2PS3A

Structure and metal binding properties of znua, a periplasmic zinc transporter from escherichia coli
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
284
structure length
265
Chain Sequence
AVVASLKPVGFIASAIADGVTETEVLLPDGASEHDYSLRPSDVKRLQNADLVVWVGPEMEAFMQKPVSKLPGAKQVTIAQLEDVKPLLMKSHGDFNMHLWLSPEIARATAVAIHGKLVELMPQSRAKLDANLKDFEAQLASTETQVGNELAPLKGKGYFVFHDAYGYFEKQFGLTPLGHFTVNPEIQPGAQRLHEIRTQLVEQKATCVFAEPQFRPAVVESVARGTSVRMGTLDPLGTNIKLGKTSYSEFLSQLANQYASCLKGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords High-affinity zinc uptake system protein znuA
publication title Structure and metal binding properties of ZnuA, a periplasmic zinc transporter from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal transport
total genus 85
structure length 265
sequence length 284
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2ps3A01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2ps3A02
3AEQA 1EFDN 3LHSA 1N4AA 3MFQA 1QH8B 1G20A 3R5SA 4IRMA 4INPA 3HH8A 1PSZA 3HJTA 4PM4A 3AERB 1PQ4A 3ZTTA 5B58T 2AFHB 3AETA 3BE5A 1XVLA 3BE6A 1N4DA 3AESB 1L5HB 3EIXA 4OXQA 2OGWA 3AEUA 4WZAB 3TNYA 4WZBB 4ND8A 4HMOA 2OV3A 5BVGA 3MINB 3ZKAA 4NNPA 1QGUA 3K1AA 4UDOA 4N01A 2OV1A 2PS3A 2X4LA 3PDIB 4UTPA 5CX1A 5M2QA 1ESZA 2R7AA 3AEKB 1N2ZA 4INOA 1N2CB 4DBLE 2AFIA 1QH1A 4TKVB 5KOJB 4TKUA 4WESB 5BVHA 2XDQA 4PAGA 1MIOB 1FP4A 1G21B 4WNAB 1M1YA 4GICA 1H1LB 5JOQA 4G07A 2XH8A 5JJ5A 5GGXA 4K3VA 4FKMA 4WN9B 5KHLB 2XUZA 1G20B 3PSAA 1KAEA 2PHZA 1QH8A 2R79A 3AERA 4XPIA 4MDYA 2MINA 1M34B 3NU1A 4MLZA 5KOHB 3ZK8A 3MD9A 3AESA 3U7QA 1L5HA 1K7SN 1KARA 3ZK7A 3PSHA 2WHYA 2XY4A 2M6KA 5M29A 1QGUB 4OVKA 3MWGA 2RG7A 1M1NB 2YNMD 4NNOA 3PDIA 5CR9A 4CL2A 2PS9A 2M6LA 3TLKA 3G9QA 2YNMC 4TKUB 2PRSA 3AEQB 2XDQB 5JPDA 1M1YB 4WESA 5HDQA 1MIOA 4LS3A 3MWFA 4H59A 4WNAA 4HMQA 5AFSA 5M34A 3LI2A 5M3BA 3AETB 1H1LA 4HN9A 5JG7A 2Q8PA 2ETVA 3AEUB 2OSVA 4HMPA 5GGYA 3R5TA 2AFHA 5FLYA 4WN9A 4ND8B 4MX8A 5BVGB 1K75A 4WZAA 3GI1A 4WZBA 3K1AB 4XPIB 3MINA 2MINB 4LJSA 3HXPA 4FI3F 5CX1B 4FNAA 4BBPA 3U7QB 2XV1A 3CX3A 1M34A 2QI9F 2AFIB 3AEKA 4H0FA 4MO9A 1QH1B 1TOAA 4FILA 5KOHA 1K2VN 1N2CA 5BVHB 4TKVA 1FP4B 5KOJA 5HX7A 3ZK9A 3TEFA 4G09A 2XQVA 4UDNA 1G21A 1M1NA 2O1EA 4M7OA 2PS0A 1KAHA 4B8YA 4OXRA 3EIWA 4UTOA 2WI8A 3UJPA 1K0FA 2Q8QA 5I4KA
chains in the Genus database with same CATH superfamily
3P9SA 1JHAA 4GX5A 1XMVA 4JQZA 2HX1A 5FJJA 2NUBA 2VS1A 4LGMA 3OIDA 3TL6A 4AZ0A 4DQ0A 3VO9A 4WTOA 3AERB 4EAAA 4I5GA 3MPOA 3O74A 5CH8A 4IR7A 2P2CA 5M04A 2IDKA 4X60A 2AEFA 2XE4A 1LJLA 3BORA 4CLOA 5MDHA 4Z4EA 1Z12A 2CF6A 4JOQA 1I3NA 1I2DA 1C1XB 2B20A 2FOLA 3HUUA 3MMZA 3RTCA 3UWDA 5K4GA 1XKQA 2VH1A 3U9LA 5E4JA 3V7FA 2AI2A 2Q6IA 2BKLA 4UOZA 2ZJ6A 2QUIA 4AAYA 1OF1A 1UJMA 4B6QA 4BYMA 1CKEA 3KK0A 3ZZNA 2UZ0A 3IAAA 3ZQ4A 4XEUA 2AV6A 3LP8A 1B1CA 3GA7A 1JTEA 3LC7O 4U2FA 4Y2GA 5A3VA 4GPIB 4DDWA 2DTEA 3IO3A 3UA4A 2JEZA 4C29A 2VCYA 1WJGA 3ZXYA 4DLBA 3QE0A 1A96A 4ISBA 2P90A 4RQUA 2GSWA 2JAPA 4IIJB 1IMJA 2R1UA 2A3NA 1KFCB 5KPDA 4MV1A 1P6XA 3ELUA 3DHNA 5LKAA 4EB3A 1FW8A 1ENOA 1W87A 4K9MA 4BEJA 4EPTA 3PX7A 4DSOA 1S8FA 2C29D 3P9PA 4ILKA 4JC5A 4OYLA 4RIHA 2FJUA 4EHLA 2VH2A 4EJ6A 3HDTA 4MQ6A 5JVDA 2DB3A 3Q85A 3P2MA 1ZUNA 5IJXA 4XIIA 4F2PA 1XQ1A 3T5BA 3T5MA 1GRCA 1AQJA 4Z7OB 3PDHA 2CBGA 3EA4A 2H8KA 3I9MA 4E5PA 1EZ4A 2FF5A 3ND9A 4E1AA 3WNCA 4GHWA 2JJ1D 1D9XA 1P1IA 1VCMA 2GK3A 2VJOA 5LUBA 3EX7C 4AKHA 2H4YA 3OZRA 4Q24A 2NPFA 1NUQA 4Z4HA 1EXNA 3DMTA 4P3KA 3UXEA 2HFJA 5HKKA 1AQYA 1TM5E 4X1IB 5KSOA 4CQNA 1MXHA 2IYUA 2JAXA 3NUZA 3I2GA 3MEQA 3QLTA 3ZY4A 1OQAA 1U8ZA 2RBGA 4ZOLF 5IX8A 2A33A 2OCGA 5AKKA 3HU2A 1SUIA 5M34A 5CDGA 4B73A 1MB4A 4ZI3A 3BXXA 2D3WA 2IYEA 2PSHA 2PR2A 3K8ZA 1JLHA 1A9QA 3KQOA 5AH0A 5FLEX 5KSZA 2E9SA 4FCTA 3LT1A 3COJA 1O6CA 3SYTA 4DMGA 4BC0A 1IY0A 2JGMA 4CM1A 1SVWA 3NHJA 4CMIA 5CYGA 4DAOA 5JIBA 2I7TA 3ZD8A 4C0SA 3ESXA 3T52A 1J23A 3KEMA 2ZREA 3S29A 2PE5A 3C48A 3DYIA 2AB0A 2Q0QA 1DAFA 2O4UX 4HQFA 5JATA 4XWOA 4JT2A 4P31A 1COWA 5AKXA 1EB9A 2IPMA 4RAOA 4LQDA 4BO9A 4X6UA 2G71A 1RCFA 1ABBA 1NWCA 3Q3IA 1MFPA 3VR0A 2G9UA 4L95C 1G7TA 4XWWA 2NUAB 4M46A 2H51A 2O2CA 2Y4NA 3OESA 3O2QB 1D7AA 4LECA 2D8MA 3DQPA 2WAXA 2GXSA 3L79A 1GGKA 4F6RA 5CXUA 2QSUA 2ZRKA 2BFCA 3KB8A 3KKNA 4P8RA 4HNHA 4Y6GB 2BEKA 1CIPA 1OB2A 1D1SA 5KX5F 1D2AA 4O5AA 4YMWA 1IU9A 1FXWF 1P1JA 3GF4A 3I5XA 4J4TA 2GB4A 2Q5FA 3QMWA 1Y3FE 3H8SA 3N2YA 3OQPA 5D6NA 2XJ9A 4WA7A 5IWAB 5EESA 3VNBA 5JZOA 3VJKA 4B8WA 3ROXA 1KRHA 1RKBA 1XDBA 1J5XA 5H8WA 4CEJB 1ZCBA 3L8DA 2ZRJA 2ZIZA 4AUNA 3T7IA 3THSA 3O8DA 4FIDA 2ZJ1A 3OLCX 3OPMA 3L84A 3HBNA 1U1IA 3O4IA 4I4NA 3A2LA 3NC4A 2O4CA 4PWYA 4ZVNA 4CIYA 3QOFA 1EUDA 1PX2A 1X86B 2PZEA 4MWOA 3RVJA 3U44A 4JBLA 1WEKA 2BP7A 1CJUC 1FP4A 1ZAKA 3FRJA 1K6JA 2XZOA 4KO4S 4DB2A 4LXIA 1KKLA 2PT5A 2A3RA 2PBRA 4OHUA 1PK9A 5BWMA 3R9WA 3AVYA 4L74A 2B4TO 1YDEA 1CC1S 2XDAA 4IHJF 4QA9A 4G1UC 1TM4E 4HWPA 3TLAA 1XP5A 1RAHA 3MAAC 4ZHQB 2Y1WA 1IJFA 1EXDA 4W1PA 1VPTA 3R6TA 2E4XA 2VK4A 4PFQA 4TV9A 2SICE 2X1MA 1KJZA 4WLEA 5JWRA 4LFBB 1LPAB 1U3UA 4AVYA 4KDRA 5DXAA 3PDWA 4C03A 1MT3A 3I2JA 1ZGGA 2Q6LA 4B8ZA 1Q57A 1ICEA 1KPIA 1WCXA 4PS1A 3QP9A 4PX3A 5EGSA 1W75A 1XA3A 1W47A 2IXEA 4L22A 3H16A 2EJWA 2AD1A 3CRZA 4GMDA 1NKVA 4U2KA 3VZDA 3KTDA 2QDXA 1S2IA 1V9LA 5KS2A 4YMIA 3U7FB 3L7NA 5EI5A 4BNZA 3ORFA 4LOKA 2VPXA 5C5EA 4GWLA 5EQFA 3OSUA 3O5AA 4JHLA 1RZVA 2Q1WA 5A06A 3G0HA 2OBBA 4DM4A 3ZI0A 3LOQA 4L16A 1ZK4A 3EC1A 1L9KA 3SE7A 1ULSA 1E64A 1SHKA 1V1MA 3MQFA 3SX0A 3ML1A 1GUDA 2FZLA 1MVNA 4QU5A 2DERA 3JZFA 1FXSA 3N0WA 3QYPA 5ENVA 3VO1A 2NAPA 1SOUA 2ZYDA 2WVAA 4AFNA 5EN4A 9ABPA 2XBMA 1YQ9A 4BRUA 3PFGA 4KVAA 3W34A 3GFPA 3EEBA 2QX9A 2LGJA 4GBMA 4K03A 5EHXA 2GF0A 3K0KA 1FYVA 3K8QA 5A7HA 4DWVA 3UGKA 1QOQB 3G5LA 2R11A 1N8KA 1H2RS 4QTZA 5H4HA 3U81A 1OMOA 4JWKA 3E03A 1THZA 2ZJFA 3L46A 1GU1A 5A5DA 1EMDA 2R1VA 3GARA 4DLUA 3T4EA 2M6RA 3V32A 3TG2A 5E2AA 1TW2A 2BGLA 1JG3A 2YZNA 1XNRB 5G0WA 5I7SA 3M1AA 1PZEA 1DP4A 3VPSA 4MRPA 3WK4A 4UTOA 3AQIA 3GYBA 5BN4A 2JL1A 2FZVA 4RV5A 4DMKA 4YCLA 3OZ7A 4HCJA 3C41J 3N75A 2PT6A 2E5WA 4TOIA 2O7SA 3DKIA 2Q5CA 3QVLA 4LHWA 5DWDA 3HR4A 2ZPUA 2PY6A 1JAHA 4JLPA 2K4MA 5JZSA 1XNQB 1QORA 3QV2A 4EEXA 4FU0A 2OBMA 1Y98A 3V1TC 1H6CA 2OGUA 4YDHB 1RXCA 4YRPA 4AJLA 3T1OA 2I7DA 4DUPA 2G28A 3VR4D 2W2KB 3P5BA 1YC2A 5BV1A 4XGRA 2BZGA 2H5EA 4UDOA 1B6RA 3M3PA 1NTOA 1S2OA 2GO7A 4UCXA 1Z0AA 3SNKA 1IQUA 1YV9A 3KUXA 3UICA 3ZU3A 4DW8A 4RH3A 1ISFA 3GG9A 4M87A 1G17A 3PUXA 3L8EA 1FFCA 2PD6A 3V3KA 2GD1O 3M0EA 4R2HA 3TFQA 4QJ4A 3SZLA 3EEYA 4F1KA 2MIIA 2ECQA 4G0PA 5H1YA 3W3AH 1Z06A 2WQ7A 2PQMA 3EBPA 1L8XA 2P9GA 1X6VA 4C0LA 1L6IA 3IEPA 4MW1A 4BVBA 1FTGA 1P19A 3RF6A 1N2CE 3VH4A 3DWFA 5JASA 1XAGA 2PL3A 2H7XA 3JZAA 4WERA 1XAIA 2VC2B 1UQUA 1BJRE 3F0TA 4FKMA 4MYDA 4Q16A 3SYKA 2PSEA 5JI3E 1G20B 1I2MA 4HJRA 4WGFA 4AS3A 3SBOA 5KTMA 3KG2A 1K7FB 3C70A 2LUOA 1ND5A 5E7QA 1W2WB 1DAGA 5ALEA 1Y8ZA 2RGCA 3L41A 4RCVA 4D8YA 1LLDA 3TTYA 3G7NA 5I4CA 1I01A 1L5YA 3CNBA 1T10A 1QO0D 1XDZA 4C5AA 2J07A 2QNRA 4HGNA 2JH9A 3CRVA 4QUBA 3NM4A 4UEOA 5BOSB 1CS0A 1QC5B 2OQ2A 2GN8A 3S8EA 1IBRA 2OD7A 3GD7A 3O1JC 1SBZA 2AYXA 4PNPA 5CITA 1KO5A 2ZIVB 3E0XA 4G01B 1E5TA 4GGPA 1QAQA 2H57A 2I4TA 1TCAA 3JCZA 5G40A 1R0RE 3RREA 5B2ZA 2VK2A 3Q8MA 2ORYA 3EXG2 4O29A 3OTOB 4P2GA 3K70C 2PRSA 1GVNB 1U80A 4CM7A 3OFVA 1YONA 2FSUA 1I7SB 1XHFA 4UU7A 1RPNA 3VSDA 1Q7CA 1KOJA 2HJSA 2ZT7A 3NWEA 3OLZA 2WT4A 1EX9A 1GUYA 4AF6A 3L4EA 4YH1A 4QYMA 2C92A 1Z38A 2QLLA 1PTJC 1V1RB 4LXGA 4BV2A 4C9BA 2FRVA 1J2RA 4ZEMA 5JDIC 4B43A 3OZDA 5FLYA 3O4HA 1GCAA 5BV7A 3EZ2A 4HVAA 5F1YA 1EINA 1GPMA 3DPUA 2OLKA 1GFWA 3D1VA 2P3QA 3AZPA 4LK2A 1E9RA 3OY7A 1IYZA 4CG3A 4N3NA 2DPXA 1PDWA 4GOXA 1CZHA 4EW3A 4ZV4A 2J9ZB 1Z35A 2NU7B 1VJDA 3MWKA 1E2MA 5T8KA 1V5GA 2G9RA 3UB3A 4NU6A 4CLRA 2AJLI 2IXBA 2P6UA 3MLEA 4JJFA 1RBZA 3IEVA 3R74A 2FPPA 4X1KB 1C3OA 3H9EO 1RAGA 1VL8A 4LTNA 4C08A 1OH7A 3TZ6A 4MUGA 3LK7A 1BXRB 2VK8A 3GD5A 3IQIX 1KAGA 2QRHA 3QF4B 4PVCA 4Y2PA 1GPBA 3OBBA 1BKSB 4KQWA 3EIWA 1UAYA 5CK5A 3ZKWB 4EY7A 2L17A 4KL8S 4PNEA 2D4HA 4LJ8A 3R7DA 4X3PA 1EI9A 4XM0A 4EWLA 3BS4A 5CA1B 1LI4A 3HU5A 5AJYA 4AD8A 1PD0A 4N49A 1UJ6A 3SY8A 2AUTA 2DR2A 1TPZA 3SD7A 1GFSA 1FL9A 2J09A 3E1KA 3A4LA 3WYDA 1KSHA 4AZTA 2YH2A 4CM9A 2WW8A 4DIKA 2Q49A 4GEGA 4LY3A 1KS9A 2MMGA 4MWBA 5NULA 2HQOA 4GF5A 3KALA 3SSNA 2ZCVA 4H6VA 2FSFA 2OCYC 3OEYA 2AJDA 1K5HA 2CJFA 4R1LA 1GM5A 2ZTMA 5F9MA 4UVEA 2GVDC 1LPSA 1ZJZA 2NZJA 2IV2X 2DR3A 3ESQA 5LYJA 1BDBA 1S8OA 4KQ6A 4LMAA 1DCTA 1TQ4A 3IUPA 4OFXA 3MIZA 4IIFA 2ODBA 4M99A 3L49A 5ESRA 1DAOA 2IHZA 1LK7A 2ODPA 3HBLA 2OXTA 4MCHA 2C3YA 4P86A 1A4IA 2RKOA 1NVTA 4OU4A 1GTSA 2OR3A 1XQXA 3OE1A 3GDWA 5LR6A 3AZQA 1X9GA 5HCUA 1N1GA 4GBED 4CBVA 4LKRA 3GLTA 1VPLA 2X23A 3OIWA 3PWKA 4FJ0A 1T3HA 3O03A 4FW9A 2IYXA 4MWSA 1VBFA 2XH8A 1OX4B 1C30B 1SC6A 3LXXA 4MR8B 5BUZA 4CCYA 4FD2A 1N9GB 2A94A 1AF4A 4RO0A 3N5CA 1R50A 4ZZ1A 3R0IA 4M2LA 4BCCA 1QXSA 1XJ0A 3VO8A 1TEZA 1VYHA 1UBMS 2V7QD 4B09A 5KTSA 3TQFA 2NU9B 5EHQA 5HF9A 5I7VA 3GT0A 5JRDS 4M1OA 5LM3A 4ZYUA 4IUDS 5L51A 1AXRA 1QLJA 3C45A 4Y3UA 1W85A 5FPQA 4C22A 3FKSA 3I6BA 3PNSA 5EE1A 4H0NA 4EFLA 3VPDA 5B1SA 2V6JA 1GFIA 2ZBUA 3O4RA 5KDDA 5DTJA 3V7WA 5J5AA 1YJBA 3ESZA 1BYIA 3LVRE 4O2BF 2HWYA 1VM6A 3OX1A 4GZ3A 2R6CA 5E2IA 1PVDA 1VQ1A 3OJLA 1E8DA 4M55A 2BFFA 4C0AC 4QXRA 4DR1B 5ADVA 1K8XB 4QTXA 3VISA 1DUVG 3OBIA 3VI4B 2VF2A 2YWFA 4GX0A 3D1JA 4WLVA 5ENZA 1KVTA 1NVKA 3QPUA 4FR2A 2HCFA 5D3QA 3MLAA 1IPEA 2W8BB 5E8RA 1CD5A 3U3OA 1E7QA 2WTUA 1FVXA 1T0HB 2RIPA 4TV8F 3WGYA 3LGAA 4MX8A 4YCDA 1DL5A 1TF2A 1S9DA 2OPHA 3S1AA 1J42A 4U5XA 1WDMA 3D64A 3ZCVA 1V3TA 4Z54A 4QREA 2DFKB 4F1WA 3KYJB 3SEQA 3THYA 4OXIA 3P0JA 2DMRA 1GR0A 1J33A 2ROQA 1GKYA 3R9XB 5T4EA 3GR6A 2A59A 2HJ9A 3Q3VA 4H1UA 4XGNA 5D86A 4AKEA 4F4JA 4Q1AA 5HWSA 3Q12A 4UEKA 5JAPA 2XB8A 3QV1A 1ZCAA 2WMDA 1JG1A 3WS7A 4EVQA 5HX7A 1KFEB 3AMVA 3T3NA 2GZ1A 2JA1A 1G21A 3PQ7A 4OQYA 4N3GA 1V39A 2XCQA 1IBSA 1Z4JA 2WHQA 3GLFA 3PGXA 3RYIB 1L1EA 3VSBA 1YFKA 5KQPA 4CHGA 2B8NA 2ILTA 2YDYA 1LRLA 2OHOA 1N4AA 2ZYVX 4K6FA 3EHDA 3KT3A 4F11A 5KNDA 2ZJBA 3HXTA 1PQ4A 1XMJA 1MHPA 4MPRA 4XSVA 3SFTA 3F6BX 4W1SA 4ZQFA 2XUDA 4OHKA 1ULUA 5F2OA 3KQKA 2PLWA 4G5SA 3AESB 3WJAA 4EF6A 2GEKA 3L7OA 4WFKA 1V6SA 1TU4A 2BEJA 1FEZA 3IALA 3TNYA 1B41A 1B0ZA 1U0SY 1Y0BA 1O5IA 2EW2A 3D6UA 3MMPA 2R6GA 2Y0EA 1VSBA 3EQ7A 2BGIA 3N86A 4GR9A 3V2UA 3VZSA 1RZRA 3RJMA 2CK3D 1U8CB 1GTJ1 1NF8A 1XLWA 4R0MA 4LRXA 7REQA 4HXYA 3RTDA 1FY2A 1FFHA 1G98A 3ZVMA 2H2WA 5ERGB 1G42A 3NP9A 3KBBA 4P33A 1U0TA 4E46A 3FWHA 4E94A 1M1ZA 1P2GA 4RIEA 3CVYA 1IONA 2HJVA 1SZJG 2Y93A 5IPFA 1IN5A 1WUYA 2B5OA 2RGDA 5LZ9A 2ZB3A 1DRVA 3CF0A 3FPHA 1DBRA 3CVOA 3J81A 3W2EA 5GGXA 1YFJA 4C2AA 3V8MA 3AIIA 3N2GA 3CSSA 1MTZA 5E1BA 1NNSA 4A8HA 1L7PA 5ER9A 3OZXA 1USUA 4I4TB 3BCUA 2CL0X 3IAHA 3U1TA 2OECA 4B0PA 4MQEB 1KR2A 4PIVA 1ETUA 1P3DA 4EECA 3TNFA 3NU1A 1LGYA 5F7XA 2KQUA 4UDYX 4DLYA 2HSJA 2QA5A 4GBGA 1WABA 1YVPA 1GAEO 5FBLB 4EELA 3SS7X 5KYYA 3KNZA 3P1JA 3WRYA 4AO7A 4H3KB 3TMAA 3RAJA 3OQNA 2RC5A 3WA7A 4ZTZB 2J32A 5DTQA 5LDGA 4D3ZA 1BO6A 1NDUA 3HZOA 4BTVA 1R0BA 2WR8A 1EVKA 3OQIA 1GIAA 1Q0QA 2C0QA 2CC2A 4G1EB 4JWTA 3U4MA 4HXFB 1JDSA 1K9SA 2GHRA 2Q27A 3M6IA 5CDSA 4YAGA 1LNQA 1WSDA 2XHEA 2VT3A 2XYQA 2QGFA 3MOGA 4Q37A 3HMQA 2JLBA 3WKDA 1LA2A 3TUZC 2DPHA 3FNGA 1JQEA 4BZZA 1NJ6A 1UP6A 4WOKA 3UPDA 4QM6A 3A27A 1BD3A 1RAIA 5T57A 1N7JA 4RD2A 1GUFA 1K7XB 2OHFA 3ASUA 2Z8XA 2BFPA 4Y2YA 1W8DA 4MYCA 5GV7A 3Q8LA 1J70A 2PMCA 3CLTD 1TK3A 1YE5A 1XDSA 3T0GA 3UC9A 3OIVA 3EA0A 1E3WB 2H11A 4H1HA 1Z26A 3DFKA 4AO8A 1FFXB 3FJOA 2IDMA 16PKA 2O2SA 1CW2B 1ZQ1A 2Q9AA 3R24A 2GTPA 1MW9X 2V54A 1YA6A 3LUGA 4L3WA 2WMNB 5JJCA 2O57A 2VTBA 2Z09A 3WB2A 2HSDA 1WM1A 4RHXA 4LRWA 3OCXA 4MUYA 1KFKB 3T9EA 1B1AA 5ESWA 2I2CA 2JGFA 4TVKA 3KR9A 1PR3A 1JR3D 1REQA 2JIOA 1H2EA 1HMPA 3NEAA 4TRJA 4G84A 4CIBA 3GMDA 4RZSA 2FYTA 4HBGA 5T4FA 3H2YA 3R7AA 3TQRA 4HNQA 1SM4A 3MXOA 5KVQA 5I6DA 5BN3B 3UCEA 3HXOA 4YQFA 4HDRB 1Z8DA 2VQSA 5LP6C 2FSVA 4WV3A 1OWMA 1NVEA 1TFRA 2QXUA 4MKIA 7GPBA 4GKJB 3DD5A 1K8ZB 2C4TA 5DHFA 3FSRA 2Q45A 1FPQA 2D54A 2QX8A 3QU4A 5B1DA 5HMMA 4FINA 5B3JA 4O4LF 1GL7A 1YRAA 2N42A 4NABA 2IWRA 2H52A 4MAFA 1AO0A 2JB9A 2OV1A 2PIAA 2ZYUX 1OLUA 4NLLA 4PZDA 5JQGB 2FR8A 2OOKA 3COZA 3VQTA 1UIMA 4I55B 3JYHA 1X7WB 4FYXA 3ZZMA 1C7ZA 2QVXX 3F7OA 4B9EA 1FMCA 2OO7A 3GT3A 2OXEA 3DUWA 1A97A 2C7GA 2CHEA 3JWJA 3LO8A 3TYXA 4FYMA 5KTPA 3D31A 1Z33A 2DZDA 4ZGGA 3QFCA 1MP0A 2WE8A 2X8LA 2Q50A 1NKSA 3G2NA 2GHQA 3T9DA 1YRHA 3N9IA 2WYWA 4JYBA 4Q3EA 4WN9B 4ZI5A 1CZRA 3U9TA 3HO6A 2FEWB 5ALYA 1C9KA 1WZUA 3L8MA 1IXYA 1Z29A 2QJWA 3G6KA 3QGMA 1B6TA 4PV7A 5JZBA 2I87A 4IQ0A 3ZVNA 1CP2A 1KPGA 5IYZA 1YDHA 4JI0B 4LQLA 2ZTLA 1P1BA 3K9NA 4PTYA 1OE0A 1L5SA 2O05A 1K3FA 3RM3A 4N3CA 1UDWA 1GZVA 1VKNA 2GH1A 3BULA 1QB8A 1OYWA 3HJHA 1NBMA 1T0PA 2PX2A 1J6UA 2BJHA 4DYVA 3G8CA 3P2YA 4ESHA 4B3TB 3JVVA 1O8CA 1U31A 1VA4A 4BX9A 3PQDA 3MWEA 5KC9A 1JBKA 1E58A 1LX6A 4OMDA 3IIMA 1J7JA 4DUYB 5HG0A 1HYQA 3AH8A 2ZKLA 1O95A 4FYPA 2EKDA 1YL7A 3CT4A 4RK6A 5DO9A 5IM4A 5EJEA 3HV0A 2JASA 2FX3A 5JRZA 4ZAVA 1GPH1 2IY9A 2H7YA 2OE2A 2HN9A 4KCGA 3O3OB 3GQBB 5CHEA 3FTFA 1G8HA 3IDFA 4RHUA 4O2AF 1W581 2Q0XA 2WNHA 4K0RA 4WZAA 4F9EA 3O91A 4BP8A 3ESDA 1LPPA 4KN5A 3UJNA 1E6EA 2CNBA 3ZYCA 1ENPA 2NIPA 3F98A 4LTMA 1P31A 4PC2A 4Q3OA 1EIZA 3S55A 4RSGA 1SQ0A 4JLVA 1IMOA 3C1AA 3KT8A 4DQDA 1FRZA 1PEKE 1UZNA 3HDVA 1T91A 3G0GA 3OQOA 2ZWVA 5J58A 2ASEA 3N28A 1ADBA 2PH1A 4X84A 3FVWA 4EY4A 1ZVJA 3Q1LA 1Y4DE 4WY2A 3F67A 5UKDA 3B60A 3OETA 2E85A 3LKDA 3HB5X 1NXSA 1QQBA 1SVSA 3T5DA 1KJIA 1XZAA 2W00A 3HXMA 1QZTA 2OORA 1R2QA 3MUOA 5GZ3A 2CVPA 2PK3A 1AS2A 3FUVA 1QH8B 4FSXA 3TZHA 4TT8A 5IG2A 2D5CA 2R44A 3DV2A 1TMGE 4CM5A 1QWSA 5EG5A 5TIIA 3DEIA 3DOIA 5ADWA 3CPJB 5CJJA 3UAWA 4YJDA 4GKKB 4AKGA 4GE0A 4I8DA 4L85A 4PFKA 2ZZNA 2JFYA 1JDBC 3UMSA 3OUTA 2HNKA 1YS9A 4EVRA 4FYHA 4ND8A 2OOSA 4KVFA 1RPAA 1I30A 3AX6A 2ZR9A 1Z56C 5JH7F 1NRXA 1QHIA 4GZMA 2OCAA 3E3AA 3RTAA 4KITB 4MWDA 1YS4A 3ILSA 1DG1G 4IXNA 1R27A 4K9DA 4TMKA 4FWTA 2GOYA 3Q6NA 4DBLE 2FMIA 4P0QB 1WMBA 3O8OB 5ELLA 3NHMA 4CKWA 4K7JA 10MHA 1Y3DE 4HWTA 5AOVA 2GAOA 3DE7X 1Z2PX 4P22A 3ZW7A 4LHEA 2Q3DA 2GSDA 1ND6A 2YRFA 3VV3A 2H5LA 2GBLC 2CHVA 4H7IA 2YXLA 5KJ6A 4I6GA 1A2BA 2CGEA 3HKCA 3R3HA 3NCTA 4GLJA 3P0IA 1I7PA 1YHZA 3MCAA 2DAPA 2IOFK 2REQB 3QEKA 3S8MA 3OM9A 1V35A 2YXEA 1PL8A 4G0XA 3QXJA 2NW6A 2OKCA 3RYHB 4IWXA 5FDFA 1BQEA 4FUTA 2FPIA 5KNCD 4IGAA 3WB1A 4TS3A 1GXSB 1NURA 2QRVA 5JAIA 1JPJA 2ACEA 3FETA 3Q88A 1JEOA 1RFLA 2DWPA 4R1NA 3TMYA 1BN7A 5FPYA 4G8BA 4WCFC 5JC1A 1BW9B 1JECA 1VYTA 3JATA 5DBHX 1N33B 4JELA 3PCRB 2GEDA 3EN0A 4C5CA 1S4MA 3BRSA 5JCXA 1V1JA 4HFJA 4CTOA 4G4JA 2IVFA 4JDUA 2E82A 2WHPB 3T1TA 4Q7JB 5EIOA 2CDNA 1WKVA 5IWCA 2C88A 4QGGA 5KVVA 4GLLA 1T35A 3UWPA 4BNYA 4N40A 4EZEA 3UMRA 4UMVA 3EXIA 1JFVA 3BPSA 2QN9A 1AGRA 2FW0A 1M1UA 3O3CA 3VMFA 1HE5A 1V16A 2WU3A 1NSFA 2YRWA 4EJMA 1VJGA 1VJ0A 2R1TA 1DU4A 1GEEA 3BC1A 4MB2A 5EKSA 4BFZA 1FUUA 3FA2A 1EK6A 1F1JA 2PCJA 3FSGA 3IMFA 3LOUA 1V8FA 3LPLA 3RVBA 1N2XA 4PQRA 1WNFA 3MRVA 4RKYA 3D7LA 2JCXA 3BSFA 2RGYA 1HTBA 5IULC 1NIPA 5B1YA 3OUUA 2BF4A 3BX1A 1CQPA 5DI3B 4G4IA 4Z9YA 1E2KA 1HFEL 4PONA 4OOEA 2WDZA 1PV4A 1Z7YA 3EF1A 3KU1A 2MHCA 1RYDA 1GA6A 3OEHD 3IQEA 3K9CA 1AKVA 3BT7A 3JD2A 4LCJA 4BIIA 4PCVA 2CSXA 2IYRA 2W9XA 2XMQA 3H7AA 1RQPA 4FFDA 3DBHA 3IVMA 3H6KA 3RS7A 3NHAA 4L9RA 5EWLA 1PN3A 2C2HA 2FEOA 2VWQA 4GLOA 1VMIA 2Z04A 1CVLA 3O2JA 1KI3A 2ZI6A 2O52A 3KJGA 5JAUA 3BXHA 3OMLA 1RYMA 2HF2A 4UD6A 4KR2A 2WIFA 4HLUC 1PK8A 1LPMA 3CWZA 1N3IA 3EWNA 4Z8YA 3PUWA 1ZLYA 1YHYA 2AXEA 1RW4A 2ZQYA 3I9NA 2FH5B 1PJ8A 4TQ9A 5E1MA 2VYQA 3RSSA 1M8FA 5IJ0B 1YB5A 1KE2A 1C7RA 5JD4A 4C0JA 2R4UA 3HZHA 2YCBA 1UK7A 1WV0A 1ZH0A 2E3JA 2AG1A 1KQNA 1QGUA 3T61A 3TQOA 3IAUA 4C0WA 2E6KA 4N01A 3EVGA 1SK8A 1VZ2A 5ECYA 3F3KA 2D2XA 5ANRB 1QK3A 2OWEA 1NXQA 4P98A 3O38A 5EYPA 4EG8A 1FFYA 3W2GA 1JHMA 2AH5A 3NYIA 3EY4A 4O4HA 4JEUA 4TKUA 3EPLA 1L5VA 1IY8A 4KQ1A 3KT6A 3RC7A 1V25A 2PX6A 3D02A 3SZRA 3VR6H 2GN9A 1XC7A 3AKCA 1UXOA 3HSSA 3GY0A 2FWIA 1SFRA 3AUSA 3EGXB 2OQRA 2WIKA 3H11A 4L3VA 4Y0AA 4ALNA 1NBOA 4BYGA 4C3VA 3ZLVA 1C0EA 1Y7IA 4INJA 4REQB 2YL2A 1FRNA 3H5NA 1NHWA 1SQSA 3EUWA 4GWKA 4H7PA 5CA0A 1P4JA 3B82A 4QLAA 3ZHCA 3NBYC 2W43A 1QV9A 3ZE1B 1GG2A 1VMAA 1U1GA 1R4NA 2X2PA 5KYTA 3NV9A 3MTBA 1SOAA 1FNNA 2PWBA 4B31A 1QNFA 3QYJA 4Y30A 3WIUA 1UZMA 1MBZA 3LBNA 4UMDA 1E98A 3T8YA 5AI6A 1N92A 5M5BA 4ZTUB 4LF9B 4BGUA 4HDSB 2JI9A 1KF0A 3LKZA 4I3HA 1IB0A 3VR3D 3VUFA 4DGQA 2NOAA 3O8CA 4L7VA 4AJKA 3V9PA 5FLXA 2FMFA 3NT4A 1F6BA 3OU6A 4DXHA 3MIIA 5BYJA 2COKA 1XRJA 4TLAA 1W44A 3S4YA 4K0KB 2CXUA 1ODTC 1FDVA 2X0JA 3CSDA 4UOQA 2AL7A 4AG3A 1Z6AA 2IH4A 2HLPA 2LWIA 1W4AA 2Q2WA 2G1PA 3MTJA 2D5AA 2C3PA 5AM1A 4XD7A 2O1WA 4ZVUA 4B81A 5DGDA 3IFSA 3WXBA 3O2SB 4LZAA 2HWUA 1HE3A 4KDCA 3RFXA 4DZRA 3BKWA 4NBRA 1KTVA 3THWA 1NBWB 2PXAA 1Q20A 2UYHA 4FGSA 2OILA 4OQQA 2JIBA 1W0JD 2VJYA 4CQMB 4EHKA 1S01A 2ZAMA 3IKLA 4ZT5A 3BWCA 3LL4A 3VOAA 4W5TA 2PO7A 3VU0A 3W6PA 2WSBA 3RAGA 1YL5A 3HCRA 2PUEA 3GUUA 2X3YA 2P62A 2JJYA 3UQYS 1HQKA 3TPZA 3WNQA 3RGGA 2J6HA 2B2XA 2BTQA 3AB7A 3IRVA 3STWA 4HLNA 4YMVA 3EW9A 5J4HA 3GRCA 2B4YA 3CB2A 3PICA 2QR3A 2EHJA 4P35A 3QFRA 1Y7HA 1KDRA 4EJFA 1SC9A 3NBUA 4IRMA 3CUTA 1I7DA 3BBLA 3IS3A 2WU8A 1TQHA 1TLLA 4U02A 4QECA 3BGWA 2ZR0A 3JQDA 2P27A 4LRYA 4N6OA 4MR9A 4QOIA 5KYWB 4PO1A 4AWAA 4XPZA 4EDFA 4YJ2F 3JSXA 4EA7A 3PQ6A 5K0TA 1F0NA 1YBHA 1UC8A 2F9MA 1XX6A 3CKYA 3U4QB 5KX5B 1JVNA 1NUPA 2WJGA 2D5BA 3MINB 2BWJA 5JYBA 1QRSA 3GO4A 5K20A 2BGUA 3O90A 3T5CA 4JP5A 1EK2A 1FRFS 1OBFO 1BE6A 5BRJA 4BJ6A 2IOQA 4QDTA 4ZCPA 5M2QA 1SD5A 4DV6B 1GDTA 4CU2A 1BU5A 1TUEA 2ZSEA 4WZBE 3OG9A 2J9RA 4KQXA 3GLGE 1SIWA 5I3ZA 5KOJB 1KI6A 1HUQA 1QIIA 3UAOA 1TQ2A 3PNPA 4HYYA 4NHOA 2PUBA 1QVVA 1U7UA 1XL0A 1JKJB 2FPLA 1PCXA 2H9AA 4GX2A 3LUPA 4MW9A 5EP4A 3R8XA 3WLFA 3WLLA 4AG5A 4ES6A 1O77A 5HUQA 2J5RA 1HKUA 1I1QB 1K6MA 1Z39A 2VP9A 4PINA 5CNJA 3S40A 3UOAB 1TU0A 3GHHA 3IUBA 4E51A 1LWOA 4DWOA 3SVTA 3WBJA 2HY7A 3KYDB 2XB4A 3DEHA 1EWVA 2A0KA 5A6SA 1USKA 1XVIA 2PUVA 4H4DA 3K1TA 2G0TA 4IHJB 1KZYC 4E6PA 3OWOA 4QODA 2X15A 1OAOA 2PIDA 3HCOA 4RABA 4XX0A 3SICE 5BR7A 5L3QB 5ALKA 3BGOS 1A5ZA 3ERCA 1EUCB 4E2WA 4JMPA 3FPSA 4Q48A 3UT0A 5SZJA 3IHLA 2O1XA 4G25A 4B46A 2RHTA 4KUHA 1NQUA 3DBRA 4FUQA 3V4OA 5BUQA 3P96A 4LVCA 3C5WP 2JVJA 3KCNA 1P72A 4GM1A 1IZ8A 1HQYE 1C9EA 4MVJH 1E92A 1RP7A 1ELOA 4PPNA 4PW0A 1AUVA 4MEJA 2JJQA 2IEGA 4EB0A 2O2ZA 3F71A 3KTAB 3QQPA 4IDDA 2UUAB 2ZUTA 5TT1A 3ADDA 1ITZA 3TFOA 4HDQB 3ID6C 5FBQB 2AVDA 1P33A 4D7AA 4PICA 1I5EA 1MG0A 3C5HA 4KFSA 4LV5B 3IODA 3ELDA 1AS0A 1UL1X 1AA6A 2DFLA 3RT7A 2NNWB 3W5VA 5JSZB 3KYCB 1V8BA 3MAJA 4AS1A 3JAWA 2AFHA 3FCCA 3R5TA 5KYUA 1E0KA 4JQOA 4YB8A 5C3MA 2Z30A 2XHZA 3SR4A 5C52B 4TZ6A 3TZQA 3EDQA 5B6PA 5IZ4A 2PTHA 1NF2A 5A9SA 3WYCA 4KGXA 3S1LA 1OIVA 1CJCA 4GMFA 3DL2A 4GM4A 3RO7A 2C2GA 1AMNA 1V43A 2ARKA 4C6TB 1HNWB 4FZRA 4TUYA 4W6QA 1ZN7A 3CX3A 1BS2A 1VLVA 1XZEA 2AZMA 1A2QA 3K20A 4Q3DA 5AKEA 4CL0A 5K0CA 4RVGA 2IYPA 4X65B 4MUIA 2OA0A 3UAGA 2XJ4A 1N5OX 1HEUA 3EC2A 1UUFA 3TEFA 3LOPA 4IHAA 3NWOA 2QTWB 2OB2A 2PS0A 2V7EA 5AJUA 3K6JA 4CDNA 1HQCA 1MJFA 2A9JA 2CDAA 1SXPA 4PG7A 3WJ7A 3DSRA 1JG2A 5EZ6B 4BNVA 4JAVC 3SJBA 3OC0A 3HU1A 3PQ4A 1UCFA 3GEHA 4GPZA 3M5WA 2C3MA 2HO4A 2PVSA 4BMVA 1PKXA 4Z49A 4CQMD 2QF7A 2H1LA 4CV1A 3D6FA 1VA5A 2OV8A 2QAJA 4FS8A 1DPFA 4GOJA 4LNUA 3B38A 2IPOA 5B3KA 5IK2D 3E9CA 4CIAA 3JQAA 1XT6A 4J4HA 4I66A 1CEYA 3IA2A 4KR9A 2NO4A 4FK8A 5FWYA 4RF3A 2ZSAA 4RJLA 4K6HA 2OXCA 3B6KA 3AGPA 4PN7A 1EHYA 1Z0JA 3PB3A 4LWQA 5JAZA 4L4YA 1HYGA 3RYCB 2VT6A 5FI1B 3OQVA 3W8RA 3L1KA 4RVNA 4C21A 1B6GA 4E3WA 3V1LA 3ZD7A 1TKBA 4QU0A 5DXFA 1S02A 1CRWG 1SZDA 5FNVF 4RTLA 1VHTA 1TYDE 3GGPA 5F98A 3B9QA 1PJ4A 2CB0A 2OZLB 3D6JA 2KHZA 3I5MA 5IANA 1ZD1A 2CVFA 5CB4F 1DQNA 1SWVA 1LWNA 2WTAA 4PZUA 2A58A 2IYSA 2ZUEA 1H66A 3OCWA 4YAIA 3W5DA 4BFUA 3NALA 2Q6VA 1AUOA 1K27A 4KRYA 1LW7A 1Y1LA 3IQHX 3VJMA 3QX8A 1G3MA 1A8QA 4IVQA 4UJ5A 3QLUA 4BQRA 1W6UA 4IJVA 4JJAA 2DHEA 2GCPA 5EUQB 5CAEB 1P2VA 4PWZA 4AJ1A 3AEXA 3SJUA 3R7WB 1WTAA 2R7LA 4PX9A 3ESAA 1E2UA 4WECA 4ZOEA 1FBTA 4S04A 2WJAA 1R18A 3C8HA 5AW8A 2I5PO 1AXGA 4JENA 2JD1A 4LKOA 4HDNB 2HV8A 1EAYA 5CLGA 1I4WA 3FX2A 4J75A 2IH5A 3IILA 2R60A 3KDPA 2PV0A 3TNDA 1UWLA 3HP1A 4EI2A 1C41A 3OQMA 1F6DA 4U0JA 3V1NA 2W2VA 2CNLA 2JJ8A 3KFLA 1C29B 3O4GA 4D46A 3K6KA 5KWSA 4C0QC 3SVZA 3GCZA 4FNMA 4IMPA 3DLBA 3OU2A 5BMVB 4IUBS 4WBNF 5U4XA 1TGYA 3COWA 4BFCA 1GO2A 2X19A 2XA9A 4YCSA 3CO0S 2LRHA 2BFNA 2CNOA 1R0WA 3X1DA 3IEXA 4RVSA 2V96A 1FUKA 2VJDA 4MV9A 4JKYA 1PJRA 4L6IA 4MS3A 1KQFA 1C7EA 1J0DA 1K9VF 3JVUA 2R6HA 3MWLA 3N1UA 3W6NA 1URPA 4LVNA 4F21A 1SGWA 3N39C 5K8TA 3QOXA 4JBYA 5IJZA 1TQ8A 3R4CA 4OLHA 3JQQA 1YZNA 4JDPA 4MULA 3OFND 2JHFA 2RFLA 2EFGA 1ZMXA 4ZAZA 3S6JA 3PCTA 1KZ7B 3DB1A 1UPUA 5LPNA 1NYTA 5ALPA 5KYXB 5IC4A 1LS6A 2JFNA 4MK4A 3AV3A 3C3WA 1I6LA 1EXMA 2BRUA 2NV2B 5KU1A 4B84A 1IZ0A 3IJPA 4P3NA 4WN3A 4LF8B 2OBLA 2QIPA 4RKQA 3TZLA 1CJTC 4QBTA 1L7OA 4OHPA 1D2RA 2SKCA 2MU1A 4V1CB 2HHHB 1D1PA 3Q7SA 3VNVA 4LZLA 2Y1GA 4LJ5A 3TSZA 3O83A 1CQIA 2CHQA 1KY5A 3VZCA 1UM8A 1A1VA 3AP2A 1OFUA 4MJXA 1JVBA 2FCRA 1YB1A 2GF9A 3DJFA 5F78A 3K4QA 3W2HA 5DM4A 2Y27A 5LL6P 4LHSA 4UAGA 3FUUA 3QPBA 1I10A 3N0RA 2HA4A 4FMDF 1IOLA 4NNPA 4XIYA 4FHFA 3PD0A 2EOAA 3CNLA 4HQLA 5EZSA 3U7RA 4U0KA 1G2PA 5LXTF 2BSQA 3RU7A 2OV6A 3DVAB 5FV4A 5CX1A 2JK1A 1AZWA 2G5GX 3D8NA 4TLLB 2NU8A 2AWOA 1QGYA 1Z7BA 1PLLA 2ZULA 3LVQE 5DGTA 3RS0A 3H0CA 3NT2A 3MCUA 2LXNA 2DKOA 5B58C 4HS9A 2ACWA 2E2WA 2J7PD 4ITVA 1CY8A 3ZNPA 4GNRA 4KZPA 1TT5A 2HA3A 1C1DA 2IZ0A 4QQKA 2QVGA 1Q12A 4FXOA 1TMYA 2F1RA 4YRRA 1JJAA 1TZKA 1QO9A 5B7PA 1IHDA 2OCBA 3I2IA 3QXCA 4ZVVA 5B6JA 4IVRA 1MU0A 1ONSA 1R3UA 2XEXA 1PWHA 2CDRA 4XLLA 1KGDA 2BLNA 3C5VA 1X1CA 3D8RA 1BIFA 3TLYA 4FW8A 4ENQA 3MCVA 3D4NA 3HLTA 5EXXA 5HTKA 2MSNA 4COKA 2VNSA 1MQ9A 2BFBB 2ZU0C 4TYYA 1U3DA 3AGQA 4EDHA 4NEHB 3CW8X 3D81A 2FVXA 5DYNA 5HEKA 3KQSA 3RARA 1RXWA 4ZPJA 4JGGA 1BA3A 1E5XA 2G09A 4H7JA 4HVCA 1FIUA 1SNYA 3LXUX 1GPNA 4M36A 2X0DA 2G8LA 2BBWA 2H48A 3HGQA 1JJIA 3KOYA 3CE9A 4GAEA 4NVRA 3RSHA 2VG8A 4IIGA 5F51A 1QM5A 4J29A 3IDZA 2DUMA 2YBDA 2AW5A 4JEIA 2IKSA 3UMMA 3RRMA 4BDSA 2QD1A 5H02A 1TX4B 3B85A 3SEFA 3GGJA 3WGJA 4IY1A 3KJFA 1ZD3A 2BE9A 2V97A 3IA7A 4WNCA 1AA9A 1VGRA 2KLBA 1FFSA 3K73O 3I9LA 3TSAA 3FTQA 3GLRA 3BIFA 2G08A 1WY7A 4RNCA 4X20A 1OU0A 4HDOB 4F71A 2REXB 2YQ5A 2O8DA 1OU4A 1DCKA 2W4QA 3HXKA 5ALDA 4MWGA 2PZJA 2O54A 1QANA 1UFQA 5E9JA 1A9SA 1Y3IA 4RELA 3WMGA 4BNNA 3L4SO 4WK4B 1U02A 4HZUB 2WBLC 1R5NA 4FVTA 4M9ZA 1L5ZA 4C0KA 4NK4A 3KPUA 2BM1A 1OKKD 2ZAOA 2W6OA 3HG7A 3C15C 4FNAA 5A2QA 3BMNA 3LWDA 4L4SA 3RLFA 2V7TA 4M0PA 1PUXA 3E15A 4BIMA 5IT0A 4YJGB 3O1LA 5K6AA 2MCFA 5D1NA 2XA1A 1E59A 1R8YA 4IDEA 3GIWA 5BSKA 1JFSA 4QJBA 2XW6A 1IC6A 1G2OA 2GZAA 2I4NA 2CUKA 4GIBA 1KY4A 4Q4HA 3WLJA 1ZPDA 4JSYA 4AT1A 5HOQA 2P68A 2B3TA 1TXGA 2O8BB 1FP2A 3DXZA 2F3RA 1OV4A 2BKUA 4LPSA 5AM5A 3FB1A 5JAQA 4Y9SA 1VECA 2G6TA 1VZ3A 1NXTA 1NSTA 4NFSA 3H05A 1TYBE 3VU3A 5KREA 3G8YA 3E4CA 4QO8A 2YKGA 2ZBVA 4CG0A 2WKQA 4YASA 3QEBZ 1NC3A 2WA1A 1W35A 2C9BA 2CLKB 2IYOA 3JTMA 5TMDA 1BX0A 1RYHA 4K6KA 3SEZA 4C7KA 4JYMA 1V3VA 2DKNA 2JFWA 4ZU6X 3I4FA 1BE1A 1M6VA 4HB3A 4J7UA 2GEVA 2WSIA 3O2NA 2DM6A 4B3IA 3D3EA 4NXMB 5L3VA 3V8VA 4YP5A 4B4WA 3O6VA 4HQKA 4UTPA 3A2NA 1VL1A 2J9GA 2Z43A 3V1YA 1RHUA 3QPWA 1FOEB 1RHRA 3PKJA 4GLBA 1TO1E 5BWOA 2WFAA 4U00A 5HQ3B 3JQ7A 3MUNA 4RE6A 5AXAA 2E5LB 3FNIA 3QIAA 2CXQA 3H9GA 1QFMA 4P3PA 1LU9A 1M0WA 1P74A 3L6RA 2VHCA 2PS1A 2W42A 3CU5A 4QUHA 1YZLA 3PC8A 3PPYA 2M2IA 4IF6A 4R1OA 2W2QA 4F97A 5HNKA 1YA8A 4NPHA 4V0KA 3DZBA 2XRMA 2JFGA 5L4SA 4G1VA 4ZVMA 2V9CA 1Z4MA 2P9HA 3RC1A 4DV7B 3ZJTA 1EJ0A 2BD0A 2IF2A 4J76A 5BNWA 1Y3BE 4M8SA 1JAXA 4LGYA 2A1TS 4WKGA 4L75A 3U62A 4BFYA 1ANKA 3CW9A 1YJQA 4AZSA 3A4YA 4KDEA 4RA6B 3DULA 2DHRA 2ZE7A 1WA5A 2I9KA 2YRXA 2BBOA 3UO8B 1LNSA 2F62A 1U11A 1Q0PA 3FBTA 3X1ZA 1FMFA 3A04A 3HVHA 3WYGA 1D4ZA 1OWNA 1W4BA 2HBRA 1X1BA 1YZTA 1ZOOA 3N2KB 4P53A 2QE7D 2QY6A 4LY0A 4XLZA 4XR4A 1VRVA 2CXRA 3JQ8B 1LFDB 1LC3A 4PY2A 2Y1KA 2WYHA 4CMKA 2B8EA 1WCWA 1Z5PA 2G5CA 3DDUA 3FBGA 4QVGA 1KS2A 2JAOA 2NUPA 3PUJA 4KOEC 4B6RA 3DP9A 1CR1A 3GJQA 4ENRA 2RHGB 3ANLA 4YP6A 5AO9A 2OCDA 4PLWA 1XJWA 4DCTA 2Z0MA 1USWA 2FPKA 4NK5A 4V38A 1LPOA 4ZRNA 2OTCA 4R8LA 4UZEA 3V46A 1SU4A 1K3TA 1DADA 3A37A 5JG7A 4QBHA 1IHXA 1Z45A 2W6IA 3WDSA 3FOZA 2ZFUA 4NZZA 2ZDGA 5CFZA 3O3NB 1RYBA 1P5JA 5IT4A 4D56A 3OD1A 3HNOA 4I1SA 1Z5WA 1HFKA 5HFJA 4BLQA 4YLYA 1LDNA 5LZ7A 3S2GA 4X8LA 3U7QB 1TJYA 5T8KC 1KK0A 2Q3EA 2XLCA 3FWNA 3UJ7A 1AX9A 2GRAA 1RXVA 5BVHB 4J2HA 4F92B 3SC3A 1MMFB 4ADSG 1RRFA 1D1TA 5G1NA 1KVQA 3QX9A 4HGQA 2C57A 2Q7DA 1EX7A 2WYOA 3TIFA 4DLRA 3FPLA 1XELA 2PRKA 2YHIB 2IOYA 4IAOA 4P5EA 3MWJA 4HB0A 4ZQBA 1YC5A 1DQSA 3DDZX 5K3FA 1RRCA 3NHYA 2Q3HA 3KFXA 3LUJA 3VHQA 3WK7A 2F7SA 5C0OE 4UTNA 1DTSA 3JW8A 1YOVA 3CZ5A 1D2GA 1Z7GA 4YAFA 5TT0A 3I5AA 1GQYA 4E21A 4RBNA 4PZCA 2QB5A 1YMUA 3A6JA 5GVRA 3I9FA 4G89A 3Q72A 3AVTA 3H2SA 3VPBA 1G19A 1V2GA 3ZHVA 5D2CA 1HLFA 1UWVA 2Q5IA 4H08A 1ZM3A 3F5DA 5DLDA 4EA6A 2YY7A 4DLXA 3OPNA 3IPLA 3SLGA 4OUDB 1UBRS 1XQ6A 4D42A 1P2TA 2NVWA 4F45A 4QEDA 4NOMA 2JANA 5IKEA 4JI4B 5CVVA 3CWCA 3GEMA 2C42A 1VE7A 2GZSA 1N2CB 4MKHA 4XI9A 4KMMA 5JROA 3NANA 4MNTA 1S8NA 2ONCA 4I4LA 4DHWA 5ICGA 2HR1A 3CEPB 2A4MA 3L8CA 2C9CA 5AQEA 1L5KA 5D5PA 1Z8HA 1AKUA 1P75A 3F46A 2O0JA 2Z2IA 4NL4H 4L8VA 3RUAA 1KEEA 5CT9A 2H31A 1DGQA 3AJ8A 1VBNA 3HSYA 2CFCA 1NVVQ 5EE5B 1JQLB 5JO0A 1L7NA 3HB1A 5G0VA 1AKQA 5BSUA 4OJTA 1W30A 1Z13A 2VHTA 3I9OA 3WA6A 1TKAA 1UF9A 4GOMD 3SZOA 2MINA 4F4UA 3U5TA 3T4PA 4N48A 3P19A 4MW5A 1G59A 1Q0UA 4LYFA 2J0VA 2MYUA 3MWDA 4MS1B 5I7HA 2ZE8A 5DRTA 2EV9A 5TQVA 3UBTA 1E94E 2XQKA 3ITEA 3N6VA 5KNBA 1PJAA 1KI8A 3FFWA 1T9CA 2FNAA 3MLBA 1Y1SA 2PJUA 4H6PA 2K5UA 1KYWA 2Q62A 2X3UA 3O95A 4BXOB 5GM2A 1M1NB 3F74A 3CLUC 4NNOA 2NNLD 1MAHA 3L02A 4K9QA 3G1WA 4X97A 2YNMA 1ZONA 3GBPA 1IUKA 5EE9A 4BQQA 3WO1A 2FMTA 2QX6A 2EEPA 3CFYA 2JZCA 3LXMA 4LCBA 2VSOA 2FN7A 3QKTA 2WYIA 3V97A 1WZCA 1N6LA 1SXJE 1HDZA 3ZXSA 5EL0A 4CFSA 5AUPB 3WL7A 1O96A 5CPFA 2DU8A 4KUGA 1LZLA 4KLZA 1BQ4A 4XB6B 4HXGA 5B1IA 2Q9BA 4KO1S 3GI1A 2OAGA 4DDHA 4IJ6A 2VPPA 4WNIA 1NOIA 2ISCA 1UBLS 2EJTA 2ZRMA 4LUCA 5JZVA 1G5RA 4RTSA 3VKHA 3LFHA 4B83A 3L6EA 2CBZA 3IT2A 4NIMA 1L3IA 1NE2A 3V2IA 3VNUA 1H5NA 3AW8A 3UHAA 3LFUA 4F4CA 1O6GA 1YWGO 3W3AD 3FRIA 1UPBA 3MMSA 4HV4A 1DG3A 2F00A 4G09A 2OQIA 1O03A 1LSUA 4DRYA 4CR8A 2FG7C 2QG9A 2ZSIA 2QPTA 2WTMA 4ZD6A 3S2FA 2CMHA 3UPUA 4CUJA 3PWZA 3FPJA 4E15A 4EATA 2FSSA 5AXCA 4EEZA 1X80A 4KR3A 1VG1A 1P8AA 2AIRA 4QU8A 4GDFA 2G83A 1SXHA 2W6MA 5D5HA 2XCUA 3JAMA 2A1TR 3NG1A 2BMWA 4RFVA 2B5VA 4YAJA 3KHKA 4B71A 3VPFA 2GEUA 5C9ZA 2O0LA 3U6BA 2A0YA 3UJBA 3T6KA 2P9BA 3NTQA 5JCOA 1A8UA 4GI1A 1ATZA 4OKSA 5FORA 4CQLA 3UYKA 4I1UA 1BJKA 3MTEA 4QXQA 3B1KA 3MGCA 3ENZA 1RLJA 2R7AA 5K0LA 4V0MA 3DBLB 3RIXA 3SQDA 5K03A 4S1OA 4XJSA 5AMXA 5KTOA 3MM4A 3D6HA 3EARA 1J2UA 4OMFG 3EFEA 2ONZA 3GDOA 4ZREA 2JGDA 5CHYA 3KM0A 1HETA 4CEIA 5DM2A 2Z98A 3SQWA 1R88A 1YIAA 3ZJVA 5CDHA 1IVSA 4O4JA 4X62B 1SXQA 3VVCA 3ZEAA 1FFBA 2BEWA 1DQYA 2B36A 2B1IA 2LPMA 3DXYA 3VVLA 1CUFA 4CEHB 1P0QA 5JJ5A 1CR0A 1M5TA 3EOBI 3ECSA 2I8LA 3MJHA 4XCVA 1IY9A 4MS4A 2ZBFA 3KV1A 1CRPA 1T4BA 2QSZA 1YOBA 3NDRA 4IYRA 3OEEA 1UPTA 1NW7A 3HCEA 4MUEA 1I4TD 4CR6A 5EIXA 3PQCA 1MO2A 5K0JA 1WXQA 1DWQA 5JNWA 1BEEA 1EFRD 4Y6SA 3T99A 1VMDA 1WL8A 3FZNA 5ALOA 2C94A 1WNTA 3RU9A 3MBKA 1JHOA 2WHYA 3AHIA 3E23A 2W6JA 3KQYA 5AVKA 3F5SA 2VP5A 1QK5A 1RMYA 1SD2A 2VYCA 1H8HD 5DISB 1NPYA 2FZGA 4M8IA 4JJZA 3WRYC 1D4OA 2GARA 2G80A 4BBAA 4KREA 5ENDA 3NAGA 1SBHA 4NV1A 4DDVA 4WBSA 1P0MA 2QOEA 3BGVA 5AHRA 4HAIA 4Z86A 2XDQB 2PLRA 4FFBB 5L7TA 5ES4B 3OTIA 1MH1A 2NYRA 2QT1A 2YIVX 3ANSA 4PQEA 4A73A 2WWXA 5HRCA 1QCDA 3KKEA 4TS1A 5LMCA 4FXPA 3TRJA 1IXZA 4QOSA 2E55A 1QDLB 2H7CA 3G82C 3JX9A 4JIGA 2AI3A 4MVJF 4YWHA 3TZEA 5F7OA 5JSFA 1BH6A 1NN0A 2LCIA 1FS4A 2X76A 1R8QA 3HS3A 5SY4A 5BW8A 4GR4A 1K75A 4Q93A 1DRWA 4EP1A 1DB3A 1EFTA 1NA5A 3GU3A 4ZVTA 2QLMA 2B25A 2GNOA 4L0CA 4HAOA 4P4LA 1KIAA 3RTGA 3PFBA 2Z2YA 3KZXA 3UVEA 3OJFA 4NJMB 3V00A 1RLOA 1TA0A 4KN8A 1E9DA 5JNTA 5J40A 2GM3A 1GTVA 2WQ6A 5HS4A 4E3ZA 2PUFA 4AN4A 5F12A 1S2DA 2DWCA 4JASB 2IHBA 1YO6A 2GZMA 4EITA 4G0ZA 1Q83A 3B3JA 3QMPA 2I76A 1DX4A 1E9EA 3T3HA 2Z58A 2ZB8A 3QG5A 4M7OA 4EG6A 5AIBA 1NVAA 2VQFB 1EJBA 1GCUA 2I78A 2JFHA 1G6HA 2YVUA 2FDCA 4D9NA 3KX2A 5LU8A 3RT1A 3W5IA 1KYXA 3C6KA 1F9AA 3DFZA 3GT4A 4URFA 1Q2UA 3RCBA 2V0CA 3OJCA 5CBPB 3E1SA 4UM9D 2XZLA 1JQBA 2YW9A 2F6RA 5F4ZA 4PLTA 1F0PA 3VXKA 4EL5A 1T5SA 1NGSA 1G291 4YX9A 1QB7A 3LMKA 4DRZA 1G3IA 2FSVC 1VHLA 3G9UA 4IILA 4DJFC 1Y7TA 2WWYA 2EP8A 3D0RA 3TOSA 2CKMA 1PJBA 2HMYB 4M4SA 4RGQA 1M7BA 4AWXA 5B3JC 6YASA 3SF8B 3WGZA 1D8AA 4XUGB 1QVAA 2ZS7A 1EVIA 1U8YA 2W2TA 2ZRAA 3B7GA 3N8KA 4K2HA 4C01A 2ADFA 3HP7A 1V7ZA 1ZRSA 1NVVR 2GA9A 1ZISA 1U2ZA 5LIRA 2B83A 2FR8C 2OC4A 5CLLA 2RHRA 2YASA 2GK4A 3NTVA 3NZEA 3FDIA 4MIOA 5BNFA 4BUJA 2ZRBA 1ZSVA 4N5NA 1OFVA 1LTHR 3L93A 1M2NA 3M6VA 1ABFA 1XCJA 1H6AA 2QI9C 4PBSA 4WXPA 5CLIA 1OX6A 2YVQA 1U3FA 3B36A 4KPUB 4DPLA 3UAVA 2BTEA 5EHNA 2W58A 3SQLA 2UVQA 4PAMA 5BWCA 1UDXA 1UJCA 4R5MA 2CWWA 3FCSB 4ZHSA 2HA2A 4R6XA 4ETNA 3EWAA 4X1YB 1TT7A 2W6ZA 4O1HA 1PQYA 2PT7A 1X1QA 5ITZA 3QUAA 2ATXA 1C7JA 2B1QA 1UK9A 2AMYA 1SCJA 2ZKIA 3ZWQA 4N12A 2QK4A 3DOJA 3WNVA 5HGJA 4NJEB 3GP3A 4L2IA 3BJEA 3BQNB 1UADA 2VRWA 3HHPA 3KYIB 4H4CA 4Y6OA 3E3OA 5EZYF 2WPDA 1TCBA 2FWPA 1ZH6A 3HDHA 4OD0A 1JLKA 2BEVB 3NX4A 3W5HA 3WLKX 4NMWA 3QOYA 1O94D 1ZVMA 1RYZA 2H7VA 4YJ3F 4LNHA 1T2EA 1R74A 1E79D 1U0GA 2R84A 1C4WA 5JD3A 5K2MA 4Y9UA 3PL5A 4B6PA 3JALB 3QEMA 1SQ5A 4EI8A 2IEIA 4MKZA 4EQ6A 3KC2A 3ER6A 4MQ5A 2WUVA 4J1QA 3B20A 3GELA 5E4TA 1O95C 1W52X 3I28A 4RX1A 5C80A 1OTHA 2A30A 1K63A 3W6OA 2P77A 2UDPA 2ERYA 1L4KA 3KVNA 4A26A 3QX7A 1NMQA 4IIUA 5HA5A 3MK31 1Z2DA 4PHHA 4WXEA 3WMXA 1U28C 4DA4A 1N7HA 2IYAA 3LX5A 3VR2A 1NJFA 2GEBA 2YZGA 3KRTA 4BNHA 4LHVA 4QKQA 1SELA 2BDEA 1P2BA 1C1XA 3IPAA 4H3VA 2OCLA 2QUBA 1J9EA 3DPIA 5MGNA 3VKVA 1BVYF 5T4BA 3FNEA 4GGOA 2RB4A 2A0WA 2B9VA 1D03A 1QDUA 2J5BA 1QH1B 3CYFA 1XXLA 1OTXA 2UYQA 4ABTA 2VJQA 3HK2A 1RPJA 3HYRA 5FQNA 1X38A 2ZDHA 1EFKA 3NC0C 4Y2XA 4TMZA 2HNAA 2YYZA 4BMYA 4IIJA 2H4HA 4R2XA 2ZIFA 1P0IA 2RKWA 1VMKA 3EVDA 9LDTA 1PDOA 4RANA 2QYHA 3H2KA 1U9IA 3PQEA 3K09A 2D1QA 4HDKB 4F5WA 5AHOA 2HD4A 4DUGA 2VSFA 4OAQA 3A6FA 2DQZA 1DBIA 3MGKA 4ROSA 4BMOB 1Y8RA 4E08A 3C3BA 5JD6A 2GEJA 4FN5A 1JKMA 1H9BA 1I33A 5D87A 1C14A 2AOWA 1TF5A 4YJ2B 4CM8A 5ELMA 3ZR4B 2AUMA 2VDJA 3DTYA 3GLIE 4N0MA 2WVJA 2FX2A 4DQLA 1ARZA 1WIWA 2IVZA 3A3KA 3NORA 5L3SA 3AVVA 3N2EA 1WF6A 5D00A 1W76A 4MV3A 4L8FA 4UUBA 1ZUIA 2MSDB 4WEQA 3I04M 3G5TA 1PUIA 2V45A 3WWPA 3ZE6A 4X1IA 1RJDA 3G1TA 2NO9A 1MIOB 3B9PA 3RJ9A 1AM4D 1Y7LA 3U26A 5J3JA 4X63A 4IDQA 1DXHA 3UCXA 5CBKA 4DREA 4DMCA 4BP3A 2ILVA 1EGQA 1G1AA 2EGHA 4AZWA 4NYIQ 3ZU6A 1XU7A 5EXPA 2J9XB 3UT6A 1SIBE 1E4EB 2L19A 3C43A 4MVWA 1N9ZA 3H18A 4PZ9A 3SHTA 5H83A 3STUA 3T1QA 5JXHA 5LDDC 1RRGA 1X7DA 3LQ1A 1PO7A 5ALTA 3ZHYA 2RC6A 4YGXB 5JWOA 1T3GA 2FWNA 5K45A 3TDMA 3NXSA 4TYMA 1DKOA 1YR8A 3JQPA 1QR6A 1Y1QA 5DHRA 3JASB 4JS0A 2BSXA 1ATIA 1T3SA 2A14A 1DJLA 5FYQA 2YMPA 3CLRC 1QIGA 3TOVA 4Q9LA 1PKEA 4UBJA 3ZK7A 4NARA 3BIJA 3L5KA 3THXA 3LLCA 3QLEA 1YFZA 1ZHHA 1FU7A 2Z6UA 2YVLA 2CXXA 2BGNA 4MW6A 3SQOA 3U40A 1W4LA 1MJNA 3DTTA 3V33A 5JFGA 1FA9A 2GPYA 1SEPA 1W59A 5DNWA 1T25A 2VF7A 3AG5A 3D3KA 2AOXA 1G66A 1CUDA 2QR5A 3KR1A 4BTEA 5AJTA 2OVFA 4UQOA 4F5DA 4CCWA 1U2GC 1BKYA 2FWJA 2NUAA 1OXSC 1JFTA 1X77A 2FOXA 1P9RA 1T5TA 2ZWOA 3FDXA 4N5IX 3WL4A 3F1LA 4UM9B 5K6RA 2YVKA 2DF8A 3NOXA 1FP6A 4N5MA 3RNLA 1EE2A 4R01A 4P3YA 2NTNA 1XQWA 5GONB 3MERA 1UOPA 3D3JA 3GLKA 4M1MA 4KQKA 5FFNA 1N6HA 3U3KA 1Z0IA 3FKQA 5EFOA 5CIQA 3DL4A 4YJHA 2Y68A 4IDNA 3U3XA 3RRFA 7ABPA 3WG9A 5J23A 4G67A 3LPCA 4YRMA 3FGNA 1XE3A 3QPAA 1Y34E 3H84A 3HGMA 1M54A 5HUHA 2OZVA 4CEJA 4NU0A 4ITUA 5I7EA 2Q3LA 1DJQA 1AUXA 1KRWA 4MUHA 1KPHA 4MJLA 5TRTA 2I4RA 2YXDA 3SMQA 1N3YA 4NAHA 1R0KA 3GGDA 4IOMA 3TQTA 3ZDQA 4BV3A 3PEYA 1IIRA 5DNAA 3RBVA 2AJBA 2EKLA 2YBEA 3OCVA 4OTZA 3TB4A 1XJCA 4YRTA 1LLCA 2XKAA 1TD1A 4A15A 1FCJA 4KP7A 5C81A 1EX1A 1Q3TA 3G9XA 1WCIA 4KQIA 1HGXA 1YRWA 2ZJZA 3CB4A 2EXXA 2QTLA 4FLFA 4P4GA 1HNXB 2RH9B 4NNJA 2WSSD 4M3NA 5JVDF 4ZHQA 2G76A 3M6UA 2O5CA 1EG7A 4QGAA 5A4KA 1QLHA 3X1XA 5JTUA 4G0UA 4NMXB 3BF7A 5DN9A 4K3UA 4IOLA 1A8IA 4ZQGA 1KHHA 5B2EA 1U99A 4KQ9A 5BVGA 3T1YB 3PR1A 4FSHA 4IIVA 2YW2A 3HVRA 4DGSA 1JWBB 4N8EA 5A0VA 2C4MA 2HI0A 4IGIA 3ZWOA 4HL6A 2Z1MA 1S3FA 1LBSA 2Z3WA 2VJKA 3N8GA 3W2FA 1JE0A 1DBSA 4CFYA 1W0KD 4P84A 4BRZA 5AW7A 5JNLA 2AWNA 5AI0A 4PHTA 1I3LA 5FOTA 2AEEA 2I99A 3CURA 3PJFA 5FWAA 1WMSA 3P20A 1XPUA 3I6YA 5K0SA 4OYHA 2ODTX 2HEIA 4PGFA 3MGBA 5FNVB 4YMLA 4J0GA 3OZTA 2FFRA 4ZEWA 1NQXA 1GGFA 1GRQA 3Q2KA 3NH6A 4AK9A 3H5VA 5H4GA 3GGGA 1ZD4A 4LJAA 4L5IA 1Q6YA 1TLTA 4AY3A 2JGRA 1BVUA 3OKPA 1BMTA 3OQBA 5HVNA 1OT5A 1M6YA 1V37A 4NXNB 2J08A 5HK9A 1H2AS 2BCGY 5BQ3A 3K8YA 3C87A 1M34B 4UPEA 1NXOA 3C7KA 5J9FA 1BXGB 2G0NA 5AJWA 4KHZA 3F5MA 3ZDFA 2ESRA 1ZH2A 4WXHA 1E99A 2DQSA 3IBCA 3TW6A 2WJ4A 3F9CA 3RWMB 3H2HA 3HYTA 2HAEA 3U48A 2H1FA 4KIGA 1R6BX 3RG8A 1K0UA 2X6QA 3GZJA 2V74B 2ATIA 3L0ZA 1W88A 3S3TA 3AJDA 5C7YA 1PR0A 3QH4A 5E38A 2IW3A 3M1LA 3RTBA 4LF4B 3VGJA 3O7MA 3FYUA 1TUBB 2NVOA 3DAHA 3PI7A 3QYFA 3GG2A 2JBWA 1J5EB 1P5HA 1UMBB 3WLHA 3NNNA 4JJ8A 4KRFA 4LZZA 3FF4A 1WUHS 5AK4A 4ALMA 2Q2VA 2XGJA 4HUQA 3W5AA 2B8WA 2G0AA 2BV3A 4X3CA 4J4BA 1U4NA 1PNRA 4W8GA 2N0SA 2OXFA 2X0RA 1NUAA 1CLEA 4CV3A 4QAQA 2AHOA 1NVDA 5I9SA 4I9HA 2IU3A 3PXBA 3ZDZB 1FQWA 1NI4A 3M4XA 5IVPA 1W7AA 3COPA 1Z75A 3A4TA 1O9BA 3NHBA 1ZN8A 1CWUA 3ZHXA 4EHFA 2DLDA 4OF4A 1V95A 3E2MA 3DE1X 4XJXA 5JLJA 2UXCB 1JIUA 3O8QB 3V55A 3ONNA 1TJ3A 2RBEA 3IUNA 3GFQA 1DCFA 4DLAA 1KAMA 2I71A 2ZUBA 3K5IA 3KOOA 4CKYA 5ITSA 3W5BA 3KKQA 1DOHA 3EXHA 3GRZA 2X5KO 1ZY2A 2EDCA 3Q5EA 4HYTA 3A28A 4ZI7A 1MW8X 2ZUDA 4TV9F 4BNWA 3MJEA 2JRCA 3EUFA 3TLZA 1EFDN 4IKOA 3ZNQA 2ZBDA 4N5HX 4RACA 2FN4A 3PDUA 4N0EA 3B8HA 1G20A 3ZHRA 1CY2A 1QJCA 1RXSA 3AG6A 4IMJB 3HJTA 4WE3A 3WIOA 1M66A 4YXWD 2WU1A 3R0VA 3FHLA 1V8ZA 1DIBA 4HVTA 2OK7A 4NYMQ 5LUAA 1SKMA 4EJSC 1ZCFA 1FLAA 3PT9A 4E07A 1KL7A 1PW5A 5ICSA 5IUJC 1P1HA 4NFYA 3RV4A 3BMCB 1HYBA 2BZSA 3TRKA 1C2YA 3WWOA 2DECA 4KBFA 4NYIR 4X54A 4I08A 4UVIA 2WWVD 4YJFB 4D1YA 3DLHA 2OHXA 4KNYA 1UXHA 3RDPA 3KETA 5LU9A 2IH2A 1CNMA 1XWFA 2QMQA 3DAPA 3TW4A 2RI1A 3WGOA 5LXTB 2OG1A 3R6DA 2Y2UA 4TKVB 3RYFA 3WK5A 4LYJA 2XD4A 4Q1VA 2HPHA 4ZICA 2J87A 4TRMA 3H3FA 2VRCA 3OJEA 3TLXA 2H29A 2X7HA 3ICEA 5JOQA 1ISMA 3W90A 2Z57A 5L3ZA 5A4IS 1QP4A 1EFLA 3UUFA 5LWQA 4WGGA 2EX1A 4M54A 3UMBA 5KHOC 2E5FA 2I9PA 4TXHA 4ISCA 1V5IA 4JLWA 4BMDA 1RWQA 2PHZA 3GX1A 4FQ8A 4RLFA 3L8HA 1V26A 1Z2AA 4FYJA 1OAOC 3RRJA 3STTA 2F17A 3CINA 5BO5A 2YJZA 4HWSA 1N6PA 1LF0A 1UBSB 2NU7A 3MHPA 3UY4A 5AOAA 4N3AA 3CISA 2GXAA 7YASA 3ONFA 4ESEA 2ZJ2A 1UT5A 3BD6A 2O3UA 4Q66C 4TS4A 5CW1A 1ZOPA 3H4VA 4H7EA 4Z99A 2QSJA 1XRNA 1Z0SA 1VL2A 1ZBDA 2WKPA 4TTSA 2VUIB 1L4GA 3DVQX 1NQAO 2PS9A 1PF7E 1Q7RA 2ZBRA 2YOHA 4GEKA 2DPMA 4HH3C 5CEJA 2YZKA 5JANA 4HX5A 2SCUB 1Y6ZA 2HHAA 3AEQB 3AV0B 1CIJA 3HI6A 3ZKWA 2X58A 1JG7A 1YB6A 1RXYA 5CA1A 3ITNA 1T2AA 4OB6A 4V0SA 3MJ4A 3MELA 1XG5A 4I1RA 1G8FA 3AUXA 3UWKA 2VPIA 2EGGA 3BXFA 5DOZA 3TVTA 1HQDA 1W25A 3AETB 4Q39A 4D6YA 5HRAA 2ZBEA 4ASUA 3ER8A 4A2PA 1JNYA 4TVOA 1MAAA 3BWXA 1K7EB 5HZKA 3AM4A 5ED0A 1M6HA 4KWTA 1GLNA 2GLUA 3OFSA 5J2UB 3ABZA 1BCSA 2WD8A 3VTZA 1KMQA 2YMLA 2GESA 3WFZA 3X0DA 5IN5A 3ZXIA 1MGOA 1TTQB 4UBKA 3AONB 3NGMA 1C2TA 3EXEB 4N82A 1X3LA 2OHHA 3VSAA 5J2TB 4PIPA 3VR6D 4PZ0A 1JLLB 1SUWA 4DADA 1T0IA 2VZEA 5KOYA 1F2TA 2F59A 2WJ6A 3EEOA 3H1AA 3UOWA 1E89A 4JXXA 2R8OA 5A1JA 2GJSA 3MT0A 4Q21A 1PQWA 2YWEA 2H00A 1EDDA 2RMKA 3VH1A 3L0IB 4ZRDA 5GZ6A 5JNSA 4RM3A 3NFYA 4YAWA 1QE3A 4J3NA 3I8XA 3TE7A 2ID4A 1YKSA 5L40A 4OQMA 3AC0A 5IXSA 3KAKA 4UFNA 4YHBA 5TVGA 3ZTTA 2EL7A 1QF9A 3AU8A 3MJRA 3QKRB 4Y2UA 1FX1A 3RVPA 4AMYA 2ATCA 3DKVA 1XI2A 4JP8A 4ZZ2A 3RUEA 3E48A 1L4NA 3RVLA 3VDNB 1I4DD 2EATA 1GTG1 1OGIA 3OT1B 4GI7A 2VNAA 4WZBB 4R8VA 3O9ZA 2BKXA 3B1WA 5BSEA 5JFTA 1KJ9A 1PWEA 3ETHA 4ZO9A 2O8VA 2GR9A 4EO9A 1Q1QA 2CUZA 3QNUA 1DMRA 4INAA 4UEWA 4QTYA 4RD6A 4D6PA 1K97A 3UNXA 2JA2A 1ZESA 1OI3A 3L1JA 4DIEA 3UGJA 4DC1A 1BDJA 1XYGA 2GK6A 3IAFA 3KKOA 1OZHA 5K3BA 1I3KA 2P0EA 1A9ZA 2YICA 2J0SA 4FHDA 3INYA 4KOAA 1Q84A 2P9TA 2WP8J 1R0ZA 4GRDA 3SDZA 3EBLA 3ZY6A 4GECA 5ECDA 1H1LB 1FE8A 1WTCA 2Z2JA 4GSKA 2W6NA 1U8EA 4J2OA 1Z0DA 1MC8A 2W8BA 3DHYA 3LF2A 3NIFB 5IP5A 5CDFA 5JSUA 1FC0A 4CUZA 2HDWA 3E4DA 2FFHA 2VPQA 4UOEA 5K0FA 2O0KA 3G1UA 2VNKA 2VXBA 5HHTA 2DBVO 5B37A 1SN7A 2WFZA 5A4FS 1DWUA 1KNQA 2X86A 4Z4CA 1QRUA 2E1RA 3QLUC 4BN0A 3O0DA 4FHEA 3UT5B 2G25A 1Z2EA 3PHJA 1MO5A 4UHFA 3RYTC 4PGHA 3SIPA 5DK4A 1PZNA 3NM6B 2PUHA 1ZVQA 5CTAA 1QHXA 1G8JA 1YVDA 1XKTA 1RQNA 3R6WA 4P92A 3TTVA 5A3QA 1U98A 5E6RB 3RNOA 5DGCA 2HU7A 2GBGA 2VJMA 3OAAD 1QIMA 2H3HA 4LHYA 1PR4A 2C54A 5BSWA 1Q7TA 3RHTA 1DRJA 1E5QA 1FTNA 1T43A 1V7PC 4ZJZA 4X3OA 5JZMA 5KVSA 1NNUA 4XIGS 5HIMA 3FXAA 4NICA 3RYIA 5EXSA 3WHIA 1B4DA 4HAWA 3PFFA 4FEGA 3TQCA 3G68A 3MWFA 4R8RA 2X1LA 1DBWA 1RLTA 2AK2A 1E61A 3G17A 4HNAA 3KS9A 1QMGA 4K05A 3H04A 5LYJF 2CCKA 3AEUB 3GUVA 4DL9A 4H1WA 4PCLA 4D4JA 3B52X 3EFHA 3H87A 3IE1A 2AOTB 3PVCA 4KH1A 1KBZA 3ONWA 5JS7A 1H8EA 4UE6A 1DQRA 3K1AB 3SS9X 4KK4A 5TPZA 1NG1A 1J06A 5ALZA 1RPZA 4TS9A 2JKYA 4IH1A 4BBPA 4OXNA 3BCRA 3DZ8A 1PNOA 1XROA 4TXLA 2BUCA 2FQYA 1KMNA 4AULA 3RJ5A 4AS2A 4RLHA 4Q82A 2VEOA 4CMEA 4CODB 2XSZD 1V5WA 4NENB 3CKMA 3Q8XB 4ZVOA 3VH3A 4IS3A 1OHHD 4NYMR 2A88A 4UUAA 1IXKA 4XR9A 2PU7A 5K0BA 4Y7CA 1BYUA 1MEJA 1Z82A 4X7MA 1SC3A 5DJ5A 3VYSB 3W7VA 3T9AA 1EK5A 4E12A 2ZAIA 3E5RA 1NQOA 1A4XA 4BNFA 2YS6A 4QVKA 3VHXA 1N3BA 3AY7A 2BEUA 4MRMA 4F84A 1TYAE 4I4TA 4A6DA 1R8SA 4CGYA 3QWFA 1KQ3A 1H4SA 1GGMA 1YS6A 2PRYA 3E9QA 4MQEA 3T54A 3TZBA 2OGWA 3BFVA 3QE3A 2CMDA 4EHHA 3WKBA 2PFKA 1XDWA 1C81A 2XMSA 3I6MA 4MVJD 4QPDA 3T95A 5BQXA 5CLJA 2R9VA 2GYVA 4WASA 2VYNA 1QFJA 2X9GA 5AXBA 3ZI7A 4BGEA 4OK6A 13PKA 3UC5A 3IOMA 1L2TA 1GNSA 1OREA 1SZPA 3JD1A 4JGIA 4XM1A 2L42A 5ECGC 3NO4A 5AM2A 2TECE 1WO8A 1LI5A 3TS1A 5DMXA 1DC3A 2P5UA 3E9MA 1VTKA 1RRVA 1T9ZA 1UP7A 2J3DA 3RQSA 2ZRIA 2HJGA 2C7VA 2VLBA 3WQHA 1U2QA 1DUIA 4ON9A 3E8MA 4KAXA 1VSQA 2PKXA 1J0XO 4G37A 1T8UA 2I03A 5ALUA 4CT4B 2DPGA 1SCDA 4OO3A 2PPLA 3B7PA 3KXIA 2P9YA 4LGVA 1ODCA 1Z6TA 2WSYB 3Q1KA 1P9LA 1Z9BA 2VRNA 3M2PA 4I6JA 4OFZA 4PE5B 4TN1A 3U4GA 5DOVA 3R3JA 1QK4A 1XR3A 2FEAA 2JLSA 1OZGA 3H75A 5L45A 2WFLB 3KJQA 2NT3A 5IT9A 1IPHA 1IOWA 2HWXA 4GPD1 2J3LA 4EABA 2Q5JA 1O0CA 4D97A 4AUEA 1YR3A 3QIVA 3T3DA 4M0MA 1E3WA 1F06A 4OATA 1FFXA 4WJLA 4OQXA 5KNDD 5H9WA 3QE4A 3LZ6A 3U3RA 3ANYB 4JX8A 5JC8A 2YIMA 3IBGA 1GSAA 4AZVA 2OCKA 3DC7A 2C97A 1ISJA 2JFBA 3JQGB 1ZXBA 4J0KA 1FDIA 1WX1A 1Z6XA 1P17A 5JSKA 1A9XB 1T3LA 1NT4A 2JFUA 4E5YA 4DJDC 5K4AA 1CFZA 1HDRA 2M32A 1NP3A 5JFOA 3FHCB 1Z15A 2ANCA 4Y2RA 3WYBA 3TIVA 1JBEA 1IHPA 5G53C 2QUAA 3SR0A 1O57A 1E1QD 4JJKA 1SBYA 1P4HA 3QTLA 3F73A 5CT4A 4BZWA 5BN3A 2WQZA 4D0LB 1W5TA 4HDRA 3PUKA 4FS3A 3RR2A 2X1HA 1KYIA 2AT1A 1WRBA 2B2CA 4MWZA 4RZ3A 2QQ5A 3VKFA 1FXUA 1SVLA 1IATA 3G2HA 3B53X 4QASA 1IFXA 4R16A 4LW8A 3R40A 1AY0A 4QTTB 4Y2QA 3UAYA 3EAQA 4ZGWA 1NI3A 1QYDA 1FSFA 4JLOA 3PU6A 3ZDEA 1JEQA 3MA0A 4LBYA 3WLEA 4F5EA 1DZ3A 3ZVKA 4OHYA 3VUEA 2HLHA 1B0PA 1K66A 3EZFA 4R54A 1UJNA 1GSIA 4QSMA 2KLHA 4TL8A 1TOAA 3BBPA 4EEKA 1JW9B 3L8GA 2IIVA 4DSNA 1UMKA 1P9WA 4HN4B 3AHFA 3G6WA 4OJMX 5K6AC 1JFFB 3R0XA 1X7WA 2WG0A 4R9VA 1DWOA 5AM4A 1GGEA 1YMVA 3VDMA 1T2CA 3LY8A 4JI8B 3WLMA 2AZ4A 3BFJA 3GAZA 3CVUA 1WMAA 3A1DA 3GFTA 2IITA 2DCMA 1T9BA 1X1EA 2WWGA 4NF2A 1G6Q1 4RVOA 3TH5A 1CR4A 4H2DA 2QT0A 3P9QA 3ZUGA 2AZDA 3ZDCA 4P08A 3HB4X 3BQMB 4HH0A 2DLCX 1RWPA 1QP8A 2CSUA 4Z0PA 1LPBB 3UANA 3PTAA 5DBEX 5BV2P 1YQXA 2W5UA 3G49A 4BO2A 4Z2YA 3DV0A 4JXZA 3BZBA 3T0FA 2W2NA 2O19A 1G41A 3KSUA 3X2FA 3KOXA 1MENA 5G0UA 1AQIA 1M2VA 1IOVA 3L82B 5U9CA 1T8WA 2J6CA 5C4IA 2HXGA 1X94A 2P8JA 1GZ6A 1KA9H 4A1FA 2VPWA 4TWAA 1LX7A 4MGYR 2J33A 1OC2A 2I3ZA 1I6MA 2PKEA 3RQIA 2NP7A 1TPYA 4UTXA 4Z9FA 4TMTA 5H3LA 1FDWA 3WHKA 5I01A 3BKXA 3H83A 3GJRA 5FPSA 2HV9A 2Q3BA 2XCSB 3NIBA 5DFAA 1AB5A 4TSKA 1U8UA 3MCWA 3I92A 4BL5A 2R6DA 4LYGA 5BSTA 4M60A 4M6WB 5A62A 2YFKA 3ADBA 1RQLA 3WWEA 4X66B 4QFCA 4S1WA 4PIMA 4BY9E 1E1RD 3G0IA 3JSAA 4RY9A 1EM6A 1FNCA 4B0OA 3HFGA 1T2NA 3DL0A 1XL1A 3BA1A 1JAZA 1PTJA 3QOWA 2QU8A 4U39A 4DMFA 4D26A 5GVSA 4WKNA 1XTPA 4HD8A 4MAMA 1PYDA 5ADUS 5FULA 3IUQA 2WILA 2SKEA 1H4QA 4OJNA 1SEVA 2WY2D 1DO2A 1EBFA 2FJ0A 1EM8B 5IASA 4CE6A 1RIFA 2C84A 1GYQA 1I6KA 3IQDB 2V9PA 2E6UX 4QHYA 1R0SA 2I22A 3RFFA 4D80A 3E05A 4FWBA 5CNIA 5CYOA 4BE7B 5JNUA 4CEIB 1MPXA 1CPYA 1QBKC 3QVSA 3WKEA 3IVRA 2QM8A 2Y0CA 2FFQA 2C04A 2FPOA 4D9GA 2E4YA 3QI2A 1OIXA 3SYLA 1A0OA 4PGAA 4UTVA 4DIMA 3L7IA 3MTGA 4MW4A 3PS9A 2VQEB 4N7RA 2FQQA 1YCFA 3RVMA 1SG0A 3JTEA 2OYCA 2V1XA 2YFQA 3OO0A 3QZUA 1R3DA 2JF0A 4HWKA 3GFVA 1R0LA 3OX3A 3FWZA 4NPAA 4D8XA 4DWJA 1PLJA 1WHSA 4J1NA 3DDCA 1TEXA 2YXPX 3WXMA 5BMVF 3BRCA 4JB3A 5IZCA 1T9AA 3HKEB 2ONYA 1N5MA 3AKEA 1N3LA 1Y8CA 2BGKA 5HQJA 1CRLA 4H3SA 3R0QA 1HF3A 5DVZA 3UXHA 1T5DX