2PS3A

Structure and metal binding properties of znua, a periplasmic zinc transporter from escherichia coli
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
284
structure length
265
Chain Sequence
AVVASLKPVGFIASAIADGVTETEVLLPDGASEHDYSLRPSDVKRLQNADLVVWVGPEMEAFMQKPVSKLPGAKQVTIAQLEDVKPLLMKSHGDFNMHLWLSPEIARATAVAIHGKLVELMPQSRAKLDANLKDFEAQLASTETQVGNELAPLKGKGYFVFHDAYGYFEKQFGLTPLGHFTVNPEIQPGAQRLHEIRTQLVEQKATCVFAEPQFRPAVVESVARGTSVRMGTLDPLGTNIKLGKTSYSEFLSQLANQYASCLKGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords High-affinity zinc uptake system protein znuA
publication title Structure and metal binding properties of ZnuA, a periplasmic zinc transporter from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal transport
total genus 85
structure length 265
sequence length 284
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2ps3A01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2ps3A02
4TKUB 1FP4B 2M6LA 1PQ4A 4MDYA 3CX3A 4NNPA 2OGWA 2X4LA 3AEQB 2QI9F 3K1AB 1MIOB 3BE5A 1N2CA 2OV1A 3ZK7A 3MINB 1FP4A 4TKVB 5B58T 3TEFA 4DBLE 4UDOA 1G20B 2PS0A 1XVLA 5AFSA 2PRSA 3K1AA 1M34A 4H0FA 3LHSA 5GGXA 4TKVA 4ND8B 4PAGA 1G20A 2XDQB 4IRMA 1N4AA 1M1YB 4PM4A 5KOHB 3ZKAA 4OXRA 4CL2A 4LJSA 2XQVA 2ETVA 2WI8A 4FKMA 5M2QA 1M1NA 3ZK9A 4INOA 1M1YA 5KOHA 1K7SN 1KARA 1N2CB 2AFIB 4M7OA 2XUZA 2YNMC 1TOAA 4INPA 3PDIA 4MX8A 5CX1B 1EFDN 1QH8A 3NU1A 4FNAA 1M34B 2AFIA 2WHYA 3HJTA 2O1EA 3MFQA 4K3VA 2PS9A 5CX1A 4MLZA 1N4DA 5JJ5A 3EIWA 3MD9A 2Q8QA 3AEKA 3EIXA 5I4KA 5BVGB 2XH8A 5KHLB 5CR9A 4WZBA 2OSVA 4UTPA 3R5SA 1M1NB 5BVGA 4WN9A 3AESB 3GI1A 5JOQA 1QH1A 3PDIB 4G09A 1KAHA 4B8YA 1QH8B 1K2VN 3AESA 4HMQA 4FILA 4H59A 1K0FA 4UDNA 3R5TA 5HX7A 4WESB 3AEKB 4UTOA 2PHZA 4N01A 1N2ZA 5HDQA 2OV3A 4HN9A 4MO9A 2R7AA 4WZBB 3G9QA 4BBPA 1L5HA 3TLKA 4WESA 4GICA 3AEUA 3AERB 4WN9B 4WNAA 3AETA 3MWFA 3MWGA 1QH1B 2MINA 2AFHA 2YNMD 4G07A 3ZK8A 3PSHA 5GGYA 5BVHB 4NNOA 2XY4A 3AERA 3LI2A 1PSZA 5KOJB 5M34A 5M3BA 1G21B 3UJPA 5BVHA 4WZAB 4OVKA 5JG7A 5KOJA 4TKUA 1G21A 1L5HB 1QGUB 4WZAA 3AEQA 1ESZA 2Q8PA 3AEUB 1MIOA 4WNAB 5JPDA 3AETB 3MINA 3HXPA 3U7QB 2MINB 2AFHB 4XPIB 2PS3A 3PSAA 1QGUA 3HH8A 5M29A 1H1LB 3BE6A 2RG7A 2M6KA 4OXQA 2R79A 4ND8A 1KAEA 3U7QA 4XPIA 2XDQA 4LS3A 3ZTTA 3TNYA 1H1LA 5FLYA 2XV1A 4FI3F 4HMPA 1K75A 4HMOA
chains in the Genus database with same CATH superfamily
4UJ5A 5SICE 3DEYX 1PWEA 1EVKA 3ZDDA 3OZEA 1YCDA 2HO4A 4I6GA 3AVUA 1BCSA 1P0MA 2H2DA 3R6WA 3Q3HA 2IEBA 3F4LA 2ZGVA 4ZARA 3BSYA 4TMZA 3E0XA 5HZKA 1Z63A 1C9JA 2B7CA 3ZGYA 4RD4A 2VYCA 1M2NA 2IT1A 2GB4A 1R8QA 4L95C 1OFGA 2YFKA 1NN3A 1X8JA 3HYTA 3SBOA 4MUEA 4JODA 3E9YA 1HKUA 5A2GA 3DQZA 1JAZA 3I01A 3PD0A 4URWR 4U0JA 3W3AA 1WKVA 1YVEI 1NV8A 3LLVA 2AJBA 3KKKA 2I55A 1E92A 2FF7A 2AQ8A 3DXFA 1HR0B 1A9TA 5A4MS 3RU9A 4M6WB 3PGJA 4NENA 4JR1A 2OCIA 3T5CA 4CM8B 2W2MA 1BHSA 2H1IA 1GL3A 1N1EA 2WIFA 2YUTA 5EKDA 2QJTA 4EVQA 2WYUA 4HS9A 3BEDA 1EQ2A 4PTYA 4KLNA 2YZ7A 4RGQA 5FF9A 2AT1A 2NO7A 1DE0A 3EPPA 3PR3A 4PZCA 3GRVA 4INAA 3ZZUA 2KS6A 2O4UX 4NH4A 3MGGA 1ZBQA 1WF6A 4HX2A 1OLUB 1G38A 1YB1A 3EVBA 3WGQA 2DHQA 1ORVA 3KPVA 4IKOA 4F86A 3W2HA 1KAOA 4O1IA 5JECA 5M04A 4W99A 4HXFB 3NHLA 2OSBA 3PA8A 4B3SB 1HSOA 1G2QA 1J7JA 1YFKA 1WVIA 2L19A 5HFAA 1C8LA 3RWOA 4CIDA 4BVLA 4J16C 2C54A 2J5XA 1LV8A 3COPA 2R47A 2O4CA 3CF6R 4JL6A 4WVFA 3WYNA 4M8LA 4Y9SA 5JOQA 1E3DA 1QQBA 4TWAA 4ESHA 1SHTX 1RI4A 4RAQA 2UYQA 4M55A 3AR6A 1WOMA 5AXBA 5JJIA 2IPOA 1BC5A 3L07A 1AUOA 2BKUA 2TMDA 2VJCA 4B1FA 3AEYA 4D6YA 2X5XA 3LBIA 2JJ1A 4J0CA 4RJLA 4A0SA 2YYSA 4DLTA 3DTVA 4JEHA 3KV1A 1UXJA 1HNXB 1NI4A 2IPNA 2EFCB 3KEOA 1OCEA 5KNDH 2QRVA 4QODA 2H8GA 1S3FA 4TLAA 2GBGA 5T4EA 3LHKA 1CUJA 1TO1E 3QOXA 3FBWA 2GEFA 5GGYA 5KWVA 4GVPA 1AXRA 1CDOA 1QM5A 1ZZEA 4PTLA 3SQLA 3GZTB 2J0EA 2FG6C 3V1NA 5FLEX 5B5SA 4RTRA 1U65A 1IPHA 4O4HB 4QYSA 2W2OA 1SHUX 2ZQYA 3WL5A 3MJRA 4P3KA 1Y89A 221PA 1TIKA 4WQMA 2WYHA 3F5DA 1C9EA 2YY6A 3C48A 3TPCA 1DMSA 1MO6A 2ORED 1I4WA 4ITUA 4Y6LA 3KAJA 3U7EB 3UGQA 5BMVF 4OLAA 3FRJA 4M49A 3U17A 2PJUA 4IUDS 3I3OA 4L3OA 4IUYA 4F4CA 1YDFA 4Y2RA 5IUKC 5FWDA 5EESA 5A6SA 1JV2B 2MSCB 4ZOLB 3QUAA 4I5EA 1GPJA 1B16A 1ZM3A 2Q5IA 3KRTA 1UJ6A 4CBVA 3G2HA 3TMAA 3ZZ0A 3DLTA 4GPAA 1QB7A 1P7WA 1H1LA 4BUZA 5DM1A 3BCRA 3DAGA 4HMPA 3IL2A 3VC1A 5IBQA 2IS1A 2A9PA 4NMWA 1B8PA 1THGA 2FFQA 2RGGA 2QUJA 1E63A 5C5DA 1OAOA 4PY2A 3WVNA 3NRCA 3MG9A 1NF2A 4I1VA 2C3MA 1CE8B 4DLPA 4BBAA 3E48A 4I5FA 1BX0A 5CVUA 3UTDA 3H5VA 3KQLA 4OHFA 5EIBC 3WY9A 4AY3A 5LQJA 1Y37A 4M2LA 5JAPA 2R7KA 2XMZA 4P7BA 4ZCMA 5KYTA 3SQWA 4KREA 4RVHA 2H00A 1WP4A 1KIFA 1SQSA 3C5HA 5T5QA 4JJKA 3SLKA 1CR0A 2Q7XA 3CW8X 3GEGA 3R5FA 2PTGA 4KE8A 4F84A 2YOGA 4P82A 3NP7A 1FU4A 4PZAA 4YT4A 3ADBA 3R24A 4P9NA 3G7SA 4RJJA 4TTVA 1MAWA 2QJRA 5CW1A 4D9KA 4GM1A 3OZBA 4R2KA 4V0QA 2OB2A 1D2AA 3OCVA 4ZAVA 3DYIA 3C74A 1U31A 3QOWA 3KR2A 3LO8A 1TGVA 3E81A 3OJCA 4EYOA 3E9QA 4BKPA 1NR7A 2AFIA 3FCCA 3WDMA 5JFTA 3N3BC 3QEKA 3RIMA 3NBQA 1C7FA 3T9BA 1D5CA 1TADA 1TLTA 2CLLB 2F17A 2RGYA 1Y3BE 2WW8A 4O4LA 5BN4B 3UW1A 1QG4A 4JT4A 3U48A 4UM9B 3LCUA 3JYPA 3CRMA 4D56A 1ZBDA 1JLKA 5DISB 4QDJA 4KWTA 2C5LA 2JKYA 4CQJA 3R76A 2Y6VA 3L46A 3X2SA 2PGAA 1SC1A 3CEHA 3EBPA 3K31A 4U6SA 4BEBA 2XSZD 4FN4A 4M76B 4JSYA 1MZPA 3P9SA 4MV3A 3PKZA 1R66A 2QJFA 2W9XA 4H27A 4NEHB 4ZKDA 3ZKWA 1ZNYA 5LPNA 1E9DA 4DLZA 2FDRA 3OM1A 1ICIA 3S4YA 3UHFA 3NX4A 4DC0A 4HH1A 1BROA 2G07A 1J56A 3DE6X 3BB1A 4MW1A 2GFHA 1ZVQA 3MAJA 2L0XA 2X6TA 1E79A 3LX5A 3N2LA 4N0DA 4XYBA 5I7AA 1QGOA 2J41A 2HWXA 2VF7A 4DMRA 5HGXA 5HRCA 10MHA 2FOXA 1ZJJA 2WC1A 3K2QA 5FPPA 3RODA 4FT2A 5ARCA 1IH8A 3HCWA 2IHVA 4X7RA 1HDEA 3ZBTA 1BU5A 3A25A 1I2AA 3UMGA 3KK0A 1FP2A 3SJCA 2YJNA 1RPTA 2JF0A 1YONA 1SOWA 2GZ2A 2POQX 3AFHA 4IGEA 3TL2A 4AP6A 1UBOS 1KEPA 1AQ6A 1QG0A 3O4GA 1JX6A 4Z5XA 1XEWX 1NT2A 4OO3A 5JNWA 3E22B 5AKZA 1E62A 4LJKA 4YJFB 2XNJA 2F59A 1VE6A 3O47A 1NN5A 3NB0A 2CBGA 2G80A 3EASA 3UWSA 3EF1A 4NCXA 1SU6A 4B2IA 4IWNA 1GEEA 4R3UC 1KJ8A 5LN1A 1LVHA 3G8YA 2FW9A 2Z4RA 2A14A 1WQ3A 4BKOA 1DBPA 2YUIA 1DAOA 3KDPA 2ASEA 2AJLI 3W9SA 3TN7A 2PBFA 4HVLA 2D2EA 2HJVA 2A5LA 1IIRA 4O4JA 2V1UA 4R2MA 1L8AA 3OJWA 2O2XA 4DJDC 5K01A 2QTNA 3K16A 1G4UR 3LBHA 1RHUA 3GEIA 3R0QA 4K88A 3W5HA 5JQGB 2VUHB 4TSFD 3D6AA 1OLSA 2BFMA 2H1WA 2YRFA 4IILA 5T6BA 3ZI7A 1YI8A 4E5NA 4G85A 2OV4A 1W44A 4K2HA 4A1OA 1O87A 1R4MA 4NC9A 1QXSA 1WB5A 2C9MA 3I1FA 3GLUA 3EZFA 2XCIA 2V7VA 3OPQA 5KSOA 3AYZB 3U56A 2DLNA 1AUQA 1RW4A 1V3QE 3PGMA 1WDMA 4RLQA 5A3SA 1QIGA 1Y5RA 3P9PA 3Q85A 2ZR0A 5FPHA 3RYFA 3LYUA 3AKEA 4E5DA 5JXGA 3GLFA 4H4EA 2EHDA 2FTKE 4V38A 1MU0A 4QYWA 3TLEA 4NMXB 2J85A 3EVFA 3AT1A 4YY3B 2JS7A 1PVVA 3A3NA 4F06A 4Y2GA 4LJ8A 2ZT7A 1E1QD 5AI4A 1J9EA 1RXIA 1SHJA 1KI6B 1GFIA 2B1IA 1OR8A 2J1LA 3IAFA 4C04A 2C4HA 1Z4NA 2ZBVA 3ILHA 4C5AA 1CYEA 3I9FA 3IAM1 4HDKA 4JQZA 1T6XA 1D6JA 2FNAA 3FMFA 3MCUA 4I4CA 2G40A 3MMSA 4ESEA 1ZA2A 5EVCA 5CT5A 4QXQA 2PUGA 5FL3A 2WJAA 1Y6ZA 4GZLA 4KPGA 4R1TA 1VLVA 4P8RA 1PZXA 4P35A 3ZGNA 1Z6ZA 4B6GA 4YUAA 2PAAA 2GO1A 4YJGA 4GE3A 1CK4A 3JV7A 3KJGA 2HRBA 4YGYA 1AQJA 2JJ8A 1B8OA 4V0ME 2WQ7A 3DZCA 4CUJA 4FLMA 1TK3A 3G0BA 3HQ4O 4IGIA 5ICEA 4CF4A 4IDHA 1ZR4A 3RC1A 4BJ5A 4P4UA 1AXGA 1C0PA 1OBFO 2IOFA 2PBZA 4IIYA 4IDGA 4F5WA 4QOJA 1E7YA 5BRNA 3CONA 2J9XB 3T9FA 3FDFA 4F1JA 4L8GA 1V5IA 4LXYA 2GLUA 2P6NA 2WMYA 5KNCH 3EXEA 1AY0A 3K1JA 5J5CA 5JCPA 2PKCA 1N5MA 2C83A 4D26A 5AQEA 1ECLA 1P18A 4A91A 3NCTA 1UPTA 3PUJA 4Y18A 1OWOA 5D6NA 3V4OA 5ALVA 4OI0A 1KH2A 2RH5A 4MVCA 2WVGA 2CVQA 3VDMA 5HIIA 1Z0IA 2VKTA 3DDSA 1XDWA 2Q7OE 3NDJA 4M0FA 3HKCB 1G18A 1NW8A 4AROA 4QULA 4DMHA 1JDUA 1OTHA 1CJBA 1F0KA 1HK7A 4KYTA 3FMIA 2BT4A 4WZBB 1FDSA 3INNA 4NYJR 4QBKA 3KNZA 3IXMA 5EUQB 4KR7A 1ZCFA 4PVDA 3DDNA 3PWTA 5I8ZA 3EF3A 3QX3A 3R8XA 2QLBA 4XX0A 1ZK0A 3U5TA 5FXMA 4ZHQF 5CLFA 1VFNA 2PQ2A 5EIFA 1MRNA 1M5TA 1PAUA 2A1TR 5KNLA 4BV8A 4D1YA 3AM4A 3G3EA 1K7CA 4MV4A 3ADCA 4UNPA 1BDBA 3I4FA 2GBIA 4RSHA 4W5WA 5DK4A 3A58B 1KMHA 4B3XA 4JMLA 3OJLA 2JAWA 3RVRA 4HQNA 5AXAA 4BNVA 1L5FA 5BWLA 4BWVA 1FDTA 3TB4A 2Q2WA 3WX0A 2A1UA 1KAGA 4WLEA 4A0GA 3UK6A 1XMXA 5KYVA 3T1TA 4RFLA 16PKA 3C6BA 4ME6A 3RKUA 3ZDXB 5LKRA 1JHQA 1QCYA 1WMAA 1T9DA 3WRVA 2FVXA 2PH7A 4UOEA 4FONA 1XPUA 2PX4A 1W30A 1VG0B 2JHCA 1YHNA 1N2EA 2Z2YA 2ID7A 1Q19A 2PEZA 2G5PA 1O8CA 2HYDA 2R8YA 2ZYAA 3I76A 4IDFA 3TKLA 3E5RA 4EATA 1FS4A 4ZI3A 1BKYA 4X1YB 1HPLA 1L4KA 5AKJA 4NFLA 5E4JA 1YU6A 1MB3A 2GLTA 4IF6A 4P2BA 4ZEOA 3I64A 4WX2B 1U1EA 3I73A 3CSSA 2WV7A 2RGCA 3PGLA 5IM5A 3WICA 1DQPA 2BEWA 2ZPUA 4L6IA 1M10A 4ZMRA 1JIXA 3NNDA 3O4RA 3SZOA 3VR1A 2WKPA 4K1XA 4TZ6A 2HF9A 2YV4A 5DGDA 4CF6A 2BUAA 1QVWA 2VPIA 3D6MA 2PX6A 1RBMA 1A8UA 1RFLA 1S5PA 4GRIA 4OQMA 4W9NC 5HQ3A 3WLPA 1M34A 3Q7SA 2I3BA 1N3LA 1R8XA 3I23A 3OE7A 4HP8A 4AW9A 3DA8A 1O2DA 4PAGA 1B1AA 1Z5WA 2BZGA 3ISJA 3TJRA 1H8ED 1M6WA 2IXBA 3C5EA 1GHTA 1S8OA 2PQMA 4OQPA 5E2AA 2C58A 1CETA 3IIEA 4I8XA 4ZC8A 5F2NA 3PCRB 3V00A 3EMVA 1GKKA 1PJRA 4LNHA 3PBKA 2I65A 4QFDA 3QKSA 1OKKD 3TZHA 1X9GA 5FO1A 2GEBA 3TAXA 5LYJA 1WHTB 2HF7A 4NZNA 2ZWVA 1S3IA 2I8CA 5K0GA 4C08A 2UYCA 5F9FA 4CCYA 1OFVA 3HVHA 1J22A 5CJPA 1R0XA 3JZIA 2ID4A 1Z7BA 3UMBA 3PNYA 3GHYA 3OJ0A 5AVWA 4RKRA 4B80A 4BC0A 4CKWA 3HLYA 4JJ7A 3QKTA 3NIDB 1T5BA 3V9PA 1GZ6A 4GR5A 4GZ3A 3TXAA 3FTFA 5DO9A 3V4SA 1XMIA 4FFBA 4IIHA 3QMPA 2PYIA 2OCGA 4QL3A 4AKSA 4JB2A 6LDHA 4RD1A 5K5EA 3E7FA 2HSZA 2Z08A 1LNZA 2C4NA 1MC1A 1TMKA 3MMNA 5EGNA 3ROXA 4N7MA 3JQCA 5EXDA 1C9MA 1WHSB 2W11A 2NTYC 3AY6A 3VO2A 4MQEB 2JEYA 4JQSA 4CMEA 1MV8A 5CYOA 4FIZA 1SCQA 1JDNA 2AG8A 2MWMA 1VZ3A 3FWHA 1MO4A 2OAEA 3ZY3A 1RPAA 1B74A 1XQ1A 3TSOA 3M0EA 2VZEA 5JROA 1KC1A 1ZW6A 3FHLA 4BNWA 4DCSA 4EDFA 2CMDA 4J07A 5EJ7A 3TPZA 1U8AA 2FX3A 5IZ4A 3C0KA 4UCXA 3V4LA 3ZI0A 4IKEA 3SFTA 5DNDA 2X5NA 1H2EA 1KFCB 1YL6A 3DW1X 4H35A 4HZUB 1HL7A 3JZMA 4BL5A 1LWOA 5CNIA 3VR2D 4EA8A 3RHSA 4YUYA 4BWGA 1GARA 1MOQA 3C85A 2AYZA 1QC5B 3KYIB 4DMMA 3P2OA 1NBMD 2A0YA 1XA3A 3AMVA 4N5LA 2OBLA 5I47A 3HJAA 4PPQA 4GRDA 3U26A 4W5NA 3HVIA 2PXCA 5EWLB 4AAYA 2EU8A 4AQYB 2ZJFA 3GT3A 3RU3A 1QHFA 1ZDMA 4OAOA 5HCNA 4AL4A 3IBCA 3SKXA 3HKBA 5BQ5A 1POXA 2CYBA 2W7TA 3O1HB 2GTIA 3VVCA 2D0PB 3QF4A 1KEUA 2XRYA 3GY0A 3QXSA 3T9AA 3ADOA 2J09A 2A5YB 3SZGA 1BXGB 4Q16A 5FT9A 4UHDA 3U7QA 3W2GA 2W98A 5A4JA 1W36D 1ADFA 2QG4A 3V6MA 4MB2A 4DV2B 3BHJA 1QZXA 3TDNA 3ZLTA 2V7XA 4Q05A 1SUPA 2ZYDA 4FDUA 3IAAA 1HDXA 1J2TA 1PG2A 2R1TB 1QORA 1X14A 3ZUGA 3N7AA 1L7PA 2P4HX 2R86A 1JEQA 2OHOA 2RHMA 4Y9UA 3TZCA 4GDFA 3KWJA 4E2XA 1EFLA 1HFKA 3B52X 3WP0A 5L3ZA 1FTQA 5EGSA 4JXZA 4DIBA 4CMKA 1GFSA 1PX0A 1KK3A 2C1XA 2KW5A 1NSTA 2WNSA 4KRYA 4KZKA 4NHEA 5DWVA 3F8TA 5HF9A 3VSEA 1ZR2A 1Z17A 3BRSA 1DAEA 1SC6A 3GMDA 4KLCA 2NSLA 4MHSA 1ZGHA 1YFLA 2BGGA 1DKLA 1FTGA 2FF5A 3VKUA 1GDHA 2B1QA 3H7IA 5BOVA 3PUKA 3C7DB 4CLOB 2OCBA 4BEVA 1XRRA 2W6QA 3RGWS 3I2FA 4ED9A 5KYGA 1FNDA 4XSVA 1KQOA 2C82A 1OXTA 3ONFA 2QUAA 3PF8A 3A6ZA 4OJMX 1ONSA 3DKVA 5CEJA 5HKKD 3M3HA 1MX3A 3MK31 3QFTA 4P22A 3E7PA 4EABA 4BVJA 2FWBA 1NVGA 4MUGA 2POCA 3HN6A 5A0TA 3MB8A 1XDDA 5FA6A 2QUZA 4ON9A 3TWOA 2HWKA 4HXYA 2HDWA 1KP2A 3GLGA 1ECJA 2ZRLA 1EJ2A 1N4DA 3SI7A 2OKGA 3ZG6A 4EY8A 2EQ5A 5ESWA 2R5NA 1L5OA 1SBHA 3VYRB 2H48A 3RM3A 4EG0A 1SHKA 1NFQA 3NWJA 4FMDB 3UOAB 3PFGA 3LL7A 1XU9A 2C98A 4FD3A 1I9CA 1J07A 3GJSA 2VYND 3I0MA 1DIOB 3OAAA 5K3EA 2C9DA 3ZY4A 1IZZA 4NMHA 2FPMA 5K4GA 2QQ5A 1ZVKA 1XU4A 1AK9A 2PPLA 3BL8A 4JBGA 3VC7A 4R0NA 4H59A 1M0WA 3CX7A 4M98A 3A6PC 3LQ2A 1AN9A 4MUHA 4NJMB 1WW2A 4LGYA 4HH3C 5GV8A 3TLAA 2XB6A 2OV6A 4CI9A 4PS1A 2QRQA 2W0MA 3NATA 4GVLA 3OX4A 1F48A 4KYVA 4XOIA 4BLQA 1JTVA 2Y6UA 1HX7A 1P19A 3OURA 4AMBA 3UIEA 5C18A 2VEOA 4O29A 2ARKA 4ZT4A 2HA5A 1JG6A 2DQYA 5HPYB 4YROA 3PRYA 2AWNA 4R7ZA 3VNRA 1JHXA 4WA7A 1RKBA 2BC9A 2ADMA 1S0UA 4GP6A 3C3XA 1A8PA 2LKCA 2QGNA 3D0KA 3K7EA 3SZRA 4CYMA 5HKBA 2BP7A 4TTSA 1W85A 5BSKA 1OI4A 1ZISA 4QU8A 5KJEA 4CIAA 3BPSA 3ZHUA 1OXSC 2PMCA 4D4IA 2NTJA 5ERYA 3WNBA 1Q6ZA 3DDCA 4C4ZA 2XUOA 3PFIA 1CJUC 1KTVA 1CQJA 1DSSG 1QWOA 3ZHXA 1QGUB 3PXAA 3VI4B 1EE9A 2OOSA 1AHPA 5KO2A 1AS0A 3DOHA 3GLTA 2F55A 3MMPA 3VU0A 1BJKA 4OXXA 1FNNA 2VAMA 4YRCA 1M6VA 3X44A 2RD2A 4URVR 2VCYA 4NVRA 2UKDA 1YDWA 3JQGB 3QU5A 1SBZA 4OH1A 3WGLA 2Y1LA 1G64A 3O8BA 4JB3A 2APJA 3GWZA 2C97A 1K4KA 3OHMA 1D4ZA 1XZMA 1Z5NA 4Q3BA 4RW0A 4TWIA 3W5CA 1HNZB 3OLWA 2RBGA 3O4FA 3OEHD 2CL5A 4QRIA 5K0BA 3HBFA 3ZWOA 2P65A 4L7VA 4XDGA 4AS1A 1M6NA 2X5JO 4GGMX 4DZZA 5A5EA 5KB3A 3S28A 4NAUA 1G6HA 4QOSA 2DH5A 1MC8A 2IUYA 3I30X 5CP8A 5EJ4A 4QNMA 4TKVA 1F1JA 1LRJA 4BV3A 2XBLA 2AYYA 2OVFA 3IP1A 2IV2X 1T3GA 3KFXA 2HBYA 2WNHA 3FDIA 1H4SA 2EX0A 4R01A 1NUHA 5IK2D 2UUPA 5BUCA 2F67A 1MAVA 2EOAA 2PSJA 1XA0A 3MPOA 4II7A 1KMNA 1NNLA 2ZIXA 3K30A 1X7YB 5AI0A 3EYAA 4DBLC 5CD9A 4P58A 3TXYA 1PTJA 3IYLW 1PK9A 4HDNA 2IYFA 4P36A 4D2IA 4E5PA 3GFFA 4IWYA 2V5VA 3AGQA 1FMTA 5JAQA 2BFDA 4UVDA 2WIJA 3EVCA 3V4PB 1K2WA 4K3VA 1DJQA 1JHRA 2QRNA 3A1SA 4MLZA 3U40A 3WP1B 4YV1A 4Q3EA 1B41A 2XQIA 3IBSA 4HPWA 2ZS9A 2GYVA 4OFWA 3C8DA 2QSUA 3T3OA 2ODPA 4ENPA 9GPBA 3L2OB 5IXYA 4YT8A 1I1NA 1SG9A 2P7HA 2E85A 4Y9DA 4PRYA 1ESEA 1ENZA 1TFRA 3CIFA 1JU9A 3HL0A 4P0QB 5EERA 1I7NA 2C92A 5IBCA 4N5NA 3L04A 1Y7HA 4IY1A 3H3XA 1TKRA 4D81A 4AP5A 1UK8A 3EHDA 1NPDA 1RE0A 3PB3A 1RZRA 4F2PA 4FMCB 3UGJA 3I9LA 1JDPA 4MROA 3TSAA 4Q1DA 2ZUSA 1IFXA 3PJGA 5IX8A 1D2CA 5LMUB 2PL3A 1FYEA 1G3IA 2I7TA 4J90A 4L4UA 1JQ3A 4NYJQ 3ZHZA 4MB6A 5JSZB 2YWEA 1F8XA 5DNEA 5T7BA 3GDHA 4C7KA 3WYCA 3DZKA 1GDDA 3PENA 4CMIB 1X19A 4G3XA 1IK4A 4V2IA 4UOZA 3CVWA 3PX3A 1RJ9B 4D0NA 1J1ZA 1UF9A 2EERA 3ET4A 2EEPA 1ZJ4A 4R51A 4UM7A 4W63A 4X45A 3KALA 3CO5A 5B1YA 4BGVA 4ZRDA 2IDMA 1UBMS 2G5GX 4L8LA 2AI3A 5E6SA 4I50F 3WL8A 1MG5A 2ZI9A 4YJHA 5EUBA 1ZIDA 4RETA 2Z2IA 3EZXA 3A6FA 3EGXB 1N2JA 3PQDA 2K7FA 3KZCA 4HNQA 3KETA 4RYLA 3VR6A 2NU9A 4RJIA 1LD3A 3GJ3A 4OLHA 4WNAB 2OB1A 2I76A 2B3DA 2QJOA 4FFWA 5FRDA 3RNOA 3U4DA 4E5KA 1FFYA 1VHWA 2X4GA 4NE9A 5IWAB 1O95D 4G0PA 2HPVA 4ND2A 1QPBA 1CRZA 3GEDA 4LJLA 1X3LA 3RS0A 3TPFA 1K6IA 1NU6A 1WZEA 1KAEA 1W0KA 3A1FA 5ECWA 3ZYCA 5KYYB 4DY6A 1YVDA 4BJHB 2ZYGA 5AI5A 4TT3D 1SZCA 1WG8A 3TTXA 1P9RA 1TM2A 3UG7A 4QT4A 1NULA 3KVVA 2GF0A 3NOVA 4KGXA 4BU1A 5LVAA 5JNLA 3VJKA 4BIIA 3UW3A 4NJEB 3LY8A 3MGKA 1G4AE 2XOXA 1Z2CA 4AD8A 2GK7A 2AWOA 3O95A 1L5YA 5DEIA 1TEHA 3NXKA 2ZZMA 4HLUA 4PHGA 3MCVA 3HB5X 4AYXA 4BN4A 3Q3CA 1DT3A 1W2WB 2GXAA 5LR6A 3EC1A 2O8BA 1VHTA 2KMLA 1LU9A 2QZ9A 4YQEA 1MT3A 3R3SA 1EESA 2IQIA 3RSZA 3TEJA 4II3A 2JNWA 4L5YA 4JA2A 1H1DA 3FCAA 4JGGA 4YJ3A 5DIFA 5EE9A 3WKCA 3EPRA 3BC1A 3FNHA 4N3GA 1MJ5A 4CLRA 5K03A 3EB9A 4ALKA 1Z73A 3BGVA 1P17A 3D4LA 4CIVA 1UK6A 1SIUA 4US1R 3EG5A 1BX1A 1O54A 2EJWA 3FNQA 4G8CA 2VPXA 4QHYA 2QQEA 3HNOA 3ST7A 4OI2A 4BE7B 1CB7A 5L3QA 3VKHA 2O0LA 1Y5LA 3HG7A 4KAJA 4MHOA 4C7OA 3A9UA 3PDIA 1KXJA 3HKEA 1QH8A 3P19A 5CNKA 3MZ0A 4PQYA 3C98A 4Q66C 3NVAA 4QGGA 1AJEA 2QAGB 3HZOA 4HWSA 3OLCX 4NIMA 4OOEA 2I6FA 1SZJG 3FGZA 1L5RA 3M2PA 2GZSA 3S2IA 3M4XA 3VJMA 1JLLA 4EUHA 3B5EA 1YJXA 3WBBA 1FIUA 2XKAA 1B6RA 4OREX 3M3PA 3BWBA 2VJMB 2PQ6A 4L50A 4D96A 2O59A 4G2TA 3QYAA 4F2WA 1OTYA 3A1WA 3ESDA 4I6JA 5LCXA 2VWHA 1YUBA 3SDZA 1FFXB 3H11B 1XLTC 2YV3A 3PJFA 4IJ5A 1K27A 1P7CA 2VJAA 3EN0A 2FEKA 4U6QA 1NA5A 1M6EX 5IDXA 2P2CA 3PFHA 4KX5A 3TDKA 3FIUA 1VJGA 2YJTD 1CRQA 5F2EA 4OKSA 2BEUB 1WDLA 3ELDA 1UT6A 2WUEA 1DC5A 2R44A 2RGRA 1I6KA 3AZPA 3HSYA 3LY9A 2RGNC 3WOHA 4KQ1A 3FI9A 2CK3D 1PJBA 2MHCA 3K96A 4Y6RA 3Q1KA 2JGKA 3DMTA 5E7QA 2D5BA 5DWQA 3OCWA 1RACA 1YKSA 3RRXA 4CEHB 1EUZA 4F56A 2AFHA 3E9MA 3OCXA 3OESA 4EYQA 1X9IA 4JC5A 2XECA 1L1FA 1TKCA 2Q5EA 3DVQX 3AERA 3MYRA 2AG5A 4EW1A 5C53B 5LMNB 3USES 2JFFA 1VJTA 2QL7A 1Z37A 3QV2A 4N65A 2HSEA 3MT8A 3K8ZA 3GJ8A 4ZT2A 5TT1A 3GMSA 1JTEA 1RHQA 1SXGA 2IU6A 2ZB3A 1OT3A 3SG0A 1KTIA 3IT3A 4B44A 4P5EA 1GPAA 2CJWA 4NU6A 4DR6B 3FF4A 3UM9A 4NCNA 4HZGA 1L5QA 1EGHA 1BH2A 2H1OA 5DHFA 4BB6A 3NBZC 5JDIA 1B3BA 2EGGA 2VUIB 2YQ4A 2UDPA 3HH8A 3TTWA 2HPHA 5C3UA 1LQUA 1VC2A 4AY4A 1LDYA 3L4JA 3PXUA 4ZC1A 4MPRA 1CDEA 1WCV1 3I9V6 4QU9A 3QKRB 3OY7A 2X0DA 1AD2A 3V2UA 2X7XA 2ZE6A 4F3RA 2Q1TA 2QMOA 2V7QA 4FGSA 1KI3A 1F6WA 5BN5B 3WMEA 1SCUA 1VLHA 3U7GA 2PV7A 4DCUA 1PVOA 3TTSA 2D8MA 1NP3A 1SUCA 1Z56C 1NNUA 4HUQB 2G63A 1I2BA 3QKWA 4RVSA 5DHAA 4GBJA 4WXYB 4ZEVA 5JYEA 2B25A 1LPBB 1M74A 4PCLA 1JT2A 3OIVA 1ZJWA 4MYTA 5JD6A 4ZK2A 4C2BA 1J8QA 5KC9A 3MTEA 4EKNB 1QHHA 1MQ9A 3I58A 1XG5A 4IQGA 1XZDA 2IYXA 3ZVRA 3KTFA 1CFZA 1GU1A 4FEYA 4JI0B 1YR1A 2IK8A 4M9ZA 2BGKA 4QFCA 1XAHA 4W4TA 4Q3NA 5ED0A 2XRZA 4XIFA 3VMMA 3UWMA 3UT5B 5ITWA 3RC8A 1AS2A 3D1LA 5FUYA 1U0RA 3UFBA 1WTCA 3BMQA 3UO8B 1JSZA 1YZKA 3CYFA 2ZYIA 3TVTA 1HORA 3KQUA 3QM1A 3E4DA 5F5NA 3FDXA 1IN5A 2PZKA 2KPOA 1NRJB 3KVOA 1UKBA 1E64A 4G0QA 4P84A 4ZYZA 1NW3A 3K32A 3ZWMA 3QE9Y 2JIPA 2JFQA 5JNRA 1PHPA 2VUUA 2F90A 2WD7A 3AFOA 4TLLB 5DI9A 5TV2A 4EM6A 2HZBA 2WUFA 4Z1OA 1QS0A 2D1YA 4HRVA 2O5CA 2GSDA 3QXJA 2YVQA 3ZV5A 2CXSA 3HJRA 5TMEA 1OFHA 1PT7A 3WK5A 3KQHA 1VE3A 5B57C 1TC2A 2ZBPA 1TQDA 2JJMA 4MARA 1JHUA 2JPDA 1D0SA 1VHJA 2V6FA 4XQEA 5JS6A 1XDZA 1TA9A 4RK7A 4GZMA 5DHPA 2UXDB 1V37A 2H1VA 2PIDA 1R16A 4XKJA 4YX9A 4NFYA 3OPYA 5D6OA 3Q8XB 1OBOA 1KO5A 3L49A 1WUTA 2DUNA 1SRRA 3GIDA 4TRRA 4INJA 1YE3A 1GUYA 1KF0A 1EFVB 4PRKA 3QWBA 5HDQA 1FRQA 2Q3MA 5EJ2A 2CL7X 3CWZA 3KYJB 2IYNA 4QGHA 5A1TA 5BOSB 3ZD9A 1QAOA 3UENA 4B43A 1SOMA 4Y3UA 5IWCA 3D6TB 3JX9A 4G07A 3EVEA 3JSAA 4IZHA 6YASA 3NGLA 4O2AA 3B3JA 1MC5A 1CLUA 1Z4IA 3OQPA 3P4YA 5GQSA 4RD0A 4D4KA 5I48A 1PSZA 4PAQA 1WCYA 1RFGE 2O06A 5M3BA 3TW0A 2C9CA 2OECA 3OE5A 3W0LB 2JRCA 4ZKEA 1E9RA 3A6LA 5AUOB 2VT6A 1JXQA 1Q2UA 2I1WA 2BEVA 2IH5A 4IX1A 4M7WA 5LIPA 4YYZA 3BKXA 3EHEA 1G8HA 4FEAA 4Y98A 5ULLA 2IYSA 1G1MA 3EGOA 4LSGA 3HEAA 4UMDA 1UBHS 5J1TB 3L8CA 4RMNA 2W83A 3LL4A 1KRHA 1Z0SA 3G0GA 4JY7A 4TUYA 5EHGA 3RBVA 4AMVA 3BFJA 3VTAA 4PN3A 2OE2A 2Q3JA 1RZVA 1C2YA 2H1HA 3RE1A 4OXQA 4A0RA 3RSLA 2WB2A 2A35A 1E1RD 1OH6A 4YP6A 3SQXA 3GQBB 3EWSA 1B6GA 4CMBA 4US2R 1QNLA 5CB4F 4L16A 1UEXC 2BH9A 5LA6B 3THXA 2F8SA 1GV0A 1QCDA 1ZXBA 2WIKA 4G0OA 4D8UA 5J47A 4ZEMA 4DR5B 4WDQA 2HGSA 1DARA 2MCFA 3WHKA 1W7AA 3OFKA 5CH3A 4LOIA 4IZIA 1Q84A 3UANA 4A26A 1I4TD 7ABPA 3U44B 3M4ZA 2JW5A 5G0WA 4XW2A 1ISFA 1USIA 1UMCB 1A5BB 3G9UA 2ES4A 1YQXA 2J9FA 3O84A 4KLRA 1WDKA 5HBGA 4GFDA 4RQBA 2BBWA 1YS2X 2VRCA 3FSRA 4C3OB 1MFZA 3EQ9A 4K87A 1KZ7B 1DBSA 3TRHA 5TJ9A 4PLTA 1T4CB 1U5BA 3JQPA 3C6XA 1O6BA 3UJ3X 4ADSG 4CIBA 5DM2A 2QYOA 4DB4A 1RLOA 3CLVA 1QRDA 2EWMA 4ZRMA 1RXUA 3KHTA 3W6NA 1D9ZA 4NDAA 1F7UA 1N5IA 1CY2A 2IIPA 2JBHA 4OP3A 1ZWLA 4RZSA 4ZU3A 3U7RA 4HQLA 1J0AA 4KOEC 4EB6A 3WB2A 3GP3A 2PT5A 4Z4HA 3HR7A 3R7WB 2IEGA 1G17A 1W59A 3KUKA 2FMIA 1WMBA 3DBOB 3GBPA 5EUMA 2YYYA 3NU1A 1QE5A 3RCBA 4BPBA 4V0MA 2HJSA 1XTVA 3KBOA 3HN7A 3DTYA 1KY5A 3L0SA 4JU9A 3IESA 4TWJA 4RAOA 2W4QA 1XZCA 4YAFA 1PG0A 4FYXA 2JARA 4NBKA 1UZLA 4C0JA 4QSMA 1PL8A 3CLTD 1AO0A 5CD1A 1M1NB 1SGWA 1HE1C 1DBWA 2HMVA 1IK6A 1MAHA 2V7BA 2NYRA 3L8GA 4UHCA 5AVKA 2XKJE 4ZOBA 3UAXA 1JG2A 1SXIA 4WJLA 1JH9A 2N3ZA 2ODBA 4A1FA 2ZFUA 4OMUA 3VR5H 4ISBA 1O95C 3H99A 4C0LA 3D6UA 2A7QA 2IYEA 1K3UB 3C1UA 1CUGA 5H3HA 3GOQA 1NVTA 5CM8B 2F8LA 1NY5A 2PUAA 3L8FA 4IIJB 2YXLA 2SKEA 4PQGA 1AO3A 1GQSA 2IGTA 3A4VA 1CULC 1DCFA 2F8MA 4HQFA 2HK6A 3NIFB 2BEKA 3TW4A 3PZRA 5C80A 4PYRA 1OPXA 5DNVA 2LCFA 5IAEA 5GJBA 1XDSA 1GZUA 2UVPB 4HDOB 4HR7A 3TOSA 5K0TA 4WBNB 3R0XA 2Z04A 3L6RA 2H29A 4DQLA 5JVDB 1CP2A 4QTZA 4YVFA 4I55A 3W7AA 2ZCJA 3QLVA 4IH9A 4B3TB 3GV0A 3DV9A 3TNDA 1A5AB 1B2RA 3D8SA 4BAUA 1Y4SA 1ZRMA 4HTAA 2C3PA 2P27A 1OY1A 2I2AA 2XYQA 4JNCA 4DNPA 1X1EA 4CDMA 4AX8A 4BNXA 3AI7A 1U0BB 2Y2UA 1P0IA 1II8A 2ZIZA 4KO4S 3ZEAA 1WWKA 2QXUA 3QYJA 3EOAI 4HZIA 2VH5R 1UM8A 1P4GA 3H9JA 3NDIA 5E9QA 4WW0A 4G9GA 3RC9A 3KE8A 5CIWA 2AOVA 1C29B 4I1PA 3DZHA 2WIGA 2BGMA 2OD2A 4TZ0A 2OQ2A 3ZI4A 3ZHVA 4JASB 4ASUA 1FLDA 1GLGA 1O6CA 4NPHA 4JJGA 4I3GA 4Y0AA 2VXOA 3F6YA 3I42A 4PAMA 4UQPA 4AZ0B 2VHTA 3WDKA 3CF0A 2DPXA 3FUWA 1NJ6A 2F3PA 1WB9A 4I46A 2FW0A 3EDYA 1E1DA 4BRZA 4ZT3A 3FVTA 2NMVA 2J3HA 2ZB7A 2RG1A 1ZFNA 4ZI7F 1WPGA 3HY6A 1WNFA 2GA9A 4Q4HA 4AJIA 2ZYRA 5FBQB 5C46F 3DSRA 4QXAA 1THZA 5LXTF 4RF4A 5CFMA 1IQPA 3RFCA 1ZI6A 1C9YA 2NZXA 4MEAA 3WRWA 4KPFC 4RSRA 5EPEA 4GZ5A 4EJ0A 4XWYA 2RH8A 4ERNA 4JS0A 2KLHA 3HL4A 3GFRA 1Z0ZA 5AVUA 3QPDA 4I1YA 2JH3A 2DBRA 3RBAA 5DB4A 3AM3A 2VNIA 5PNTA 1S89A 3HNRA 5CIQA 4W5HA 1QTQA 2N9UA 3IP8A 3F3SA 1W8DA 3L6DA 4YO7A 5TVGA 5JARA 4P6VF 3EBLA 1J09A 4NARA 4UAJA 5CA1A 3O3OB 4P54A 2OLEA 3JRXA 1ZI8A 3N9IA 2BR4A 4R6WA 3SFVA 3UTCA 5J2TB 2GCEA 3I01M 3UYLA 3R9XB 2Q5OA 4AS2A 4O4IA 4LFBB 1K7SN 2G76A 2OFXA 4ZDWA 4BB0A 2JLCA 1M1YE 2CNDA 2IV3A 1MD9A 3SC3A 1F0NA 1VE5A 1M6HA 4QUAA 5FV4A 3TOVA 1MQ8B 3PC4A 1ISHA 4TRNA 3FOCA 3S2GA 2R11A 4FFDA 2V1XA 4A2CA 2IZ7A 4BNDB 5KQPA 3CJTA 1I51A 1KSFX 2HYIC 1L9KA 1RYDA 4L28A 1O4VA 1TVCA 3C97A 4UZEA 3STTA 4BNIA 1QIKA 3RF6A 5I4IA 1XYYA 3OC6A 2VBGA 5F1PA 3B1YA 4DUYB 1UWCA 1A4XA 2HAEA 4EMSA 2YMLA 1IOVA 1NTOA 3DLPX 4WXRA 5BXYA 5KTPA 4ARCA 2FRDA 2GVDC 1GN8A 5DLQC 5KOYA 2CMGA 1LPOA 1NLFA 4RPHA 5HKOA 2XUJA 2VDPB 3AVPA 3C3JA 4RIFA 3AOEA 3VGJA 1YQWA 4WKNA 1GL6A 3AR8A 1DWOA 2GPSA 2YHIA 1E1KA 2OG1A 3K0HA 3MHPA 3QE3A 4M37A 5IBRA 1EK5A 2GN9A 3JAKB 3ZJUA 1PFVA 1XOIA 4A8JB 5K0EA 4Z4GA 5JH7A 1SJ9A 3OTQA 4N3BA 1WD7A 2EX4A 4O5OA 1JE1A 4WKOA 3DEKA 4ZV4A 1XBTA 4DCJA 1YZUA 4TLCA 5EXPA 2COKA 3EGCA 2UYOA 1W6RA 4PAOA 2BMEA 1R0KA 3JZAA 5CFOA 1G5IA 4KV9A 3SY8A 4ETIA 4RTMA 3G6WA 1QSGA 5KAMA 2JAOA 4MI3A 3S1AA 3ZDQA 1BTOA 4YLYA 1B26A 3LBFA 4BP1A 2C8JA 1ADBA 1A5TA 4PQFA 4BO8A 2IHZA 2O3TA 4PS0A 2BFFA 4U3JB 4B33A 4C3ZA 1WXGA 4B81A 1D2HA 2V4UA 3HKDA 2PXXA 2DFPA 1JQJC 1RP7A 3A3OA 4MV8A 5GONA 3TTVA 4CWAA 3H1GA 1HLFA 4KDCA 4CR6A 4ZYXA 4AZ3B 4RK4A 3OQIB 5ALIA 1I10A 2YXNA 2NQTA 4IJ6A 3ROGA 2L42A 3QIAA 4CKZA 3PPIA 1XIVA 4JT9A 2QX7A 2HMAA 1PK8A 1M3SA 4JSRA 4ZYLA 5EAIA 4YJ2A 2NOAA 5KBYA 3ITNA 5E0KB 4LHXA 3NOXA 3RS4A 4J0GA 1F2DA 3OD1A 1RIIA 2GZ3A 3F49S 3TD2A 1Q74A 4BS9A 4X61A 5IDYA 5KYNA 5BNZA 3PQFA 2IEZA 1T2EA 4M86A 3D8TA 5IS2A 1Y4DE 3C3KA 3GVPA 1QF6A 1VFPA 3QP9A 2PBLA 5I6DA 1IQ0A 3BE5A 1E7WA 3Q0IA 3LCRA 3K9FC 1Y1SA 3DMPA 3MINB 3Q3IA 1EH5A 2B8WA 1MXHA 3VHXA 2IW1A 4TOIA 3KZKA 1NM5A 1R6VA 1UC5B 2CHGA 2NV2B 3BSWA 1GCGA 1IB6A 2FPRA 3H1AA 3OSZA 3W3AH 4R2LA 1RYMA 2FRVA 1PG5A 2C99A 2ZIAA 2OZVA 2IV7A 1E69A 4UARA 2JZCA 3IAEA 2OGTA 4AZTA 4UTXA 4KP7A 2X42A 5BPFA 4X64B 1E0DA 4PGAA 5GOZA 3ZDBA 1P1JA 4XUDA 2CFIA 1O3YA 4BNFA 4X54A 4KJZA 1HSZA 2QU8A 3GJ0A 3P4UA 4J9VA 4PWZA 1QKJA 1IXYA 1EWYA 2DC1A 3PR2B 2NZUG 4RD2A 4EF6A 1IG3A 2ZRAA 3CSDA 2ONYA 2FY8A 2SKDA 3VHLB 3USZA 3LYAA 2IZ1A 2YRWA 1QLWA 3K9HA 4MUNA 1KYQA 4QU0A 4R71A 1KRWA 2QI9C 2ZJOA 2O8NA 4DV5B 1UKAA 1TRKA 2REOA 1FVFA 1FYFA 1I2ZA 4Q7EA 1IOZA 1MKYA 3F47A 4G36A 4CM9D 3I12A 4ZVLA 2WQZA 1BMQA 1R5BA 3Q7PA 4OQLA 1J0CA 1W5FA 3C7AA 4R2IA 2DERA 4FYYA 3N2NA 4F2HA 1JAHA 4RORA 1KDPA 2X8JA 1Y81A 3DGFC 3IMCA 3WHLA 4E14A 3THWB 5DP2A 4UBIA 3DZIA 4PHFA 2QZ4A 1SUAA 1ZQ1A 4QPDA 4L0QA 1BS1A 2X58A 4QYMA 3PX7A 3QENA 4FTWA 5KKCA 2OBMA 2WINI 3DUFA 3D7SA 4M1QA 3CJQA 1T4BA 3U62A 1GKLA 1TZKA 4IDEA 4YJDA 3ZE0B 2M2IA 1JWLA 2H0AA 1H3NA 1CHNA 4KK3A 4EJSA 5JFOA 2Y1CA 4EELA 2Q7DA 1K5HA 1C1XB 5EOVA 1HXHA 3VZSA 4BO9A 3THOA 1TU4A 1GZHB 4M38A 3N8HA 1K5DA 2XCQA 2RKBA 5B7GA 3IPRA 2Q5LA 4PSUA 4PW0A 1X39A 3IQHX 4AJLA 3ZBQA 4UTRA 5JBNA 4M46A 1NVKA 4UKDA 3QRWA 1ZD2P 1GIAA 3LCMA 3T94A 4ARIA 2JIBA 5UKDA 1BGWA 3LK6A 5SZJA 4UHJA 1P0FA 5CPFA 1KEWA 3BXOA 5IEBA 3EGDA 2MDTA 1RD4A 1YJ8A 1ZC4A 3A4MA 1OX4A 1L1EA 3KCNA 4QVKA 4Q9KA 5GJVC 2J9RA 1CQIB 2WJJA 2WWRA 3CWCA 3NJ4A 3WTCA 9LDBA 1JHPA 2O8FB 4KQIA 3I6ZA 2XLBA 3A9RA 3WYEA 2VTBA 5COQA 1N5OX 1HE4A 1FBNA 2H85A 3KU1A 1EWTA 5FHQA 3O8OA 4BNZA 1TT7A 1IUPA 1NG9A 2QE7D 5BT9A 3QVXA 2EBWA 2CJYA 1YE5A 4LZPA 1GYPA 2GCNA 4PFJA 2SHKA 1TL7C 1P1RA 1XF9A 3FROA 1IEVA 3MAAC 3EH1A 4Q9JA 4EL5A 5IFLA 3HDTA 2HNAA 1SK8A 2JASA 4GOJA 4GI2A 1YNOA 2DFNA 3AVOA 2RHBA 4YP0A 5HE9A 3EEYA 5BSMA 4A0HA 3CLTC 1Z5GA 2YDXA 3JQDA 4LHYA 4LZNA 4B82A 1DQRA 2JGEA 3ETDA 4G8JA 3S5UA 4AP9A 1V2HE 1OBCA 1QDEA 3WWZA 3CVXA 4MWZA 4EX7A 1FXWF 2R3SA 2PVSA 1XVLA 3A2LA 3E9RA 1R15A 3QELA 1X0VA 3F1KA 4PFKA 4QRHA 5IVHA 3UXMA 4FFPA 3W4KA 5B3KA 4YDHB 3RANA 1ZD4A 1U2SA 2YZGA 2G4LA 1EI9A 3OEEA 1DIBA 1R6AA 4LRQA 1MT0A 3VKFA 2EWWA 2CVZA 4TMFA 4FOTA 3GPCA 1M83A 4ZJZA 3MWDB 1V6CA 3E9CA 3HJBA 2N1MA 1TF5A 3WMXA 4LTNA 4LJYA 2XDAA 1NVVQ 1MVLA 1O96A 2OC4A 5AW1A 2C7VA 2BM1A 1Z38A 5IVIA 5JSKA 2OMKA 4E13A 3D2CA 4YCMA 1N9GB 4B2LA 4GF5A 4J0HA 5A3RA 4MWGA 3N75A 2ZE5A 4WMLA 3QU2A 1KY2A 5AW4A 5JJBA 3HFSA 3PL1A 3LTNC 3L7AA 5IAJA 2PXAA 4GT1A 4B8ZA 1UPFA 4TVOA 3FZGA 5ALXA 5EKTA 5JE8A 3VZCA 5C8YF 1JG3A 1U0LA 1B0UA 3S8MA 3JRNA 1KK0A 1NJ1A 1T8UA 1UOPA 2AZMA 2IJGX 4N12A 3TL6A 2VQEB 1M72A 1AX9A 2JBWA 4DM3A 3HTXA 1LRKA 2HQ1A 3TIVA 2TRSB 3GN2A 4UAVA 2P2ZA 3RREA 1ZRSA 3Q6IA 1J0DA 3DNMA 3HEMA 5E6RA 5HUJA 4DCTA 4NHOA 5KWIA 3GLHB 4UMEA 3L1IA 5FI0B 3L0ZA 4HEQA 4Z1MD 3F5QA 3LKZA 2VPTA 1RAHA 3IJEB 2WJPA 1CG6A 1ESNA 4ES6A 5EHNA 3U49A 3VR3A 1O9BA 3HMQA 3P7MA 1VIVA 4FR5A 2WB4A 4NV1A 4XOUA 1J8YF 1GXSB 2DRIA 1VCMA 3OZGA 4PZYA 1E4EB 2J0SA 4RQAA 4KQJA 2CEKA 2HWWA 3VUEA 4XPZA 2CDCA 2Z8YA 4OJTA 1TYCA 4NDZA 3P32A 3QMWA 5L7WA 1CX9B 4MOWA 5HMMA 2ZZNA 2WOOA 3AG6A 4P7KA 1G9TA 1OQAA 1U0HC 2P5YA 1AUXA 1QZUA 2VF5X 5A0FA 3DCIA 4P7GA 1G7TA 3O1JC 1ZIXA 3DKRA 1EVEA 2JFHA 1DIAA 4CKCA 2VNKA 1UPUA 4DMLA 4UAGA 1US8A 2ADOA 4Z0NA 1AGPA 1W9HA 2C2KA 2VHEA 3NHZA 3PV0A 4HT3B 1G1AA 1RTTA 3TNYA 2DUUA 3JQAA 2FFJA 3ICVA 3NRJA 2FW1A 2JAQA 3N2KA 2B2CA 4DWOA 4MDFA 1YTUA 1XNGA 1DTSA 1QR2A 4PSAA 2XVZA 5TGDA 3CVVA 1YZVA 5BNIA 5EHQA 2ERXA 2OFFA 3RC2A 4S1NA 621PA 2VDQB 1VXOA 2HXSA 1C3LA 2VQ3A 1RNLA 2WUGA 3NHAA 5JAZA 1TQ4A 4QQRA 2JBAB 3B9BA 5EZYB 3GGOA 3VU8A 3ZWYA 1QIDA 5JMPA 2BD0A 3EXAA 3PQ8A 3LDHA 3JD4A 4QYIB 2QRLA 3B82A 1N5DA 1L7MA 3IB3A 4JGBA 2RH4A 4RIEA 1JG7A 2FR0A 4QDOA 1U3UA 1IE3A 4F8JA 5K4HA 3FPEA 2E48A 3KS9A 5AHOA 2XWPA 4MB0A 2Q2NA 2ZSJA 1P62B 1U3VA 3SHFA 2WYOA 3L18A 2X2EA 4INOA 2V7WA 4OUDB 2EJBA 3NT2A 3BK2A 1YR6A 3G5LA 4QUDA 4YIKA 1XCBA 2X6RA 2CLEB 3IIKA 5LKAA 1IBMB 1RI1A 1PS0A 2C9YA 1NBEA 3P4XA 4KE9A 1XHEA 3FPGA 4UHBA 5ILOA 3DMNA 2IGBA 4XVRA 5K6TA 4ZTZB 1TUBA 3P2EA 2IBTA 1N1MA 1Z4QA 5DX0A 3TRJA 3CBQA 4F93B 1R12A 2MYPA 3O90A 1L5KA 4W1QA 2FG5A 3FLMA 4QE3A 3ETJA 3R7SA 5LQUA 1XNRB 3O8NA 5LZ7A 4D6XA 2DLDA 2I2FA 4L02A 1LW7A 1RXVA 2BSAA 4JOSA 1H5UA 5FO0A 4HEA6 1D4OA 2HLDA 1PWHA 1GGVA 5A7GA 4CRWB 3U4GA 5DNCA 3DHVA 1N3IA 3BFXA 1KOFA 2I1VB 2O7VA 3NVDA 3KJHA 4OHBA 5HF8A 2J7PA 4Z7NB 4BVHA 2QD4A 5D85A 4XYGA 3O8CA 4NK4A 1U2GC 4MUFA 3WXBA 3WKDA 5I8PA 1MNQA 5FI3A 3UICA 2BFCB 4FYIA 1SUIA 1A3CA 1DCMA 2DOKA 2FUG6 3ED1A 4GU5A 1Q7CA 4HUJA 1E2EA 3GDOA 4TYPA 3DP7A 2XGJA 2NXJA 3I0NA 4MCHA 2OCPA 5HX7A 4K6HA 3WK8A 2QF7A 3DFMA 2ZSAA 5LNK1 4B31A 1T5DX 4Q24A 5GAJA 3W2EA 2JCYA 3AONB 4YJ3F 3U9SA 3WYFA 1H2XA 3FD8A 3NC4A 4AJKA 2VHYA 4HWPA 1J5EB 3LPMA 2LTAA 2R6AA 2GD2A 5EWJB 2JAXA 5EE5B 5DT2A 4R9UC 2P3SA 1IM8A 3LI2A 4ZVRA 1TCAA 1ZEMA 2ORWA 2YFHA 3KJXA 2P3QA 4H7JA 1E9SA 3G8CA 3K92A 4J1TC 4L76A 5EIWA 5EYPB 3CG4A 3H7AA 3LWBA 5E6UB 2ZR7A 3GRPA 3MCAA 2WWFA 1BW9B 3DOIA 4E2WA 1JPVA 2QRHA 4OB8A 4H1UA 4RLFA 2FLWA 1U0EA 1AZTA 2AD1A 2AR7A 2G1JA 2O0JA 3AEUB 2HTFA 4H0CA 5KNDD 1QCZA 3HXPA 1ULTA 4JNKA 2AN1A 3M1IA 1C4OA 4WOCA 3H9EO 2WTUA 2AF3C 4YPFA 1N8TA 1DXQA 4ENTA 5JU6A 2O2CA 1XWIA 1C0KA 3E1GA 4KKVA 1IAQA 2AOTB 4FCCA 3LDUA 3MBIA 3VGPA 3I92A 3BDAA 4J16A 2PZBA 1BX3A 4MVJE 1EYZA 4MW4A 2WU8A 3QPAA 4ZVPA 2DPGA 2BBSA 4PX2A 1TM7E 3AJ9A 1PK7A 3B9RA 1B0ZA 1XGKA 1FZTA 4HADA 1SVKA 4REQA 3D7KA 4RENA 3SR3A 3LH5A 4WLUA 2NG1A 1PF7E 3D2BA 1GG2A 3EEQA 5DRTA 5E1DA 4AJ9A 3VSCA 1V25A 4RELA 1GPBA 1CWUA 2IL1A 2WUWE 2ZEJA 5GINE 1O6FA 4CM6A 1BVHA 3GFOA 1NFFA 1YBFA 3LDAA 4I14A 3ZTWA 2XB8A 4JITA 3W8FA 3FKQA 5BWBA 3GCGA 1U63A 2XCSB 4MS1A 2QRKA 3Q1LA 4EW6A 1UZUA 3PNOA 5DTMA 1A9XA 5CHEA 2IHNA 4KPYA 3JS5A 1EMDA 2Z57A 5KOIA 1U7ZA 4KIGA 5FKJA 1GZSA 2FZ4A 2H5IA 1YRHA 3SF8B 1GL7A 1QOZA 1RAFA 1EDOA 4J8PA 4Q5IA 2J46A 2XOKA 5G1PA 5A6VA 4JD5A 3ZU4A 2CE2X 4C0WA 3R7DA 3LECA 2VSYA 4QARA 3VX4A 3PNMA 4KQEA 3I2IA 5LLDA 4RACA 1PEAA 2XNSA 2IU0A 1HH4A 2JA2A 5BQ3A 1RYBA 4MA0A 3GZ4A 3LSYA 2DUWA 4UDYX 5PGMA 3GCDA 2R7MA 1NUPA 2F43A 4YT5A 1QAMA 3R3ZA 2PWAA 4V0SA 4JVOA 1TEXA 5K6RA 3M1AA 2EP5A 2REXB 4PX5A 3ZBPA 4I5IA 1ZHHA 4I9NA 5ENVA 4QYTA 2A0WA 3U3MA 4IS2A 1EUDB 1S2DA 2HA7A 3CLUC 1ND5A 1S2LA 3WSVA 3V34A 1CJSA 1ZK1A 3OPVA 4MQUA 2E4AA 1A1SA 1NYRA 3HYNA 4LOKA 3HRKA 5EMNA 5FNZA 3N8DA 1P2DA 4GI3A 4E1BA 5HZGA 2I3DA 1FQJA 1HDCA 2GJKA 3RS5A 3T3EA 3DV0B 2HV8A 3DNPA 4GMGA 1NY6A 1IHXA 2SECE 4DIUA 5MGNA 1TLLA 3GYBA 4HNHA 3OT4A 3G5AA 5BSHA 3CR3C 3HSKA 3TLCA 3O2NA 2FPIB 1T25A 3KQTA 1VPDA 3SVTA 4RPJA 4BGIA 4KFSA 4PR0A 1KETA 4B7AA 5ARDA 3HYRA 3M82A 4Y2JA 2AMVA 4QOEA 4DZRA 2VNJA 3FSGD 4WZBE 3H9CA 3KDSE 4PNHA 3BMOA 4JI3B 4C1NA 1EK2A 4CLDA 5E0OA 4UNRA 1U7DA 1G21B 2YQ5A 4TMVA 5JHGB 1TAHA 4XB1A 5CXSA 3QLJA 5JUWA 2Z2ZA 3L0OA 4TMYA 1SA0A 4DL9A 4EY5A 1QZTA 4QPZA 5GIPE 4P0TA 1ZCBA 4G23A 4X1KA 3P9CA 4CKYA 1H6BA 1YR9A 3V1UA 2D0IA 2HBRA 1WUJS 3AETB 1ZMXA 2JFXA 1XCMA 2ILTA 1OGYA 2ZBQA 5DN6A 4ZOLF 2WFLA 5IJ0A 2C8KA 2OWDA 2DB3A 2JIQA 1YH3A 2YWHA 3LC1O 2IUSA 2QRUA 4GPBA 1TDJA 4Q6BA 2OXRA 4AECA 1HBJA 2ZRMA 4RULA 1XZNA 3ILYA 2BY4A 2Z43A 2HU7A 3MS7A 4C6SA 1DADA 2CMKA 3AWIA 5D3MB 4IEEA 1L5SA 1SCIA 1PQ4A 2HHCA 2PNFA 3A6DA 4TL7A 3ZHYA 1CUHA 3ESYA 1Q0HA 2CUNA 3FCSB 3HV2A 2FQQA 1JAIA 3NDPA 5LLTA 1XL0A 3M34A 1UUFA 2ZI4A 1P6UA 1S2NA 2YYZA 5GZ1A 3FUCA 4BX2A 4M53A 3AF6A 3TS1A 1BXKA 2HM7A 3W2TA 4NBLA 2BHLA 1L6IA 3GLSA 2OO7A 3LFUA 1IQUA 4A8JC 3D1JA 5A02A 4G2NA 2W8BB 3D3NA 4FKZA 3IULA 4WKGA 4IPTA 3WWYA 2J3MA 1N5KA 3RHZA 3WIVA 4P4NA 4ZQCB 4GOOD 2OBFA 1D8AA 2HCFA 1VYVA 3WTBA 4D3FA 4BKMA 3U7HB 2AC2A 1A50B 1CC1S 5DYNA 3AXSA 2R4UA 5TY0A 3VU1A 3B8EA 3HO6A 4D8YA 1Z34A 2BDUA 4INPA 5EKUA 3IDFA 5IN4A 1SN7A 2UYHA 1M7BA 3M6LA 4D3XA 3IAS6 2J32A 4G5SA 2Y0DA 4RH0A 3AF3A 4O1HA 5CGQB 1GGJA 2QM0A 1DFGA 2XYRA 4GYYA 4ALNA 1XDGA 3P8ZA 3ECCA 3CBGA 3LIIA 2GHQA 3G0CA 3D7MA 5G4KB 3ZCPA 4EA6A 1IUKA 2ZBUA 1NZJA 3DO5A 3GUYA 1F3LA 1O6ZA 1MFPA 1O7JA 1QZZA 1BG6A 1Q7GA 1XN4A 1YZTA 1ZK3A 2Q3HA 3DBHA 2IPXA 3EZLA 4LOHA 1BVUA 1KZGB 2E9SA 2GK6A 1CF4A 4XE5A 2HDHA 3LG2A 1SUWA 5BPHA 5ALYA 1FNMA 1P0QA 1QV6A 2ECOA 2MMGA 3NZEA 4BTEA 1SIOA 5FNVF 4K05A 4A10A 4EG6A 3T0GA 4IOKA 1DDIA 1J8MF 3WQBA 4DTIA 4HG2A 2HV9A 3OBIA 3WK9A 2A0KA 3VOTA 5JIBA 5JYCA 3H8VA 2IW3A 1P61B 2VXBA 2WWWA 4GGOA 5BMVB 1EFUA 1I3OA 1XQXA 2W2LD 1RRFA 4BO5A 4V0LA 2HK9A 3HDJA 4M0CA 5HG0A 4C22A 4NR0A 1V9LA 1F12A 5E1OA 3LUAA 2QSZA 1QONA 5T4HA 1CZOA 5DX8A 3HM9A 1XNQB 3N5CA 1RU3A 1XK6A 2NTNA 1II9A 1OFIA 3ZE1B 2BTQA 2R751 2H7VA 1W5AA 3BAFA 5A5FA 2XB9A 3PG5A 3BREA 4JYBA 4J3NA 3IEMA 3INGA 3HVUA 2EFDB 3Q88A 4DV3B 3H05A 2PCLA 2RGXA 4TMKA 5DULA 5F77A 3VKVA 5JQGA 1XFDA 2GVZC 3H16A 3IJ5A 1Q3HA 1YMQA 3DEFA 3S5JA 5L45A 4BFUA 3C1TA 3HV0A 9LDTA 1H4QA 1Y7IA 1ZH0A 1VE7A 1HL3A 2J6IA 1YZFA 3FDZA 1KI4A 2I7CA 1QYDA 5JNTA 2QV7A 3EODA 4BV2A 3GEMA 4EF5A 5JLAA 4GECA 1JDJA 2EL9A 3A2MA 3LLUA 4JC8A 4PPFA 5SZIA 3HB0A 2V6IA 1V5WA 2PLAA 3TX6A 1MUUA 5ES4B 2C9BA 5EQJB 1E0AA 1J2EA 2OD9A 3L01A 1NMEA 1G6KA 2ZWIA 1YFZA 3DDOA 3TDMA 3RYTC 1RXYA 1YR8A 1Z6QA 2GBCA 2YWBA 3ASZA 3R4VA 2HQRA 2Z8XA 4QICA 4F6CA 3F8WA 3GFSA 2QX4A 1UWKA 1X15A 5K8IA 1A8QA 4EITA 3H9QA 3BRQA 2MJLA 1EGMB 5L3SB 1XCLA 4Y0VA 1GL9B 2VDRB 3WGOA 4CPDA 2XAUA 5IABA 1I36A 1FPQA 2P3LA 1JR3E 5DP1A 1U80A 1MEJA 2WABA 3EW9A 4QEZA 4TL9A 1ECGA 2M9MA 2BHRA 4WLNA 4DRXB 4O33A 1KIMA 1TVKB 4YECA 5B36A 4M0EA 2FJPA 2Y92A 1JH8A 4AMYA 2XKKA 3QTBA 1MTOA 2XODA 2EZTA 4OBXA 3R7LA 2X14A 4JUBA 1AHNA 3IAM6 4CM1A 1XSEA 3BXFA 1U7OA 4CT4B 3SIXA 5CLHA 1FRFS 2B4KA 5SYAA 1DRJA 1M1YA 3A1EA 1UKEA 1G3UA 3N8IA 3HXMA 2KM1A 4K9MA 3P2KA 3H2KA 4HEHA 2II6A 5DJ5A 1FYXA 2H7CA 1O9HA 1Y7PA 3KO8A 3LX4A 3PF9A 1U3WA 5CBPA 5L6MB 2YZ2A 1GZVA 1M2JA 3K2BA 1WPRA 3GAZA 3MCZA 1YI0A 2PKXA 4OHKA 2VPYA 4XXHA 5FAXA 3H5LA 3UK2A 4ZIRA 3NASA 2WP8J 3PQ7A 1MPTA 4FR0A 4PHHA 1A95A 4WLFA 5F73A 3T35A 4CM4B 4FR2A 2AOUA 4ZO8A 3TUJC 2P5UA 4WKBA 1DQZA 5AMXA 2QTGA 3WYAA 1BXRB 2R2AA 4J6EA 4EQ6B 3F78A 1AIPA 5FBLB 3OIYA 4RHUA 1JQBA 5TS2A 1JR6A 1Q12A 1W29A 1PWZA 2OFPA 2ON6A 1OV4A 2Q46A 2XVAA 3RAJA 4C2TA 5FORA 2P0AA 3VU9A 1P81A 4O6VA 4XLLA 5FEMA 4EHFA 4OU5A 2YIDA 5FAKA 5IT5A 4BFYA 4BLWA 1K1EA 3GJ6A 2E5WA 5T3UA 3T0IA 1DKPA 1EZ4A 2AW3A 1B7GO 1NLUA 2IU4A 3LCVB 3BQNB 3RSQA 3WR5A 4A92A 4B4UA 4DPMA 5K6AC 3R3XA 2ZJYA 4H4CA 5CYFA 4Y7DA 3W4IA 1JJ7A 3ZXIA 4CNBA 4ER7A 3BXGA 2PANA 3M5WA 1EE2A 5C52B 1KNXA 2FWJA 4OHYA 1PR4A 1Z74A 4W9NA 5JS2A 3ETNA 1FOEB 3NV7A 2VK1A 4CKXA 1U0GA 2NNWB 5D51S 3G2LA 3FHOA 4GWLA 4YCLA 2HT6A 3GUHA 4RU1A 3SYLA 4FJ2A 1LSOA 2VPQA 3ZWQA 4CDRA 2M6RA 3QWAA 3K1YA 3B13B 3KSRA 2V3VA 4KQGA 1STOA 4Q7LA 4P93A 4PG7A 2BSQA 3QUBA 2CLSA 4EI9A 5DGXA 2CFSA 2J87A 3F5FA 3AINA 1KEKA 1VIAA 2DULA 1IZ7A 2VDJA 1JVSA 1UJ4A 1M1XB 3ESZA 4L8WB 4RY8A 1NDQA 1AE1A 4FX5A 1GZ4A 1Y80A 2D3TA 2HIMA 5ADUS 1OX5A 4B6QA 4YRIA 3FPJA 5LSAA 2QYTA 5AVYA 3I5AA 1C3JA 1HDRA 3G88A 5HS6A 5K3BA 1W4LA 3IBGA 4C87A 2UXBB 2R79A 2DT5A 2FMFA 1QGYA 2FR8C 1TD1A 2OBBA 2H4JA 2G8LA 3FYTA 1APBA 2A3NA 2ENWA 1JKJB 2D06A 4H3SA 1EB8A 1W34A 2VATA 4JOQA 3UC5A 5DCYA 5FEUA 1YKGA 1I3CA 3ETHA 4IEFB 5MDHA 3W5BA 3RVKA 4EG4A 2VJLA 4F11A 1X87A 2FZKA 1Q11A 3CVJA 1WXFA 4BNYA 5LYJB 3ZVMA 1D04A 2XTJA 4GHWA 4KXLA 4GKAA 2XNDD 2C84A 2VF2A 4D9BA 1KC3A 1L8XA 4U2KA 2WG2A 3H9GA 4HNSA 4D4GA 3JQFC 4V2UA 1I3LA 4TTPA 1T4GA 1L3CA 4ML3A 4W7SA 4WRRA 5K0FA 4ZDKA 1D0VA 3WLLA 1PCXA 1HLGA 3O4JA 5ALEA 3GB9A 3N28A 4NQZA 4TLDA 1JMVA 3O83A 3UK1A 4BP9A 4EVSA 3RTDA 2I5PO 4Q4JA 3EIUA 1J42A 2ZT5A 3NTOA 3TQRA 1CZNA 4DR3B 4CGYA 1SXJB 4FBLA 3VI3B 4G4JA 4UEJA 1U1DA 1KFEB 3SC2A 2CZGA 4F4DA 2CUZA 5JS7A 1WABA 2LDXA 2QX6A 4GMKA 1U0OC 3PQ2A 2P6RA 1P9NA 1VLZA 2JGRA 3MOSA 1L1QA 4GG1A 5JAOA 4FNAA 3DFZA 3NLLA 3RROA 1F7VA 1H8HD 5DM70 3LX8A 4LXHA 4CJXA 3F98A 1IZ8A 1USVA 4YJ2F 3CURA 3NI2A 4RIGA 4CV2A 2OO3A 1PJQA 1U8EA 3L4BC 1KPHA 2R1ZA 2KLBA 3GFTA 2WHXA 4JJFA 4MJLA 4KN5A 4PSVA 4ZHQB 1WUYA 1LUAA 2JGLA 2REQA 1TUIA 2YCBA 2MIIA 4UVIA 3TM5A 3U7JA 2R6HA 4I4LA 4HJXA 3ZU5A 3QOFA 1XQWA 3KAKA 1FNCA 5KYXB 1OBVA 2AEFA 1VE9A 5F1YA 1YRBA 5KREA 2XZOA 1SIBE 1UZMA 2B34A 3LT4A 1TVEA 4CTKA 5A62A 1JSXA 4Y2UA 5DNUA 1J06A 2ZRIA 2BN4A 1MB9A 3E15A 1UK7A 2DFDA 1DQYA 1BDHA 7MHTA 2LUOA 5CT4A 4AF7A 3BWVA 4WOPA 4QECA 1EEHA 3VYVA 4AURA 4OXIA 1R1DA 121PA 3KWMA 3K35A 4G0YA 4Z54A 3DTTA 2M1ZA 3N0RA 3Q5DA 4M1YA 4P4TA 4CT5A 2Q3DA 7GPBA 3EPLA 1FFGA 2C3OA 2XSZA 3TRKA 3TVDA 4A2PA 3I8XA 4GZ6A 4YMGA 1U2QA 3WZMA 2KBEA 1A8SA 2EEZA 3BJIC 2XA9A 1YVPA 2I9PA 5ESXA 4KW7A 1DELA 5ADVA 5BQFA 2DR2A 4LK3A 2QK4A 3HBNA 4HNUA 3MOIA 3T3HA 2X4IA 3R5HA 3GA7A 3KG2A 4TL8A 5KOJB 5J5AA 5AK3A 1W96A 3GVCA 5KKAA 1CIPA 1LS1A 4F2GA 3NO4A 5FQNA 3KPYA 6REQB 5ALGA 4MMZB 2X5KO 2PD4A 1QGDA 4QPNA 4YQFA 2J4CA 1TE2A 2IVFA 4WNYA 1SVMA 3IPLA 1ORWA 3IOEA 4IHJB 3RRFA 4KBFA 5JD3A 5IJZA 2CDBA 2WF8A 4C6TB 1B6TA 3HWX1 5G1NA 4YAJA 3V7YA 1R6XA 1OA0A 4MLDA 3T95A 1S8NA 4BFZA 1IUNA 2WV9A 3SK0A 3ZCTA 3DL7A 2I78A 4B3IA 2YQZA 3G5MA 2EP8A 3U0BA 1OWMA 2HJWA 3CUUA 4LBZA 3UJ8A 2OOKA 3NMUF 5ECGC 1UJ2A 1WX1A 2IF2A 3AH8A 4NYMR 3GC6A 2ESRA 1DX4A 4K46A 2QROA 2WYWA 5EG5A 1TK9A 4CG0A 1XI2A 4JQOA 1G5PA 1QTIA 5JY6A 3IQIX 1Z3IX 3VJLA 3TJZA 1R9JA 2VDUE 5F7JA 1E3IA 4OM7A 4A7PA 3R5XA 2X5OA 4LJ9A 4TSFA 3QG5A 2CLOB 5KZMB 2Y9PB 4KG7A 5D7NA 4J0EA 3ZX5A 2RKWA 4NH0A 3AVXA 1LV7A 1RXSA 1YQ9A 3ET5A 2QMYA 4U8GA 3SHVA 1JQKA 3BBPA 3JR3A 3O3NB 4QEKA 4YRAA 1RZRD 2E5LB 3D3JA 3C7TA 3I1IA 1THMA 3I32A 3MUFA 4E5VA 1BFUA 2GNAA 4IDDA 3AU8A 2P1RA 2H4WA 1EVLA 1K06A 3IQGX 4YACA 4JXXA 2QLJA 3PXXA 3FPHA 1UMDB 1C30B 3CGWA 3GLIB 1QK5A 3LLMA 3KXPA 4CHTA 1Z33A 1EVIA 1POWA 1U1IA 5IFKA 3GGGA 4FW8A 5CITA 1KARA 4FOPA 1OX6A 3D6JA 3K1TA 1HM5A 3RD5A 1E20A 1E1QA 2H52A 1T9GS 1FDVA 2E1RA 2V0CA 1NW6A 2Q0XA 1JZTA 1OV6A 3B9PA 3IT2A 3GA0A 2XLCA 4DBVO 3C8HA 3N2IA 4A82A 3CRNA 3T7DA 2WVHA 2CUKA 3LLSA 1PFQA 4ZU1X 2YS6A 1RYNA 3DCYA 1FDOA 2MSDB 5IKPA 4HWRA 3CF4G 4DHWA 5B3JC 2J8ZA 1P1BA 1A97A 1B93A 1EG2A 2Q6LA 3DBLB 4FMDF 3RSSA 3TVYA 3NNSA 1WXDA 2X15A 4PLPA 2BHTA 4UTPA 4E5YA 3V4RA 3WSWA 4F3NA 5CLIA 3VR6D 2Z3ZA 4OH7A 4YAEA 2BR5A 5MGBA 1JXOA 1C4XA 1QHSA 3E35A 4HN4B 3TNFA 4EEZA 1EUCB 3AHIA 3HGMA 3HSSA 5CA0A 1N6IA 4YUWA 1R9MA 3L8YA 1JFFB 2G9NA 4E30A 4RXTA 3PXEA 2ZS7A 1NI5A 3JQ9C 2D2XA 2Q99A 1LBSA 1AF4A 2CXNA 2XUHA 4Z8YA 3D2AA 3FG9A 4J76A 2GPYA 1RWMA 2YICA 3ODPA 1P2SA 1RKQA 4V0KA 1XTSA 4D44A 2FHSA 1MDBA 3D4NA 4TYWA 2QVZX 3BXZA 2WAXA 3QFCA 3ZU2A 4C88A 3V55A 7ADHA 3WLFA 4B09A 1PJ3A 5IC5A 2A5DA 2ZW9A 2AOWA 3ZCSA 2X8AA 3ENQA 3WYBA 3ZE6A 4H3VA 1SAYA 1G3RA 1M0SA 2AZ4A 3O7MA 4NFHA 1RE1A 4M1TA 3KOZA 4JVMA 1H22A 2X3YA 5KJFA 3GD7A 4RLSA 2P9TA 1E2GA 2IF0A 3IILA 4JBXA 4MPDA 4OJQA 2H4ZA 4YCBA 3ROEA 3ROFA 4OJNA 2ISCA 1YQTA 3RYHB 2AH5A 2Z3WA 5EJAA 3TGWA 2O0MA 4KMMA 1NR5A 4HXEB 5B58C 721PA 1N5LA 4FS8A 1E2LA 3RFXA 5JMOA 3RVQA 1I24A 4F5ZA 5AJUA 3OF2A 4KIFA 4UHKA 4ZO7A 1V8FA 3DLBA 1PS8A 1W93A 3ZS8A 1GY8A 3TNJA 4DYHA 5KKNB 2C2OA 1ACJA 2Q0HA 2ZCUA 3NBAA 4WE3A 4PWYA 2HCTA 3FFAA 3BCSA 4KUEA 4QIHA 4ND8A 1JFSA 4GXTA 5ICGA 1WS6A 1P1HA 3AY3A 4LS3A 1IVNA 1OE0A 2BGRA 2I3GA 1OFTA 2ZWMA 2ZJAA 3B2QA 3PHJA 3QHAA 3ASYA 3Q6NA 4G09A 4J49A 2FPOA 5T57A 4BO7A 3E3OA 2YOHA 3ILVA 4GR9A 1NVAA 3GARA 2HQOA 3BMCA 3LRPA 3E3LA 3PEFA 4K6FA 3IAUA 1EBFA 3F6BX 1TTTA 2WEKA 1CIJA 1SQ0A 3ZK7A 5FOWA 5TVKA 1H2AS 2X8WA 3T0FA 1LDMA 5J63A 2GN8A 2PEYA 2ZOSA 1LVGA 2Z4TA 2ZSHA 1BD4A 1A27A 3IE0A 3MA0A 4WY8A 1X0XA 1KPGA 3FJ1A 2EGUA 1CE8A 2C96A 3RIHA 1F4VA 2WSLA 5ISMA 4GOLD 3U3OA 5BUSA 4RCVA 4D4LA 1JIVA 5CYPA 4KHPB 4G63A 3TRIA 1A2QA 1QFMA 2DAPA 2RGBA 3L7BA 2C7OA 1Z16A 2FMHA 4ZT6A 3LUHA 2LV8A 2QUKA 4HQKA 1FQOA 4UUNA 2R9VA 4GW3A 3FOFC 1W4RA 3KTOA 2BGWA 1V5GA 4QUJA 2CV1A 4A0FA 4QWWA 4W8OA 1CS4C 3UJBA 3HR4A 1E77A 3N87A 3LW7A 1ZUNA 1K8ZB 2JD2A 4KQCA 4EFDA 2JLQA 1DXHA 2G06A 4D4MA 5AKKA 4L4XA 4YR7A 1OKKA 1X7DA 2Q6VA 2B3TA 3MD9A 2VG8A 2XUAA 1AC5A 1U9JA 1BIFA 1YZLA 1E5DA 2IFTA 3IIIA 1VHQA 3K6RA 4MRSA 2X41A 2P1DA 3B7GA 1XB2A 3IUMA 5HUQA 2NAPA 3PNLA 1C0EA 3SOPA 5K51A 3FYUB 3KKQA 4EHDA 2W2TA 1XXHB 1X7GA 1LNQA 2W90A 4S1WA 4WN9A 5FL7D 1OJLA 1CUUA 3WGMA 4E03A 1LDNA 2V58A 4N6NA 4GI5A 1YQQA 2EF0A 1AZSC 2AF4C 2H65A 2HDOA 2PJDA 3PPXA 3JAMA 4FMCF 1QHNA 4AUKA 3FOBA 4HI0E 1F5NA 2QPLA 5CAEB 1P9LA 2Q29A 4RKQA 2RONA 3UN1A 1D8TA 4NXNB 2QPTA 2VPWA 4TM8A 4B4OA 2EWVA 1WXEA 1O1YA 3BXHA 4JVSB 5BV8A 5I9BA 2WY2D 1QHXA 2EDCA 3NYRA 5C3MA 1U8CB 1FFEA 4N82A 3G2MA 1TJYA 1PQYA 2MT9A 4M8NE 1E61A 1KZ4A 2JZOA 2DYKA 3OTWA 1WUHS 1YS1X 2V5AA 3AKCA 4ZVMA 1UIRA 4R5MA 5BT8A 4UVHA 1COWD 3KUDA 1T8PA 5B4TA 4QO8A 3QWIA 5C2JB 1JHDA 4I7EA 1IWBB 3GNTA 1CSEE 3W1WA 2QRGA 1L8QA 2H3EA 3QUSA 4L3VA 1T0PA 4EUFA 2IXEA 4F60A 1K8XB 3LF2A 4MR7B 4DQUA 1PZEA 5DLEA 5LUBA 3SX2A 1H66A 4U7TB 1X86B 4I2NA 4G97A 4K6GA 3VR2A 2V5UA 1AMNA 3BIWA 1II0A 3D02A 3E22A 4YJFA 1ZU5A 3LU1A 3NYWA 4LHEA 5FOVA 1CJTC 1Q0TA 1TMYA 1SBCA 3CH6A 5IJ9A 4TQGA 1EP9A 4NJOA 2C2MA 2N75A 2W6MA 3JCZA 1LRLA 4L2IB 1UKVY 2R8XA 3EXG2 1E6MA 3HI6A 4BE9A 3WDLA 1G19A 2GXSA 1T2DA 2ZB4A 1W47A 4NTZA 3G23A 3COYA 4MVJA 2VAXA 3CF2A 4DMGA 5BYAA 2C88A 2OHIA 1E89A 1EIZA 1S4QA 5DGHA 1XLTA 1I8TA 3HU1A 3IVAA 4DGQA 4FYMA 5BW4A 1V16B 2X1VA 1QF9A 1M8JA 5DRYA 4DA7A 1XL1A 2OV1A 2FPWA 4MRPA 1LDBA 1SEPA 3OQNA 3CUSA 1M54A 1IY8A 4XSGA 1VBKA 4H16A 4Y6PA 5E1MA 3HYCA 1GUFA 3TQSA 2RGNA 4F1WA 4EY3A 3M7IA 4QJ4A 4H08A 1OH5A 4ND4A 3MBKA 3FCYA 2GZAA 1C8KA 4EB8A 1T9ZA 4JBNA 3PWZA 3K70B 1E7MA 2A78A 4ZQEA 1MJHA 3IP3A 1G3QA 3O2QB 4FKMA 1GDTA 3ZCVA 1D6SA 1NLYA 2OD7A 4HFJA 3BK7A 3H2YA 1KI6A 3I2JA 2EP7A 1ISJA 4AKIA 2I4RA 1NOJA 1X7WA 2HMUA 3DJFA 1XZFA 4TS1A 1TF2A 4OF4A 4DA8A 4Z2YA 2YC2C 4F7WA 4BMSA 3OA2A 4FFVA 1DXYA 5J58A 3MWJA 3TLGB 5JSHA 2WHYA 4N1AA 5JZMA 2HBQA 1BRMA 5ALLA 2AN9A 1HYGA 2P11A 3UUGA 1P7YA 2JCXA 1H2ZA 5CG2A 3E7DA 4R1PA 4DV0B 4POOA 1OILA 4DLVA 2ERCA 4BV9A 1SVOA 3VH2A 1FJ2A 3NDRA 3LP6A 5G3ZA 5AW7A 4ISCA 2VUSA 1CUWA 3JVIA 3OHSX 4L73A 3A05A 2O1SA 1SKUA 1J5PA 1JECA 1GGHA 2PWBA 4I50B 4UM5A 5H16A 4M1WA 2YJGA 3ICCA 4F2DA 3RF7A 4NU0A 1JXAA 2FPPB 4U7FA 3N2GB 2I33A 1SC9A 2O8BB 5JQWA 5EXSA 3QU4A 2J9YB 5CDYA 4O5AA 1GNVA 3B78A 2VYNA 2A59A 3KB1A 4DAOA 4YRTA 1Z5VA 3LPAA 3QUCA 1A82A 3D43A 4MUMA 2NU7A 5C1DA 2WM9B 1KY3A 3L1KA 4JHXA 3VMFA 3PQEA 2GJ8A 2IHKA 4YCNA 5FLXA 4YRRA 4CKBB 1SUEA 1VL0A 3C8ZA 1J90A 3W79A 1PNQA 2CW5A 1Y1KE 3TCKA 3HKCA 2HMYB 2XW6A 1IEWA 1I2CA 1GLNA 1PGNA 3I2KA 4RKEA 4RDIA 3SS7X 4ZHSA 1AQYA 4M8IA 1EINA 1Q0LA 3FI0A 1DEXA 2BCJQ 1ZGCA 4UZSA 3ETGA 3L7CA 3NHPA 3UJHA 1J9ZA 2EJVA 2VRCD 3WL7A 2KQUA 2R8RA 5AR1A 3ZHBA 1DIHA 4ZQBA 5DBOA 4WZAB 2DFTA 2QLFA 3A37A 4ZZ0A 3T3IA 3VPAA 3EFOA 3KL2A 2VHQA 1YRQA 4OJKA 4EEXA 1QH0A 1NJ8A 2G82A 2NU6B 3BL5A 4MZDA 5KTKA 2JD0A 1CUAA 3ELYA 4JHLA 5KYUA 4PBSA 4GQAA 4FW9A 4NU8X 3KR0A 4BFSA 5TMDA 5JPDA 4Y2VA 5EP2A 1DG3A 1UINA 4JL5A 2GPAA 1RABA 4EQZA 2B8TA 3TTUA 1JA1A 1KBZA 2UYYA 4P4SB 4TTAA 2M6KA 3I61A 2J45A 3I9JA 1NNSA 2YXDA 4RFSA 4BIMA 4FWTA 1SCNE 4NYMQ 1C9DB 1PJ8A 5AT1A 1GPKA 2YWGA 3NALA 1VB5A 1Q1BA 2F9FA 3FVVA 1EUYA 1TJ3A 4R2WA 3IP7A 3KJIA 5D8DA 4D46A 2NYVA 5ITSA 2FZCA 5CUQA 2BFBB 3CX3A 4QDUA 3UKJA 1PT5A 1TKAA 2WFAA 5LD2B 4NS1A 3K2EA 3LOUA 3M9XA 2DTXA 1I0IA 3U4QA 4HYTA 3C8UA 1ISGA 4B32A 3BWYA 4QJ3A 2Z3VA 1VL2A 3HFRA 3GH3A 5I5GA 3IKVA 3OEHA 2IIVA 1PLKA 1Y5MA 4K1LA 4F9EA 3AJEA 4P5DA