3AJRA 1KE2A 4ZZ3A 3HEAA 5CFPA 3G82C 3VNBA 3DTTA 1TCUA 3IESA 5I3CA 4L73A 1MN6A 1MQSA 3QLUA 5A71A 3PQ7A 4LRSB 5JLAA 2BSQA 1P80A 4KWEA 1O5IA 4CMCA 1AQYA 8MHTA 2VJNA 1C0PA 2W5UA 3ILVA 1DAFA 3U31A 1I5RA 2ADMA 2FUG1 5BSGA 4BVHA 1SELA 3H5OA 4O8ZA 1ZH8A 3U7JA 2XBUA 4YJ3B 5EPOA 3HXLA 2FW8A 1TEHA 3OQMA 1O5OA 4YJFA 1HNNA 3P5SA 2Y1GA 4C4PA 5EUCA 2C2MA 1L8QA 1G20E 4UUAA 4NG5A 1KJZA 4JI4B 8ABPA 3IPRA 2GASA 1TE2A 5CK4A 5G1NA 4Z9BA 1EJ2A 4ZTZB 2B25A 3B13B 2R6R1 1ZPDA 1MJHA 4I55B 1JLMA 1KK3A 2QM8A 1BU8A 1ZEMA 1UKVY 2VYNA 4N76A 2HT6A 2P9HA 3AHGA 3HUDA 1YQ9A 2AFVA 3I6QA 3OMLA 2J08A 3ZVMA 1ZK1A 1KI3A 1MVNA 5KQGA 4Y2HA 1ULUA 2WAXA 3CF0A 4QYWA 4ZGBA 1U6KA 5JH7A 3MBKA 2L82A 3JRWA 1UIMA 1IQ0A 1DZ3A 2P4EA 3EXFB 3AGQA 2CCGA 4X3PA 3BL8A 4IO0A 4OP3A 1DKUA 5AWFC 1MEJA 2CHUA 4HQLA 3NHRA 3EMDA 3FDZB 1A04A 3A1FA 2HCJB 2ZWPA 3WTBA 2AZXA 3QVSA 1HDIA 3JD2A 2XUFA 3TTVA 1JFTA 4LISA 3CUYA 5ER9A 3TRFA 4G3XA 1Y6JA 1OCEA 3NRBA 1W7AA 3RJTA 1ZXXA 4UBIA 1R9JA 2VK4A 5C8YF 3AR3A 1P5JA 1OROA 1VC2A 1RXWA 4HGNA 2RHJA 3ETDA 4GE3A 3LTNC 4BFWA 1EE2A 3R75A 3IP7A 3JQ9A 1CK4A 4OUDA 4JHXA 2AW5A 5EWLB 5I9TA 5C8VA 1AUOA 4JV5B 3X1DA 5JZSA 1NJ1A 2B1JA 1C1HA 1V4NA 2Y9PB 1H65A 4XEHA 4MX8A 1JG3A 3LQ4A 1XAJA 3VJRA 4H31A 4E1VA 2G1AA 4WK0B 2WMYA 1U1EA 1DO0A 5LMCA 2PXHA 1WP4A 1EFHA 1N1GA 2DHRA 3ENVA 3RC2A 2XZLA 4N0PA 3KOMA 2BGLA 1DBQA 1N6OA 1NLUA 4ZYUA 4PW0A 5LXTB 3PV0A 4L02A 2A30A 3T3HA 4A92A 4EVIA 1MPXA 4XH9B 5DM70 4QRDA 3BN3A 3K1AB 1N32B 4A5SA 5KZMB 2VBFA 2HWXA 3OCUA 4NARA 3W5UA 2XAAA 4LOJA 4EA8A 3LUPA 2CDRA 1SBHA 1QVRA 1YRHA 1EZ4A 3G2IA 5H02A 5HZKA 3RGGA 1T36A 1AF4A 3ZWYA 4ZT2A 5GZ3A 5NLLA 4ZAGA 4PQGA 1U7XA 2PWZA 4X41A 1S7GA 5AMXA 3OOJA 4YIHA 2ATIA 5FWAA 3AFOA 3PD0A 1AV7A 1WDMA 2BUCA 2M98A 3OE4A 1YQQA 5AM0A 3LLUA 3M1LA 3X1MA 4JU8A 4G4IA 1V1MA 2NTJA 4MYDA 4UTZA 5K0NA 5KSYA 4JBLA 5JJIA 2QV0A 3U5ZB 1AHHA 1DKOA 2QZPA 5EMLA 4KXFB 3TD6A 1KAGA 5AW6A 1RBYA 2ECKA 2OAP1 2EFCB 1E64A 2ODWA 2O8NA 3CIFA 3KDAA 4FZRA 1V25A 1E8DA 5TF4A 3WMXA 2JLYA 4GOND 2W6JD 3UMYA 3LUKA 2JFZA 1P7YA 3FNFA 4YK7A 5FV4A 1HXHA 1BD4A 2WM9B 1G8SA 2FEAA 4L5JA 1GFWA 2JIZD 4GF5A 4NBNA 3P96A 4FUTA 3WYGA 2NXWA 3TJRA 1KO5A 2D62A 4US0R 2YYZA 3CSSA 5DOVA 1N2CB 4RVUA 3RRFA 1LF5A 3R7WA 2H4YA 1V26A 3EAFA 2OOKA 3TBKA 3V4RA 1N5DA 3BULA 3G85A 1O9GA 3V7UA 3SFVA 1LK7A 1SFRA 4XJVA 2Z58A 3R20A 1TECE 2C4TA 2VF2A 2XEDA 3QHPA 2EKQA 2I3DA 5E2IA 4OJTA 3UPUA 1JL3A 1JILA 3L05A 4NAHA 3CWZA 1F51E 3IYLW 4J9VA 3VXKA 4CUZA 4Y0AA 1LK5A 5BSVA 3QLEA 1U31A 4R8MA 1G19A 2VYCA 1SVOA 2AEJA 3GCGA 7MHTA 1PX0A 5C1OA 4M1EA 3AH8A 2BJVA 4WKOA 2D74A 1Z25A 1N77A 5BNIA 2NSJA 4JLUA 5FR2A 1J97A 1LLUA 2QLNA 1AHPA 4NNJA 1CR2A 4C5BA 2NLOA 2IOHA 2YICA 3GEMA 2NM0A 3GAMA 1YKFA 2VAPA 3G9QA 3DOFA 3JQDA 3KZ1E 4YJ3A 3VV3A 5JADA 1Z2PX 5FYQA 5L3QA 5EE0A 3TZBA 4TOIA 1NDUA 1PNQA 3P5BA 5FXMA 1PRYA 3KXDA 4JI5B 1ZCZA 4TS4A 5I45A 1PNTA 4OYYA 2EQ5A 1HEIA 3COZA 4RLFA 2AOTA 2ORYA 3C45A 3GFRA 3KLPX 1NVXQ 3WGGA 2O8CA 4I55A 2SCUA 2ZE7A 4MRMB 5HNKA 3V4FA 5D84A 4CT4B 1NQVA 3GYGA 1U9IA 2GZDA 4OBXA 1XTUA 4F21A 4P9NA 2FXVA 2I65A 4WMLA 2CLHB 3W1VA 3ESYA 3L7YA 2EFEB 1A4RA 2XX3A 3LCVB 1M1ZA 4HAVA 4XYEA 5FPQA 3TE7A 4DIBA 2F8SA 2WJPA 4URWR 3I0NA 4FFWA 3DGFC 4FFMA 1JPVA 1N8NA 3CUSA 5FRDA 1UAYA 2QRKA 4H7EA 5TE9A 4MB2A 1MJGA 2DBVO 2E6UX 4JEHA 4ENWA 1SA0A 4B85A 2IH4A 3TINA 4XGQA 3OIWA 2VTEA 1IBSA 2WKWA 1JJIA 4RA6B 3WYFA 4ABYA 3GZTB 4LHWA 4Z7NB 3RU9A 3I01A 4ZO8A 1DRUA 2IHUA 2PZJA 3A3NA 3IC5A 4FE3A 4XGKA 1YB5A 1GR0A 3H1BA 3OEHA 3O4RA 2DBZA 2DULA 2Q46A 1FCJA 4JVNA 4LDPA 2HEGA 4LMAA 1PZFA 1DB3A 3HJUA 1THTA 3T7TA 2BDTA 3EMVA 3AT1A 3S2ZA 1NQWA 4FI3C 1E18A 2BM9A 4FE4A 1EBUA 4LXUA 3O1LA 3PLAE 1ZITA 4A8JB 3WL8A 3AB7A 4MMZB 3AR5A 3MJSA 1RACA 1LPMA 5IN4A 1JDTA 3Q2KA 4NIMA 4JI6B 3FPSA 1MV5A 1TLFA 2QQGA 3R6DA 3L18A 3ESAA 1O3YA 2AHOA 1XYYA 3Q4GA 4L72A 3U3ZA 1O6BA 3LZCA 2XECA 4QGHA 4IH4A 2Z08A 1P4HA 3WC4A 2EW2A 5JO0A 3EF1A 1RI5A 1MC1A 1Q1GA 1ZM9A 3T95A 2GJ9A 3WWCA 3GGGA 5B7GA 2J3QA 2DP4E 5FP0A 3OICA 1TGVA 5IYZF 4IRMA 1BCSA 3N7AA 5TVKA 3SF8B 4R0NA 1X8XA 2H2DA 3F9RA 3K1AA 4JHLA 4UNSA 2OD2A 1WULS 3MD9A 1W73A 3C7DB 4QPNA 4WBXC 5AKZA 4A8HA 4KE6A 1VCNA 3CNLA 3T4PA 4DQXA 3V2HA 3EEFA 1QMGA 1UWLA 4P36A 1DOZA 1N1DA 1MKYA 4UQOA 1JKJA 5EP4A 5K4AA 4V38A 4YN3A 3AQIA 3IP5A 3TZEA 2Q1TA 3N70A 3WIUA 2OBNA 3LUCA 2MWMA 2IDMA 1FFXB 1IC6A 5AKHA 3NDRA 3WSWA 2E5WA 1Q0SA 3FR8A 4Y2PA 4EZIA 2QD1A 2NADA 4CMGA 3B3GA 2X22A 3LHIA 1WCIA 4PPFA 4BN4A 3GCZA 3ONFA 3NBYC 1Q0TA 1D2HA 1Q83A 3REQB 3IAEA 1BE0A 4ZRMA 3HDQA 1XNHA 1P2FA 2EEPA 2A57A 3TX2A 2P27A 4C2BA 2ATVA 3UC9A 3JV7A 3TIGA 1VZ3A 2O9JA 3OZRA 3NDPA 2PXAA 3I6MA 2UZ3A 3G88A 2QYOA 2GPYA 5E3IA 2YIMA 2I0FA 1ECCA 2HL6A 1IRXA 4K1LA 4O2LA 2I78A 2KJQA 2XB8A 4EO9A 3L4JA 4BXOB 1JPJA 5IFKA 1USWA 2H9AA 3G0BA 3OKCA 4ED9A 4MDFA 3AR2A 1AH2A 3OTGA 2R1VB 1NUAA 3I8OA 3IR6A 5EY5B 5FTMA 2QN8A 3UKJA 5ES3A 1CWUA 3B1VA 5DIFA 1TMYA 4WLEA 5BSEA 1HT1E 3KK0A 1W4RA 1V8ZA 2WSBA 3AEUA 4BQFA 4F1WA 3GCWA 1MOPA 3GGCA 1D1PA 4GM1A 4KR2A 1J5XA 4NZOA 3F7TA 4KLAA 5HE8A 4TLAA 1Y7HA 4AO7A 3K0FB 3PR3A 421PA 2XDWA 5B7PA 1RXUA 5FO0A 1GPDG 1P19A 2L69A 4C0HA 4GC5A 4A6EA 4J7XA 1DCMA 3NHPA 2E87A 3D7SA 3P2KA 2QN2A 2VFAA 5HZMA 3ZWBA 5KYXA 1H9BA 1DEHA 5FLKA 2PL3A 1S9HA 3P8ZA 4CFYA 5CB4A 2GMWA 5JC1A 3SR3A 4WK4B 2CHQA 4RHUA 3BK2A 3ODGA 3GDFA 2XCQA 1ZM7A 3U40A 4BN0A 3MRTA 3OP4A 5MDHA 2VNSA 3OBIA 3GVIA 4FOOA 3ADDA 1ZWKA 4UHBA 1LLCA 1U3WA 3ZKWA 4U63A 4C14A 2IYFA 1SZPA 3NHMA 5LDDC 3F6PA 4M1WA 2E3JA 3Q2IA 4PQFA 3F4BA 1G7RA 3ROQA 3ZHCA 3ND6A 2CVPA 3KEGA 4Z7JA 2OT3B 1CJUC 3JQAB 4GBJA 5KVAA 1K8RA 1GD1O 1UOEA 3TDNA 4COOA 3S40A 3AU8A 4ZGWA 1YNSA 3MJFA 4D5EA 5CA1B 2JGRA 4Y1EA 1AE1A 2CD7A 3UKDA 2XA1A 2GM3A 4QGAA 5AQ1A 1LRLA 2EGUA 3WZLA 5JWRA 1U5AA 2W00A 2WFLB 1BHQ1 4KX3A 3AYXB 5HRAA 1UDCA 2PX6A 2NVWA 4LZZA 3G1TA 3UMSA 3I0ZA 5AVUA 1XEXA 1IVSA 1P5RA 4KR9A 4HZIA 3VZBA 2QN6A 4CT5A 2XUIA 2F8TA 1VB5A 4ILKA 4JL5A 2I4RA 4JCOA 5JAMA 2IVFA 5HQ3A 2FWAA 3G02A 4O25A 4GGMX 3GLUA 2ERCA 3RK4A 4DMRA 2VDUE 1WAMA 1M6HA 1T5SA 1MV8A 1RCTE 2RHBA 4J0GA 2DKFA 4R2WA 1ZIOA 2ZYUX 3D1LA 4D9KA 3V8QA 4PEVA 1VZ2A 1TF7A 2YNMA 3B1ZA 3C3KA 2VZ8A 4FYVA 5D3MA 4GBED 1H69A 1Q1AA 3LQYA 4B7XA 3A25A 1S3GA 2QYSA 3IP6A 4N5MA 1M1NA 1N57A 3JVUA 1KAHA 4PFSA 3UYLA 3UJPA 5KNBD 5IT9A 4FKBA 2IXEA 2G8LA 3WV4A 4CPDA 4XZ3A 2XTZA 2G82A 2J8ZA 3PVSA 3VKHA 1DFGA 2J4DA 3GUVA 4RV4A 5E6RB 2H7CA 1MAVA 2BGJA 3CF4G 4WY5A 2F59A 2I9PA 3OE7D 3W5DA 4M36A 1UK8A 4I8DA 4TS3A 3D81A 1ZESA 1Q0QA 4IGAA 2OR3A 3S7ZA 3V97A 3CZQA 3QPWA 3VDQA 2AN3A 3ND7A 4C4AA 4H7IA 1NVWQ 1V9SA 3A6JA 3KQVA 4H3VA 5H68A 1COWD 3OA0A 1VSQA 4FKMA 4JB0A 4Q37A 3SF8A 2I2XB 3GVCA 1QYCA 4UCFA 2CHEA 3ZWMA 4E46A 5KOHA 4KPEC 3ICWA 2VPTA 1ZNWA 2Z8YA 1JQ3A 5K3SA 1N8TA 3O4VA 5CG1A 1Z22A 3N2NA 4UU8A 3HB7A 4YCDA 1C50A 1POWA 1Y82A 2B8WA 2DQYA 5LKAA 3RUPA 5JJLA 3ANXA 4KGZA 2DFNA 3N5CA 3R0IA 4WINA 4E5SA 5HX7A 3OOYA 1XTSA 5FDFA 2DT8A 4Q34A 2QE7A 3B12A 4KLNA 4P7JA 4G1CA 3IT2A 1UKEA 1E8MA 1ADGA 3GNLA 2BZ0A 1XQ9A 1IAVA 1LZKA 4K9MA 4HTAA 4F8YA 2GJAA 4QLOA 1KQOA 3IH5A 2HMYB 3T7DA 5F78A 1B42A 4KODA 3LLCA 1E2UA 3TJZA 2O4UX 2IUUA 3M2PA 1Q6YA 3NWJA 3PWTA 5IMSA 3RM3A 5BSHA 2VR1A 3IPCA 4BXOA 4Q4CA 4RVSA 1IY2A 2EFJA 2FRDC 4NV3A 4K81B 1Z4IA 3CUUA 1P45A 2R1VA 2LIVA 4KO4S 4LYEA 3CURA 4R98A 3UT6A 2Z9DA 3JASA 2JDIA 3H17A 4QYIA 2W48A 3KKZA 1ORIA 4V0QA 3L8ZA 1U3GA 3GAAA 4KQWA 1KJIA 3FNGA 3K0FA 1XTKA 2ZRBA 4F1KA 2CE7A 2R1ZA 3BTOA 1WNFA 2JFUA 4KXNA 3NT2A 1QAMA 4JP8A 4D92A 4EJSC 5FX2A 5HF6A 1Z2NX 4IKPA 4CMKA 1NVUQ 3OHPA 4NICA 1Y4SA 3TR5A 1QXSA 1SVWA 4AG5A 3DZKA 4DWVA 1MNAA 1RAGA 2YRXA 3OLQA 5ECDA 4HYTA 1U2DA 1M34E 3OETA 5T8KA 4DUGA 2XOEA 1G1MA 3COPA 4DRXB 4JZKA 2YHIA 4LBZA 3ROEA 4YAOA 1VIMA 1EE9A 3PA6A 4CE6A 3SDSA 4OGFA 1II0A 2REOA 3ZZUA 4F2GA 4PLWA 3ASZA 4X1YB 4E2YA 2EBHX 1FS4A 5KNDD 3SKYA 1BGVA 5ALMA 4EI8A 5KJCA 4ZOLF 3HR8A 1XROA 1OZ0A 1PGQA 2LBPA 1KJWA 3I2YX 4FUQA 4PAGA 4R31A 1KJQA 2MCFA 3RSZA 4MW9A 3WMWA 4YC7A 2PCLA 3F47A 5BPHA 4EA6A 1HWYA 3ZTTA 1YNOA 3DUWA 3ZHXA 4IHKA 3D8RA 1G9XA 3GDWA 4FZJA 4BCBA 3F8WA 1YIDA 1CS4C 1L4LA 2OG1A 4OLHA 6AT1A 5KWSA 1G2QA 1Q0LA 2CWDA 1AVTA 3BIWA 1ORRA 2R00A 4Q4LA 5ARDA 1QFXA 3FCUB 4BLWA 2WFAA 4EITA 3LRPA 4X6UA 2ZBRA 3G68A 1YCGA 2O1XA 1O0CA 1H0RA 5EQJB 1WB4A 2WICA 3UXMA 2C0CA 3DE1X 4BJHB 1J99A 1K7YA 1P4RA 2RK4A 1F6DA 3M5DA 4U00A 4Y7CA 4D9NA 1IXSB 3BHNA 1U80A 3UB4A 3PCRB 1VB3A 2HA7A 4RESA 3LH5A 4JL6A 4PLFA 1UBOS 4YACA 5LP6C 3ZI4A 4ENRA 5L7WA 3FOCA 5K6AA 3D6MA 3FNQA 4AG3A 1KWKA 4BE4A 5BQPA 4CDRA 4AMZA 5CMLA 4YUYA 4JT8A 3HZOA 4UUMA 2G28A 4P93A 3EGDA 2B0JA 4EUNA 3RVDA 2TMYA 3KPJA 1E3EA 2IOFK 3FPAA 2G88A 1JYEA 4FHCA 4HI0E 2ZIVB 4NH0A 4RSGA 1CQIB 1YZTA 4QECA 4RPJA 3B3JA 1TM1E 5JBIA 3TVTA 1CP3A 2F8MA 1ZD2P 1IZ7A 1J2RA 5ALLA 1YZHA 2GBLC 5CFMA 2CGEA 4J1TC 4H08A 4OFBA 3SSMA 3VAYA 5EZYB 1P8JA 3JCZA 3MCAA 3NGXA 3P7MA 1MORA 2CXPA 2XIQA 4LXXA 1KPGA 1U8YA 4XOUA 5DM0A 5E6RA 3AOEA 1EQUA 3E9CA 5G2OA 4KWTA 4P5EA 4JKYA 1W6UA 3FGZA 3ET5A 3KC2A 1U0OC 1ZIYA 1KZ1A 2E2WA 2J6CA 2ZBQA 4ZU6X 3IIEA 3KM0A 2ZUCA 1P1IA 1XLWA 1CULC 3AF1A 2AR7A 3K8OE 1IZZA 2NU9A 3D6JA 4CM1A 5JVDB 2ONCA 5AI0A 3C6XA 2XMSA 4PRZA 4MLPA 5AW0A 3FYDA 3O8OA 2W6JA 3C3AA 2FWIA 4UUNA 2VAVA 3PC3A 1G21E 1JWBB 1IEXA 4PYOA 8ATCA 4ER3A 1L8XA 2AGVA 2JIZA 1W8IA 2WSIA 4XJSA 1XJWA 4TV8B 2D1QA 2X41A 2VT2A 1KTIA 4TS1A 4XQEA 2G4CA 4MUMA 3VDRA 2GJ4A 4OM7A 4C87A 3TOXA 3CJTA 1LLQA 1BEEA 1PQWA 3PD1A 1LW6E 1VJCA 2PJZA 3UMVA 1J90A 4MQFA 4W5QA 3EZ6A 4ME6A 4N4AA 1E9CA 3BKXA 5IBRA 4KNYA 4HWGA 1YGYA 3FGNA 4URXR 4RJKA 2QTBA 2WVHA 3KETA 2JGFA 3STYA 1RWMA 4YJHB 1XCLA 3LBYA 3IQEA 3GARA 4F85A 3I9OA 2BD0A 3V1YA 3ZQJA 2J45A 4FJ0A 1E9SA 4KYVA 3KUKA 3WO1A 2I8AA 4JC5A 5K4GA 3CEJA 3U4IA 5C7IO 3WQRA 3NBFA 2NP6A 3EGXA 2C2XA 2L18A 1L9XA 3C41J 2Q1YA 5G3YA 4A1FA 3DFMA 3LDAA 4J29A 1SXJC 2HNAA 2CMGA 2HF7A 2ZIXA 5AJUA 1QGED 1FJXA 2OBXA 1EFKA 2CKMA 2PRYA 3AIKA 3KZVA 2JJ1D 4NXNB 2HCBA 2CVOA 4LYJA 1K6IA 4Q3LA 4RQUA 1QX4A 4DG5A 4L8VA 4IEEA 4ACAA 2PSFA 3MG9A 3C6MA 3HJNA 1C3XA 1O57A 2ZWOA 4EECA 3CYFA 3FSJX 5DOZA 3E4DA 3BMOB 4LJKA 5HE9A 1ZD4A 4MPPA 3ZBTA 1HEYA 3HYLA 1I6WA 2H51A 3UJBA 2YBDA 4HK4A 1YR3A 1HORA 3R0JA 1P9RA 1C14A 1Z13A 3AC0A 1OTYA 3FZQA 2O0MA 3CY6A 4P4LA 5ILOA 1AA6A 1KI9A 1O1YA 1L5RA 1L5WA 4J7AA 4C30A 2HPVA 1F8YA 5FHRA 1TA4A 2QGNA 3H16A 3B2NA 1QNLA 3HN6A 4WXPA 4BNDB 4EKYA 3FGOA 1W19A 5LSAA 4RXUA 5EPEA 1VECA 5BNTA 4RLQA 1NIPA 1XL0A 1GPMA 1OC4A 4NK4A 1VLMA 1JG4A 1R10A 5BO5A 1DL5A 4DW8A 2A4KA 3NAGA 2X77A 2D3WA 3RVPA 3L2OB 1DT3A 1GL6A 3PX3A 3ZNQA 1R0XA 2NXCA 1QDUA 2A0FA 2WJIA 3I9NA 4FOTA 4RLHA 4TL6A 3OSZA 2FSHA 4B3SB 1X7HA 3L46A 1VQ1A 3WS7A 1JU9A 1QHYA 4NWIA 1TD1A 3OEYA 4B3HA 1MC8A 1Q5PA 2NSDA 2FF7A 4C0JA 3B8HA 2Z4TA 4X65B 2OXEA 1NX6A 2WEKA 1TYBE 3IDOA 3VDMA 3H6KA 4OPMA 4BX8A 3KAKA 2P77A 4P22A 3AHCA 2JFVA 2RGDA 4RXMA 2RBKA 5EAIA 5EXXA 3WGKA 1NLFA 1ZGAA 2L17A 3GCXA 4MV7A 2AC2A 2ETVA 2PLAA 5KYUB 5FWYB 4GDFA 4ZT7A 5T3YA 3QE3A 4II7A 1V3VA 4XXHA 1F7VA 3RRNA 5GZ1A 1EBBA 3CZ9A 1TTHA 1CX9B 5KOYA 1NX9A 5AXCA 3SM3A 4MW7A 5EXDA 1LF0A 1A50B 2D0IA 2RGGA 5CDYA 2ZUUA 3N8NA 2ID7A 1Z2AA 3RU2A 1H2HA 3ANMA 1PT7A 4M87A 5ESRA 3UNXA 2C4KA 1Y8AA 2PFGA 6PFKA 5EJ9A 1HTTA 2OZEA 4KTTE 3RSQA 3U37A 5L45A 2F3SA 3GFBA 1X7ZB 1CQIA 4FW8A 4TLCA 3U56A 4I5DA 1KI8A 4J07A 4B6PA 1KI1A 2QW1A 2C5SA 3O93A 4O63O 3TYXA 3LVFO 2XKKA 2MR5A 1DEKA 2GVDC 3P9YA 3Q87B 3D2LA 5EZYA 4WA8A 3CRRA 5TARA 1IN5A 1ZX1A 2AVNA 1QTRA 1XK7A 1DGQA 4MS1A 4E1BA 5DO9A 1AQ6A 3CW9A 4FU0A 3EJ6A 4LRWA 4HGOA 3ZDEA 3LS2A 1GPBA 2BF7A 2DRIA 1EWKA 3MVEA 3NM6B 4KJXA 3TM4A 2VTDA 3H11B 1C80A 3QELB 3SJUA 3IQHX 4BYMA 1EHCA 3ZU5A 2P30A 3WMRA 1L5QA 2PRIA 3AL2A 3ILYA 1RMTA 1GVNB 5F12A 2ZP1A 3SAJA 2CKDA 2FB9A 3WRYC 4BQPA 3MFYA 4HZUB 2F2TA 5SY4A 4Z9YA 1NQ5A 3RAGA 4YUWA 4WI1A 2I6UA 1QLWA 1VSVA 3EW7A 2JCBA 1T13A 3TTWA 3AEKB 2QVXX 2PU5A 2ZKIA 2ATCA 3OZIA 1ZS9A 3BQNB 4DA4A 1LPAB 3ZZTA 8AT1A 4HLQB 2H1CA 5BV7A 2WNSA 5FD8A 1YZVA 4J6FA 1H1LB 3VR4D 3ZJVA 3ET4A 4P92A 1GAEO 1IB0A 4YRMA 4AO8A 3P9PA 5AHKA 3VU9A 3KV3O 4LOHA 4RVDA 1SOUA 2AMJA 1J2UA 1PHPA 2JLQA 3OCVA 1LLDA 4TVBA 1YB6A 3UMMA 2IX9A 3E5MA 4JH0A 4TTIA 4ETMA 4G0PA 3N59A 3MQ4A 3A1TA 1OB2A 1E98A 4DFDA 1UC5B 3C74A 3RRJA 2YXNA 2QTLA 5HJ5A 2A7QA 5FI5A 3GUUA 1JHMA 1GTL1 2Q7XA 4RPIA 4MRPA 5DM1A 4D4KA 3RVLA 2VDWB 4EHAA 4FBGA 4YXWD 3N8DA 5AW1A 3CR3C 3PFHA 1X9GA 3CKKA 3I45A 5BY2A 3L3BA 5JZMA 3HA3A 1GZVA 3HHEA 3RIHA 1XIVA 3L0PA 3P2YA 3RU7A 2WUGA 4YJ2B 2B4KA 3KT6A 3UHJA 4EARA 2H1WA 3PPYA 4GSYA 4KIWA 5DTIA 3ZYZA 1WMBA 1WPQA 4N7JA 1LDBA 3KTFA 5JO9A 5IAAA 4CYMA 3DNMA 1KFCB 2W22A 1JI3A 4GVPA 1E8NA 3BMOA 3MTDA 2R6DA 3ZHTA 4KI7A 5BN5B 2SICE 2ZBGA 1ZI9A 4AF7A 1RP1A 3T7IA 4LWOA 3I61A 2J9YB 3N8IA 3GP3A 3FFXA 1RLMA 4URYR 3F5QA 4EAQA 1ZGJA 3A3OA 2ZB8A 5A3SA 1ATIA 2G0TA 4O2AF 4JP5A 2OYCA 3PZRA 4P0PB 1A3CA 1JIQA 4JB8A 4EATA 4PWZA 5LQNA 2YOGA 3N3BC 4IJMA 5C1IA 3U62A 3TW6A 4CXMA 1Z37A 3ROMA 2HX1A 2BGTA 3TL6A 1FW8A 2ZIGA 5LNK6 5H8WA 1R8YA 3GLHB 3IULA 3HVHA 5P8WA 1Y1RA 4PTZA 2ZB3A 1N5JA 5DX8A 3W9UA 5BNWA 3ONNA 4C2AA 3GMIA 1KYXA 4BNNA 3K3PA 3D54D 3F3SA 4ZYXA 1NUUA 3F4LA 5JXJA 4ZT6A 1QK3A 3L0BA 1IHPA 2ET6A 4POOA 1QTQA 4JIMA 3QVVA 1C9MA 4EG6A 1Q74A 1ZGCA 4P3PA 1U1IA 1Z16A 2W71A 1SZJG 2YS7A 2GZRA 4S2UA 4Y1GA 1MHPA 5E6UA 5FOSA 5KNBA 2XF8A 3ZIAD 4FCVA 1TZMA 4ZYYA 2R8OA 5C31A 3JVEA 2R1TB 2YV4A 1BSVA 2KLBA 3CLTC 3U4QB 5FWYA 1RJEA 3D6UA 5TIIA 2Q9BA 2X2PA 5CFRA 3ML1A 3U19A 2BEKA 2J4CA 4D46A 1ULZA 1Q3HA 1YUMA 1M34A 2Q8PA 3QY0A 1VKRA 4G5HA 3W4KA 4X66B 3OHMA 1RC0A 2H7VA 3RUCA 2OCIA 1N2JA 5E4YA 5A5FA 2EV9A 4QVIA 3TPCA 2HMUA 5F73A 4AMGA 2HPHA 3K9FC 1E1YA 4JELA 1NUQA 2G9NA 5A6VA 3PNKA 1N5IA 1HL7A 3ANLA 1XVUA 4WZ6A 1PW7A 1E2JA 1ZMBA 2ZB7A 4XIYA 4YAEA 4BIMA 2H5JA 3DTNA 3DHYA 1ZWLA 3PJGA 4QU5A 2Q3BA 1PE0A 4HGPA 5KC9A 1U99A 1SXHA 4NATA 1MLDA 5CXUA 3H3JA 2UYGA 3QTBA 2A5GA 4G2NA 4XR9A 4BKOA 4CQMB 2PL1A 4R2MA 4UMFA 1JE0A 4B6FA 4JEMA 5DNEA 1NQOA 5BSMA 2VDNB 1KO4A 4DVGA 2GHIA 4X93A 3IJEB 4J3JA 4BVEA 3EZXA 4DADA 4IZHA 2AT1A 5BVHB 4TL8A 3H19A 4TLLB 1VI2A 1HETA 4KGDA 5ALEA 4EJ0A 3PPIA 2LD4A 3O4GA 5LLSA 1SY7A 1G7TA 1GUYA 1P2SA 3UT5B 5ALDA 3A1WA 1AGNA 1Z8DA 4Q1BA 4YQYA 1XQXA 2I2FA 2FPIB 1W2GA 5KYYB 5KSPA 1QRDA 2VAWA 2R47A 3QUAA 4QTXA 4XDZA 3TEFA 5DLDA 3ZGLA 1L7OA 1U2RA 10MHA 4F46A 1IH8A 2BDEA 1KS9A 3CZPA 2RC6A 5B30A 5DGDA 3AEKA 1ZI6A 5C3MA 2PGXA 3GDGA 2I7TA 4RVGA 3ICVA 2RHTA 1IY0A 3C8HA 2VK2A 3M4XA 1WR8A 2WD7A 1GDDA 4WVLA 1P9NA 2C29D 2W4IA 2G1UA 3L1UA 1GTSA 1WDKA 5H82A 3IPLA 2ODTX 1YL5A 4EVRA 3QNWA 3DPSA 3WGLA 621PA 1JH8A 1SURA 1R50A 1XNGA 1JEEA 2W37A 2ZS7A 4OOEA 4ECAA 4P81A 1NF9A 1TJ4A 2Z2JA 3ZW7A 4S04A 2IYZA 4EP1A 1CR6A 3QXSA 4JWKA 3UUEA 4TMWA 1KAMA 1CYEA 3TQIA 4AICA 1XTZA 3ABSB 3M4YA 2AI1A 1N2XA 2NQ2C 3ZY4A 3VKUA 5C35A 1G6OA 4LY9A 1GUFA 2V45A 3DNPA 5CTJA 2H4WA 3E53A 3BWDD 4J0CA 4MTCA 4DBLC 4C05A 3W8DA 4YJ2A 2PSSA 3D2AA 4RSMA 5KNDA 2VT7A 1R9NA 2HI0A 4I4NA 3I1JA 2ECPA 1FYFA 1EWYA 1P60A 3DMFA 4YUXA 3EQ8A 4OHXA 2CD9A 1DUVG 3W34A 5BOSA 5KB3A 3SX2A 2M6RA 1CUYA 1XLVA 3PUVA 4NCXA 3WB1A 1R0KA 5A3JA 5BN5A 4JOBA 4GUAA 4X62B 1Q1QA 1FNSA 3ADPA 4YBRA 1SAYA 2XCTB 4AMBA 3ORRA 3L92A 3WJAA 1PZMA 1N9GA 3DWGA 4CMBA 4YCSA 1Z6PA 1NATA 4QVKA 4ZEXA 5H0IA 4BFYA 2BFWA 2HBZA 4URFA 5H1YA 3ZWAA 2GPJA 4QGGA 3S7TA 1XDZA 4U9IS 2D1FA 5JAQA 1YS6A 1KOGA 1ZZEA 5A4MS 4FB5A 1LBSA 2IH5A 2Z5GA 2OTCA 2DYKA 4QGBA 1VJ0A 4OYLA 1L7BA 4FI3F 1IUOA 2DBQA 4WXHA 5BQ5A 5JBQA 1XWFA 1X7DA 1P7ZA 1NP7A 1US8B 1VP3A 5CIQA 2V1XA 3GRZA 4RD4A 2O5VA 1XMQB 2E5LB 1Y5LA 1B0ZA 3GRRA 1VPWA 2Y0BA 1EQ2A 1L5MA 2BELA 1L0BA 2J48A 4XM0A 4FCWA 4YHHB 4QICA 4DMKA 5EJ4A 3ZE2B 1E99A 2O3QA 2YJ6A 2Q8QA 3N0XA 4PPNA 3RVRA 5L4LA 1XPRA 4ZZ0A 3AVTA 3EIWA 5CX4A 1KI2A 3U7IA 1RLTA 5AM1A 1IL0A 3RBXA 5D85A 3CZ5A 3BQMB 1YIAA 4HEA6 4YECA 1RYMA 3RS9A 2I3GA 3WGOA 4YMGA 3X3HA 1B4DA 1Y6QA 1EJ0A 4AP9A 5HP4A 2F3TA 5LYJA 3ZGZA 1KA9H 1PTKA 4UCXA 5K6RA 1H9CA 1OILA 3IQFA 1X94A 4BMDA 1Y89A 3PFBA 4JLDA 4JXJA 3UENA 2RCNA 1DWQA 3O8DA 1YZYA 1NN3A 5HCIA 1LU9A 1N6LA 2PS3A 5AHXA 4QDUA 3WIEA 1Y3HA 4P84A 4PE5B 4E5YA 3N2GA 2QD2A 3C85A 3CINA 1W1IA 1KIAA 4KX5A 4XLTA 2MMCA 2XNCA 3FCOA 5A06A 1F2TB 3D6FA 3JVVA 4MHTA 2ZI9A 2AC4A 4P34A 4LTMA 3QFHA 4YB8A 1UQRA 1D09A 2ZOSA 1Z28A 3O1IC 2FW6A 4ZVNA 3RUDA 1R4AA 3TOSA 1G5TA 1DBVO 1XZEA 4LGCA 4LXQA 4OSOA 5K8CA 3GJ5A 5MN5A 3VO2A 1P1FA 3DDZX 5EJAA 3NWPA 1KSFX 4LIPD 5GOTA 4CQMA 1TW3A 3OX2A 5BUZA 1V6AA 4JYPA 1T15A 2DY0A 1ZKDA 3HU5A 2B4TO 2KX7A 3K0EA 1Y4UA 1NRIA 3QPDA 1K3TA 5JQGA 2HMWA 4NKRA 5D1NA 1ABBA 1DOHA 3R6TA 1K0UA 2GERA 3S6JA 4I4TF 4WIAA 4A26A 3S0JA 2R3SA 1JJFA 3UT5A 2P5UA 4D42A 2NOAA 1RZ3A 1Z7BA 2JAUA 5TLSA 4MVJG 2FG5A 2P5YA 2FPIA 5KYYA 4QDOA 2R79A 3NBMA 2C9OA 3CPJB 3CZCA 2ZSAA 2HKIA 3G8DA 4P35A 4PINA 1I4DD 1CZUA 1WZNA 3K5PA 4EFDA 4IW3B 4EW6A 4TVSA 1GXSA 3DE0X 1ETUA 2RKBA 3OPXA 4ILEA 3CZ4A 5EGSA 1AKUA 3GRUA 5FA8A 1WUHS 4DY4A 3WICA 4IIGA 4URHA 1MTOA 3LQFA 3R74A 4DLRA 5J4YA 4G4SP 4RY8A 1D3AA 1I5EA 2LVBA 2H1VA 3WYEA 4NZPA 1M5TA 3QX3A 2K2QB 1A72A 1C7EA 3F2IA 3T5TA 3TRIA 2PX0A 4W5WA 3PGMA 5CCEA 2WJ6A 3P52A 1FDTA 2VJYA 5KWEA 4F3TA 4WLOA 1CUWA 1RKBA 3ZX4A 1C9DB 5A0VA 3RFXA 2WHYA 3A27A 5BNFA 4OQLA 4OHYA 2QORA 2PM8A 1SRRA 2R4UA 4M1YA 5HS6A 1Z4OA 1NQXA 3HFJA 1DC7A 4LRUA 4XQ9A 5KBYA 3OAAD 3EGCA 4ZI7A 1G1AA 4H4EA 4JYBA 2WBLC 5DP1A 1YQUA 4F8JA 1NAIA 3AUAA 1Z8NA 4G01B 4MR9A 3UMGA 2EFHB 1EUDB 1J42A 4RZSA 4RJLA 2Y1DA 2I03A 4BY9E 2FHSA 3KQQA 3ZVKA 2AMFA 2G7MC 3NAMA 2EIXA 2P35A 4LF7B 1KP3A 3A9UA 4RZQA 5TPWA 3H97A 1VG1A 3LY7A 2OCPA 4IGKA 3ZCSA 2JFFA 3T3DA 1B3RA 1LGYA 1JQ5A 1U6JA 1JIIA 1P1CA 3ILXA 2PWBA 2R11A 2QRJA 1E61A 4NJOA 1BW9B 4TROA 4BRUA 4LJ8A 1UBSB 2A9OA 1HQCA 3WK9A 3GV0A 5TQJA 4W6ZA 4QOGA 5K51A 1RE0A 4BYGA 4MITA 4Z0NA 4RPKA 5JLJA 2BH9A 5BUCA 3K71B 5ER6A 2A3NA 1MBZA 5JSYA 3D64A 3OJOA 2FFRA 3DT6A 3M0EA 4GZLA 4R68A 3BVPA 5DSZA 4MR7B 2G04A 1JNYA 4S35A 3N53A 3F49S 3BMNB 4HDSB 4JX8A 4RV5A 1PGPA 4L3WA 2Y4NA 5DNWA 3SS9X 3OHSX 4LF5B 1PDWA 3G9TA 4NMHA 4W1RA 1IJKA 1Z0DA 2I4LA 5KHOC 5KO2A 4JQSA 1TCBA 2O0JA 1IUKA 1SCUA 3EBLA 2FN7A 4UJ3A 1YIOA 4KFTA 3RLIA 4NI5A 5DHTA 4PZUA 3BORA 1ZRNA 4GEKA 4HDKB 4JU9A 4M1QA 1PUIA 2P2ZA 1E0SA 1QX3A 2OHJA 4MWDA 4TYMA 1NLZA 3DDWA 1AF7A 3QKTA 4UMVA 1VG9B 1NJ5A 1YJ5A 4CF5A 1NI3A 1AKQA 2O52A 4H7DA 4LHEA 4FQ7A 1VJ5A 4KMSA 1RYBA 4Z7OB 3IXMA 3ER8A 1Y6GA 2H31A 1EZZA 1HH4A 3KSDO 3L5KA 2ZJ6A 2QU8A 2ZYRA 1GRRA 2JFGA 3MRXA 2ZDQA 3MOGA 3URKA 3LT4A 3ZY6A 4ETWA 4OUKX 2A3RA 5FWXB 4OX9B 1QU2A 1ECGA 4XR4A 4UEJA 2C83A 3EF3A 3PIDA 2G6TA 4RYLA 2EP5A 2ZJAA 5I9SA 5AD1A 3TQSA 1UM9B 3GBPA 3GPIA 1F2TA 4C0KA 4KRGA 3KB6A 2XNHA 4U8GA 1R74A 2TS1A 3PXGA 4DV0B 5LIPA 2IXAA 3EQ9A 2Z83A 2C9DA 5H16A 4IIXA 2WJAA 3G0HA 4RQAA 2W2KB 2IU6A 2VPPA 2WSMA 4MUHA 4F6CA 1ZCFA 4ZDKA 3IGFA 1FP4A 1G55A 3FUWA 4B43A 2QUHA 3FFAA 3MRSA 3WLJA 4D4GA 2E7ZA 2DGDA 5IP5A 4D9HA 1NVMB 2JI6A 3R0XA 4JITA 2XGSA 3IT0A 3V8NA 3WFZA 1ZVKA 3O8QA 3CNBA 1I2BA 2YZ7A 3GYBA 3OOWA 2ZXFA 3H83A 1YI0A 1FRFS 4FN4A 4JBXA 4LDRA 3PFNA 4N3CA 5A7HA 4LFBB 1MAUA 3VVMA 4XWAA 2CJWB 5ITZA 1GGJA 1JR2A 1PUXA 4RQTA 1DNPA 1LS6A 3PNVA 1J1IA 5MFZA 4K6CA 2PKEA 3HCRA 4YO7A 4R4JA 4V0KA 1AS3A 1RYFA 3RF7A 3OU2A 1YAJA 4JBYA 1LPOA 1YC2A 2ZT8A 1JHUA 1M8KA 3WYNA 4E5VA 4E21A 3FZNA 1L4BA 3EVZA 5HUJA 5AK3A 2VSNA 2V8OA 2W6PA 4AJ2A 5LM3A 5GONB 1N33B 4FZ5A 2WILA 4BZZA 2PUBA 1FQJA 2PO5A 2PSEA 4ZAZA 1ZGHA 5FFFA 4E3ZA 3AIMA 1EB8A 1R66A 3CVXA 4O8CA 1X80B 3BXFA 3ZIUA 2A5LA 3SFZA 3IOYA 3DAPA 1ORDA 2XADA 2VPWA 4I1UA 1CUXA 2QRHA 5GPBA 1HT2E 1C5KA 4KPGA 3DMTA 2AUNA 4OHVA 3RO7A 2O7RA 4H18A 4EG0A 3HKDA 3AFMA 3ZD8A 3EIFA 2AUTA 4I19A 4WCDA 4HMQA 2FFJA 3N8HA 4LTNA 3GJ7A 3ANTA 2V3VA 2CCKA 3WK7A 5HFAA 4WJLA 5CITA 2V1UA 1E4EB 1PWHA 2FMUA 1JT2A 1EX7A 2IE0A 3H4VA 1P44A 2J3KA 4D9MA 1HSZA 2G3YA 2H2GA 5HG0A 2I1WA 3A7DA 4PG5A 5C4IA 1QG6A 4LCEA 9LDTA 1DTWA 4QFCA 1D1SA 3OM0A 4W4TA 1I94B 1SZDA 1A9SA 1ZD5A 1OW3B 1M6NA 1GUZA 2V03A 1HUQA 3FWPA 3IAS1 5GV8A 3WE7A 1K6EA 2QUKA 3DZFA 2W6OA 3OJCA 1AQUA 1FUKA 1NT2A 1F2DA 4X64B 1VGVA 2OHXA 5JJ5A 3AYZB 5A4DA 3B1KA 2OXCA 1AUPA 1NWHA 5DIZA 1YK0A 2VCHA 5EMNA 2LDXA 5DK4A 5E7IA 4LHVA 4DIEA 1P2TA 4BFTA 5JW6A 5LP6F 3BRQA 5C3UA 4TS9A 4UUPA 1OI3A 1G98A 4PG4A 1BW9A 2NACA 3CLSD 4PPGA 3V1LA 5IM5A 4GNRA 1OI2A 1FF9A 5F76A 5KUTA 2PCJA 2HDOA 4G0OA 2Z30A 4XIGS 1NXXA 4Y7DA 1Z68A 3ICQB 3NONA 1MB3A 4G1FA 1NJ8A 1E2IA 3BRCA 3UHFA 4E3WA 3NNNA 4C6HA 3MS2A 1JWLA 2VWHA 4MUGA 4MUYA 3GEIA 4QSHA 4ROTA 1PJTA 4QYMA 2JA2A 1EGQA 2I22A 4C5CA 1GCGA 3BMNA 4HDSA 1FBNA 1P3DA 2XQKA 5B1SA 1ACJA 3G2OA 1IPHA 1Q7BA 3FTCA 3PUWA 4KDCA 4KO8A 4TWZA 3CIOA 4CR7A 5KMGB 3DMNA 4LPSA 4LVCA 3VR5D 3P4UA 4X8MA 3K2QA 2D2FA 4B2IA 1VXOA 1X1QA 2VSYA 4UM8B 2IZ5A 5B3AA 5HQTA 1AK9A 1BVHA 4RQBA 1N0UA 5EMJA 3ZCRA 3AHHA 5HF5A 4JGBA 4WAUA 3UHAA 4NCAA 1RRCA 3H2YA 4IIEA 4RD0A 3IOMA 3QJYA 4ZO7A 3BCSA 2EX4A 3DVSX 1OOEA 5CPFA 3L8MA 4TMYA 1KKMA 2CNWD 2F43B 3DE4X 5TRTA 3TB4A 1SIBE 4URVR 5CBPA 4PVCA 1XRRA 1T2VA 1PQPA 4JVLA 2DPLA 1Z4NA 3JWEA 1RQ7A 4QXMA 5FWXA 4D1YA 5EJ8A 5KTPA 3K35A 1SG9A 3QSYA 1ADCA 4XDYA 2RHDA 2GLUA 2LCQA 1D1QA 4IFBA 4RMHA 4RK4A 4QTYA 1G66A 4BBPA 1T9DA 5I6DA 1PV4A 4AXBA 2Y05A 2CUNA 1F14A 2Z9BA 2GFIA 3Q10A 3LBFA 4K9NA 4XPZA 2X3UA 4Y2SA 3EPRA 4PQRA 3U7GA 5K20A 2F9MA 1KBZA 2MDTA 4QQ8A 5GWXA 4RZXA 4HX5A 3KQNA 2VT6A 1Y7IA 3QP9A 1GCIA 1N1EA 2W2KA 4H1HA 5HFNA 3Q8WA 4HB3A 4J4HA 5U4QA 3ZHZA 1N7HA 3QXHA 3C4JA 4RVFA 4HV4A 2WA2A 5AKXA 2VHJA 3BH6A 1LWNA 4HMOA 1O4VA 1V5WA 2Z5VA 3AETB 5J23A 1TKBA 2G0NA 2SHKA 5D01A 1PR4A 1Z8HA 2QR2A 1I51A 2OCDA 1RM3A 3PX2A 5FPHA 4EMSA 2A6PA 3AHJA 2XSZD 3ICOA 1JTEA 5TQ2A 3FOAA 2HREA 1M6WA 5DHQA 4E6PA 3V7FA 2OCXA 1Y9EA 3I5MA 1YCHA 3SG0A 1D2EA 3DBIA 4LTDA 2D54A 2F6RA 3WLPA 5AVQA 1CTQA 4QFMA 4FILA 3P20A 4I36A 5U1PA 5KNBH 5L95A 1WVGA 1NVDA 2CC2A 4UVDA 1D4ZA 3HB5X 3GW8A 3KJGA 4YRLA 3TK1A 1YJQA 1X80A 3EAGA 4BMYA 1B00A 1J7KA 3UG6A 4JWTA 3HSKA 4TMTA 3RODA 4CTMA 1IK4A 1WM1A 3S5UA 4NDAA 5BSWA 1HNXB 4LOLA 4OX9Y 4WCFC 5D7BA 4OU5A 2BFPA 4HY3A 1H5QA 4KAXA 1VYTA 5M3BA 2FZKA 3MIIA 2W43A 4XTRA 2CDBA 1AK1A 1EM6A 1IHYA 2PX4A 4QDXA 3C3CA 3MUFA 2A0XA 1P9WA 2FUG6 4L2IB 3FG9A 4GECA 2O4CA 4PGAA 1UUFA 1IYZA 1Z17A 3NWBA 1GLVA 5LQAA 3I01M 3Q7IA 3EWNA 1HTWA 1Q1BA 4W99A 3AERB 3PWKA 4KYIB 3HY4A 3KL2A 3MAJA 4WKBA 4XVCA 4YMVA 4N01A 4X24A 5CK5A 3KTOA 1AXRA 4B3IA 3A6ZA 3OVMA 1RXIA 2Y1EA 4WUTA 1TFUA 1SU4A 3AV0B 4HPWA 1SQSA 5DTRA 1Z4QA 2BZGA 2JASA 3ZXXA 4C3ZA 1PG0A 3DLPX 4Z8XA 1A9ZA 3W06A 4GSLA 5JATA 2OM6A 3E03A 1B26A 4WHMA 2I80A 1XLTC 3BEOA 3H3XA 1DMSA 2YMMA 3ITKA 1EUYA 2HLDA 3Q9SA 4IIJF 2GD0A 1QYXA 2RGYA 3K96A 4NU6A 3MCZA 2ZM5A 2AV6A 2I7CA 3ZLVA 1F20A 3E2IA 2FPWA 4DIOA 5A2GA 4Z9FA 5EKDA 1YJCA 2XTAA 5CLQA 4DDUA 2XW6A 3EPKA 1YVUA 5J2UF 4PZPA 1W5TA 3R6LA 3FVVA 2KS6A 3DAGA 1D1TA 2VXCA 1OZGA 1W48A 5FO1A 3TTYA 1IG3A 1ZRSA 1CSEE 2ABWA 1YDWA 2VHEA 2YMPA 4RZHA 4E03A 5EHZA 4R7TA 4FWBA 2ZAIA 3B9RA 5KHAA 1B93A 3AHDA 4HLUA 1LI4A 1GNQA 1GQFA 2EBWA 2XLBA 4QUGA 4QC2A 3C87A 2NVOA 3D4LA 2IODA 3N6VA 1G63A 2JIQA 3SNKA 4Y9TA 3FMGA 2QMQA 3UMRA 1WO8A 1JFLA 3H18A 4IHAA 5C8YA 1NF3A 3LGAA 5I7WA 2M6LA 2IVZA 3CA8A 3A6PC 2O6LA 2X4DA 4GPEA 3ZOZA 3LPMA 5DYIA 5AVWA 1P1HA 2EL9A 3JATB 3ANSA 3T99A 2N75A 5E1BA 2F43A 3I2KA 3CW2A 3JARB 3EVNA 3QMPA 3AI7A 3TLAA 3WGVA 1XTIA 4QXOA 3N6RA 4PRLA 4B6JA 2BR5A 3O7MA 1XSEA 2VO1A 4V03A 3GLQA 4G0YA 1CRLA 4G26A 4MDHA 1DO2A 2QGZA 2X7JA 2A88A 3P2JA 3KYDB 3SZMA 2MTBA 4BAGA 1QYIA 2IHTA 3KHKA 4CKWB 2XCLA 2XGGA 2W42A 5KNDH 2WA1A 3QG5A 1E3WB 1JSRA 4MVWA 5EYPA 4YRPA 5DEIA 3THYA 1CHDA 1CUEA 4KO3S 1FMJA 5EUQB 2C5FA 2V54A 2BRUC 1PG2A 1E0KA 3PNPA 2IYPA 1O89A 5ECGC 5J40A 4A2CA 3P71T 4BQRA 4C4ZA 4BNGA 2AL7A 4S1NA 4KQ6A 4X5OA 2XLCA 4EZBA 1T3ZA 1SCIA 2F1RA 1TCVA 3LLMA 2H1SA 1N1MA 1Q1EA 3ISJA 3BA1A 2AYZA 4XIIA 2PBZA 1E6WA 4IV8A 1E3MA 1TKCA 1NMEA 5IKXA 3NORA 2HJVA 4JI0B 4TPKA 1MP0A 2OBYA 2Z3WA 3MWFA 5KVCA 2OORC 2QK4A 3BWVA 3GVPA 4HRYA 5A3VA 5JRDS 1QNFA 3ZCXA 1F5NA 1QUFA 5H3LA 3S1AA 4BVLA 2WE8A 5JYCA 3D7NA 3OZUA 2JG3A 4YDRA 4BJ6A 1ITZA 3I4CA 2QRUA 2A9RA 3F1KA 1KFKB 3G8BA 5F7JA 3WAJA 4BEWA 1YC5A 2EJUA 1X9HA 4GI5A 2VTKA 1EK1A 4JXKA 3KR9A 4L8YA 3OJ0A 4Y6PA 4M8KA 1V96A 3RVNA 3PDCA 2A33A 4ZVUA 4QKQA 5JEDA 3S8YA 1NM5C 3C8ZA 3HNRA 4L07A 5DDIP 2PTHA 3D6VA 3SZOA 3ZBUA 3ZUPA 4UMEA 1UP4A 2X0NA 2B21A 5I01A 5JCXA 3RRYA 2O8DA 3EHDA 3T1NA 2FLVA 2YQ5A 1EQAA 2JCSA 1Z6YA 1GWNA 1EP1B 2BR4A 1Z8FA 2O54A 1JSZA 3KOWA 5ALZA 2X23A 1RR6A 3OJEA 3W8NA 2IA5A 5MGNA 1HE3A 1IONA 1W5EA 2GSDA 5JMWA 1C1DB 4M83A 5IKOA 2NSYA 1S8FA 3HVRA 2NSHA 4CQNA 1KZGB 1CUSA 4CR6A 4IDQA