2PSTX

1.8a crystal structure of the pa2412 protein from pseudomonas aeruginosa
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
61
structure length
61
Chain Sequence
DDIQFQVVVNHEEQYSIWPEYKEIPQGWRAAGKSGLKKDCLAYIEEVWTDMRPLSLRQHMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 1.8 A crystal structure of PA2412, an MbtH-like protein from the pyoverdine cluster of Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Unknown function
molecule keywords Hypothetical protein PA2412
total genus 14
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2007-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF03621 MbtH MbtH-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.820.10 Alpha Beta Alpha-Beta Complex Rubredoxin-like Structural Genomics, Unknown Function 30-nov-00 1gh9 Mol_id 2pstX00
2GPFA 2KHRA 4GR5A 2MYYA 2PSTX 1GH9A 5JA1B 4GR4A
chains in the Genus database with same CATH superfamily
2GPFA 2KHRA 2JRPA 2JNEA 4GR5A 2MYYA 2PSTX 1GH9A 5JA1B 4GR4A
chains in the Genus database with same CATH topology
2GPFA 2KHRA 4GR5A 2MYYA 2PSTX 1GH9A 5JA1B 4GR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GPF A;  2KHR A;  4GR5 A;  2MYY A;  2PST X;  1GH9 A;  5JA1 B;  4GR4 A; 
#chains in the Genus database with same CATH topology
 2GPF A;  2KHR A;  2JRP A;  2JNE A;  4GR5 A;  2MYY A;  2PST X;  1GH9 A;  5JA1 B;  4GR4 A; 
#chains in the Genus database with same CATH homology
 2GPF A;  2KHR A;  4GR5 A;  2MYY A;  2PST X;  1GH9 A;  5JA1 B;  4GR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...