2PSXA

Crystal structure of human kallikrein 5 in complex with leupeptin
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
227
structure length
227
Chain Sequence
IINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kallikrein-5
publication title Structural basis of the zinc inhibition of human tissue kallikrein 5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 51
structure length 227
sequence length 227
ec nomenclature ec 3.4.21.-:
pdb deposition date 2007-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2psxA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2psxA02
2CGAA 3QUMP 2FWWA 4YZUA 1LHFH 1HBTH 3JZ2B 1QHRB 5DPAA 3M7TA 4K60A 2QN5T 3CP7A 4A92A 4BXSA 1YYY1 3TU7H 3QLPH 1A5IA 1HDTH 1GG6B 1O5FH 5DG6A 2BDGA 3LT3A 1KXAA 2AMQA 2WPJS 2BX4A 1C1VH 1SGTA 5EPNA 2Z3DA 3E1XB 1H8IH 1BTZA 1DUAA 3A86A 1YPJH 4CRFA 2V3HH 1Z1IA 1DITH 1V6DA 1EATA 5DP4A 3O8RA 1DOJA 1SGRE 4AOQA 2BYAX 4ZROA 2PWXA 4OS7A 2VWOA 2JETC 1AWHB 1OP0A 1QQ4A 3SU6A 1FJSA 3BG8A 3GYMA 5A0AE 5EU8A 3M5NA 1E35B 1B0FA 2F9NA 4X2YA 1TX8A 2Y81A 1ZJKA 5AFZH 1EOJA 2XTTB 4OS1A 2ALPA 2WUBA 4AYYB 1QJ7B 2P3UB 4XBDA 2XC5A 3T29A 1CA8B 2EI7A 3A81A 1P2OA 3T25A 3W94A 1G3EA 3MMGA 4OS4A 1P12E 1UTQA 4MPWA 1GL1A 1IQIA 1O2PA 3TGJE 1EB2A 1BHXF 1GHBF 1SOZA 2VGCB 2XRCA 2ZZUH 3U69H 3KL6A 1AKSB 3SNBA 1Y3WA 1DSTA 3SNDA 3UR9A 3ZZ6A 2AMDA 1LHEH 4INHA 2GV7A 1SGNE 2BOKA 4JCNA 2R2WU 5GPIB 1ELFA 2ZDLA 1VZQH 1BT7A 1IQGA 3P8OA 3MNXA 1GVKB 1K1NA 3RXVA 2G52A 4FVDA 2XWBI 3STIA 1YPEH 1QY6A 2ZDNA 4ABDA 4Y8ZA 1LKAA 2WPIS 2W3KA 1AFEH 3OTJE 4KP0A 1A46H 3UREA 1RTKA 3UWIA 5L2YH 4YESB 3SUFA 1LVYA 1CA0C 1ZMJA 3RXMA 2CV3A 1DWBH 1HJAC 1ESAA 3HKIB 4FU9A 4WF8A 3GY2A 2ZTXA 1F5LA 1WQVH 4MPXA 2CXVA 4ZKRU 1TGNA 5DO4H 2G5VA 5IDKA 1JWTA 1K1PA 1SFQB 1S0QA 4WXVA 3K6ZA 1G3CA 1AFQC 1C2FA 1UVTH 3RC5A 2FOCA 1GJ8B 1DXPA 5A0CA 2VB0A 2ZDAH 4I31A 3TJNA 2G00A 1MTNB 1O3FA 4Y0YE 3K65B 3P8NA 3H5CB 2ASUB 5A8XA 1BIOA 1IOEA 1E0FD 2HNTC 1GHXH 1ZOMA 1FDPA 5HMAA 5JBAS 5F6MA 4IC5A 1PPZA 2O8LA 2GV6A 4K1TA 4Y8YA 3Q00A 2AH4X 1HFDA 3VPKA 3A7WA 2Y82A 3F9HA 4AFZA 2A4RA 1O3CA 1GMDG 1G2MA 1NFYA 1ABJH 1DY9A 4A1XA 1GBLA 6GCHF 2ODPA 1A7SA 1BTWA 2C4FH 2O9QA 9ESTA 3BTWE 1TMTH 1UVOA 3CS0A 1MU8B 1C5RA 2WPKS 3ZYDA 1SHYA 7KMEH 3BTEE 1LMWB 4YO9A 4B75A 3D23A 1IQMA 2EC9H 5AHGH 2PKSC 1K28D 5I25A 1C5OH 3RXOA 1J17T 2BLVA 1CHGA 1G32B 2ZHWH 1W14U 3GCTG 1TYNA 2F9PA 2ZIQH 4O03A 1TAWA 1HXEH 6ESTA 4YTAA 1ESTA 1LDTT 2FLRH 1AVWA 2ZA5A 1FAKH 5FXLA 3MH4A 1OKXA 4ISHH 2HVXA 4X1QU 3MU0A 1O3JA 3BTDE 1C5NH 2PUQH 2XC0A 4HTCH 4ZUHA 3NWUA 3SV9A 2P94A 2GD4B 4XDEA 2ZHFH 5BRRE 2STAE 5LPFA 1UCYK 3MHWU 3ZVFA 4FUBA 4H6TA 3EA8A 1CHOG 2PR3A 4A1VA 4GAWA 2A2QH 1SLUB 4JYUH 4LOYH 1HRTH 5JDUB 2F83A 3F9EA 1PQAA 4BAOB 2GCTB 3RXLA 1AMHA 2Y6TA 3F9GA 1LQEA 2H5DA 3ZVDA 1YGCH 1D3QB 4ZHLU 4ABFA 1O3NA 3HATH 1EZSC 5DP3A 1E38B 2SGQE 1BRCE 1K1LA 2BLOA 2GX4A 3M61U 2XCFA 1RS0A 1B7XB 1GDQA 3ZZ3A 2GMTB 1GG6C 1W8BH 2ZU2A 4U01A 4YT7H 1AVGH 3A80A 4FUEA 5DJ7A 1MAYA 1MMJN 3F6UH 5A8ZA 3UTUH 4OS5A 4KKDA 1HIAA 3QO6A 1S82A 4ESTE 2XBVA 3GY3A 1CVWH 1G30B 1H9LB 3UIRA 2QXJA 2WYGA 3SU1A 1XUHA 1J15A 4MNYA 1GHVH 2G4TA 1GBBA 2R3UA 3ZZ4A 4YOGA 3VB7A 1A3BH 2VIOA 1FY8E 1GCTB 2ZHEH 2ZTYA 4O9VA 1PQ5A 1QBVH 1AU8A 1F0SA 1P8VC 1LHGH 3NZIA 1QRWA 2ZFTA 1O3EA 1SC8U 4FUIA 1ESBA 3GOVB 5FCRA 1GMCG 2PV9B 4JZEH 2D2DA 1MZAA 1TRNA 3MU1A 4NG9H 1MCVA 1Z8JB 3T28A 2ZDVH 1QQUA 2XBXA 2FX4A 3RMLH 1BMLA 2ZQ1A 4O3TA 1JIRA 1KSNA 1Y3VA 3FZDA 1CGIE 1OOKB 3O8CA 1Z6EA 1BRBE 1W7XH 2FI3E 3LKWA 4JZIA 2FOAA 1GBAA 4NGAH 1A4WH 1CU1A 2BQ6B 1XXDA 2VGCC 1C5YB 2D8WA 2AGGX 2P16A 3T62A 3ZV8A 5ESBA 5E0HA 1FY4A 1NRSH 4MG3A 3BTKE 1GBTA 4GSOA 1O3GA 3OY6U 3O8BA 1GVLA 1WV7H 1SR5C 4E06H 1LPKB 1QCPA 1Y3YA 1UCYH 3SNCA 3UPEA 3OU0A 3QGNB 2EI6A 3DFLA 3GICB 1OSSA 3GYLB 2BQ7B 1WUNH 1QR3E 2P59A 4YOIA 3ZV9A 4AORA 1SSXA 1C5WB 1SI5H 1J16A 2STBE 1ZRBA 4ABHA 4AGJA 4BAKB 2Y7ZA 1Z8GA 1PYTC 3SGBE 3P6ZB 4MVNA 3SU3A 4IGDA 1VITF 3DT0H 1C2LA 3SU5A 3SI4H 1F7ZA 1MCTA 4KTUA 1TBQH 2ILNA 4X2XA 3SORA 2BDYA 1LVMA 1C5TA 2A4GA 5ABWA 2A1DB 3PMBB 8ESTE 3AAVA 3TGIE 2ULLA 4KGAA 1KDQB 1PPEE 4TPIZ 3UQVA 2FOFA 1TMBH 3M7QA 2A7JA 1K1JA 2Q6GA 1MTNC 4UFDH 1DM4B 3A7ZA 1MZDA 1YC0A 2BD9A 4JYVH 4X2VA 3SN8A 1C2IA 1ETSH 4X8UH 5HM9A 1GBJA 2QXIA 3A85A 3PWCA 1EXFA 3A89A 3V13A 3QK1A 1FNIA 2Y5FA 4CRBA 4XBBA 1TABE 1QRZA 2GCHG 3RLWH 1O2IA 3P70B 1KTSB 1WTHD 5C67A 3TK9A 3AW0A 5FX5A 5A0BA 5DK1A 3SGQE 1C4Y2 4Y76A 4MNXA 3SGAE 3SNAA 2F91A 1ZR0A 3U1JB 1C2HA 2CHAC 3U1IB 3SV2H 1HJAB 1O36A 3AVZA 4WH6A 5ETXA 4GHTA 4BTTB 3TH3H 1AZ8A 2IOTA 4X6OA 1O3OA 2OCVB 4U32A 1DT2A 4X1NU 3TNSA 4WY3A 4NSYA 4E05H 3TH4H 3EA9A 6LPRA 1QA0A 4CRDA 1XUIA 2KAIB 2Z9LA 1AFQB 3K2UA 1O2HA 1ZPCA 1C1NA 1GI4A 1AKSA 2BD3A 2FESH 2J38A 1XUKA 1HNEE 3VB3A 1D9IA 1O2ZA 2AERH 1UVUH 1J8AA 1NFWA 2A5KA 4Y10E 4CH2B 4JMYA 2BXUH 2UWOA 3PROA 1C2EA 1XVOA 2SGEE 4TPYA 3UWJH 4DURA 2IN2A 4MLFB 3ZYEA 2QXHA 2CN0H 1AIXH 2FTLE 2B5TB 2O8WA 4KTCA 1EZQA 5GCHG 3VXEH 2PTCE 1C9PA 4OGXA 1L1NA 1W13U 3EQ0H 1HAVB 3MNCA 1NM6A 1C1TA 1XUFA 3KQEA 1W7GH 2G8TA 2GCTC 1TBZH 1P2IA 3F68H 1ELCA 4NWKA 3BSQA 1Z8RA 3FFGA 1NRQH 3RC6A 5B6OA 4LZ4B 2XWAA 3M3TA 2DE9A 2ALVA 5F8TA 4XFQA 3S9AA 3VGCB 4DJZB 3ZVCA 1CT4E 2HALA 3A7VA 1O5BB 1V2MT 3BTFE 2AS9A 1CQQA 1DVAH 2ZGXH 5GXPA 2Y5HA 2TGAA 1AE8H 2ZGCA 4BTIB 1LKBA 4TWWA 2BY6X 1OYQA 2VIDA 2BB4A 1UMAH 1SGFA 3QTVH 2VWLA 1C1RA 1YPHC 3LGUA 1G9IE 4A6LA 3A7XA 1PFXC 2BDBA 2H9EH 1KXFA 2XW9A 4ABGA 1GCTC 2BQWB 1IQKA 3A7YA 1ZSKA 4B76A 5BPEA 2ANMH 2FOMB 1W2KH 2XC4A 7GCHG 1HAOH 1M9UA 3TITA 1GDUA 1NPMA 1ETRH 3FAOA 5DGJA 2WV4A 4R8TB 3SU0A 3KHVA 4D9RA 2YNBA 1HXFH 1N8OC 1GHWH 1GJ6A 4JZDH 4B71A 3DFJA 1GPZA 3BIUH 4X1RU 1BHXB 2VIVA 3PV4A 1QTFA 2BD4A 1V2QT 1XVMA 1IHTH 4UFGH 2A4QA 1GDNA 4UD9H 1ZZZA 3RU4D 1Y8TA 4OGYA 4Y7BA 4D9QA 4WWYA 5PTPA 1UHBB 1C2DA 1TPSA 1P05A 4I33A 1L2EA 4J2YB 1ZMNA 1T31A 4WMFA 1G3DA 1RTFB 3TK6A 1DWEH 2J4IA 1XMNB 1K21H 2GTBA 1HAGE 1IQFA 3LGVA 4BXWA 4X2WA 3LGYA 1MU6B 2YNAA 3GISB 4I8LA 1A5GH 5JB9S 1FY3A 2BD8A 3HK3B 1NRNH 3TIUA 1NFXA 3BG4B 2OBOA 4H42U 3L3TA 2GGVB 4TY6A 3S9CA 4KELA 1P06A 1S0RA 1MD8A 3A8BA 1OWJA 1ELDE 2NU0E 2GT8A 1DICA 4ZKNU 1F0UA 3RXQA 2H1UA 1CBWB 5HXFA 4GCHG 2BOHB 3BTTE 3EE0B 1OS8A 2ZTZA 1ZSLA 1FI8A 1TRMA 1ID5H 2P8OB 2LNCA 3FP8E 2H6MA 4K1EA 5TCAA 1J14A 3KN2A 1FPHH 1T7CA 2BD5A 2I6QA 1GWAA 1WYKA 1TGBA 2FOEA 1CO7E 1BDAA 3LJOA 3M35A 2ZECA 2IPHA 2ZGHA 3SU2A 2J94A 3ZZ9A 1AN1E 3L6PA 1NC6A 1SVPA 1ZGVA 2EA3A 4KTSA 3GCNA 1LQDB 8GCHG 4OS2A 1ANDA 3SJ8A 1E34B 1K9OE 2VVCA 4NZLA 5F8ZA 2Z3EA 2VU8E 3P92A 2Z6BD 1GJ7B 1ELGA 1EP6A 2NU1E 1EKBB 1EJMA 3BEUA 2Y7XA 3KIDU 3NXPA 3DA9B 4NA7A 1ELAA 3ODDA 3PYHA 1P3EA 4X6PA 2SGFE 1CE5A 1FY5A 5CHAB 3MO6A 1B0EA 3UR6A 3MOCA 4NFFA 3LOXA 1KLIH 1GJBB 4AG1A 4D7FA 5ESTE 2R9PA 1GJCB 1QNJA 3RXTA 1DY8A 3B8JA 3T26A 5SGAE 3GY7A 5FBIA 1C1UH 4ISOA 1SGFG 1IQNA 2A32A 3A83A 2BD7A 1PPFE 2GKVE 3A82A 2XBYA 3UY9A 3KCGH 1O2JA 2BY9X 4JZ1A 1C1QA 3HGNA 1S81A 2BHGA 1KXBA 4RSPA 2QF0A 2OQ5A 1QURH 3ZVAA 1L1JA 3VB6A 1O38A 2PKAA 3Q3KA 3LC5A 5EQRA 1BBRK 4F49A 1DWDH 2QV1A 2QGRA 4YM9A 1GJ4H 1K22H 1KTTB 1H9IE 1ZTLA 2Y5GA 4DW2U 2PSYA 1DSUA 1BZXE 3U8RH 2OC7A 2HOBA 2NU2E 1T4UH 1NY22 1UTKA 3QWCH 1L4ZA 2WV5A 1AUJA 4DVAU 2BMGB 4OS6A 2A31A 5AFYH 4XOJA 4CH8B 1TGCA 1SGPE 1AO5A 1ELBA 3ENSB 5EQQA 2ZKSA 1FMGA 1SMFE 2CHAB 1A0JA 1EPTB 4DG4A 4ZKSU 3RXSA 1FIZA 2XNIA 2G5NA 4Q7ZA 3U8TH 4AGKA 1QFKH 3VB5A 3VGCC 2ZFFH 1VCQA 5L6NH 1KY9A 2XYAA 2ZO3H 3PO1B 3GDVA 1KDQA 4A1TA 2H9HA 4AB8A 1O3PB 1MTUA 4BOHA 5E2OA 1NT1A 2CF8H 1BOQA 4X1SU 1O5CB 2ZFSA 2OUAA 3BN9A 2C3SA 1ELTA 4GUXA 5GDSH 5FBEA 1YCPK 1YPMH 1DX5M 1LTOA 4CBNA 3KQDA 1HJ9A 1T32A 1O2GH 1BUIA 1C9TA 1EX3A 3UUZA 2BDAA 5LPEA 4CREA 2BZAA 8LPRA 2JKHA 2PFEA 1O2SA 4ABEA 1ZLRA 1C2KA 4Q7XA 4U30A 4E7NA 5AF9H 4IN2A 4YLQH 1SGCA 4WXIA 1T8MA 1O32A 1V2LT 1IAUA 3F9FA 3ZZ5A 4UFEH 1DFPA 4IN1A 4B2BA 4D7GA 4CBOA 2WPLS 4Y6DA 3S0NA 1LHDH 1HUTH 3ZZAA 3RXDA 3MWIU 2CJIA 3RXRA 4FUCA 3W95A 4ISIH 1QBOA 3Q76A 2YOLA 1TB6H 4NIXA 4FUFA 2A0QB 2R0LA 1NRRH 1MD7A 2KAIA 1UCYE 1TPAE 2Y80A 1VITG 1QRXA 9LPRA 2ZHDA 1UVPA 1P2QA 2ZU4A 1BBRH 1O2QA 3SO3A 2GP9B 1HAYB 1ARCA 1QGFA 3PMAB 1GI9B 2RDLA 1H1BA 1P2NA 3SOSA 3RP2A 1FIWA 1WAYB 1HV7A 1SL3A 5EODA 2ZHQH 3A8CA 4FU7A 1IQJA 4FVBA 4AX9H 3AASA 3BG4C 4JK6A 1JRSA 1GMDF 2WUCA 3R0FA 5E0JA 5F03A 2J92A 1D6RA 3OY5U 4MDSA 5L2ZH 1EZXC 4HFPB 3SNEA 4GVUA 1HAVA 2BTCE 4CRCA 1YLDA 1Z1JA 3SBKA 4DIHH 3T5FH 1CBWC 1TFXA 2UUFB 1N8OB 4K5ZA 1GVZA 2JH0D 1A61H 2FZZA 3OSYA 1UJ1A 3UOUA 2RA3A 2P93A 1C5XB 2UUJB 2AGIX 4K69A 3RU4T 2P8OC 1GMHG 4BAHB 3B23B 1J9CH 5T3HA 2OBQA 4XSKU 2Q6DA 3A87A 1FLEE 1OWHA 3I78A 3HKJB 2VIQA 3N7OA 3GCTF 4YOJA 3SQEE 4J1YA 2QAAA 1X7AC 4B2CA 1LCYA 3PMHB 6CHAB 3NKKA 4DY7B 1YCPH 1Q3XA 3QGJA 1KXCA 4X8TH 3WY8A 4Q2KA 1G36A 1O3LA 5EW1H 3L33A 5CMXH 2C8YB 4NIWA 3HGPA 1VCWA 3ESTA 1S83A 4IC6A 4MPUA 2LPRA 1D3DB 1P03A 4LXBH 1SG8B 2W7UA 5EPYA 1CHOF 3T27A 3P17H 4ZAEA 4RKJB 1QA7A 1HYLA 3O8DA 1TA6A 3RM0H 5CHAC 1L1GA 3V3MA 7LPRA 1P11E 2OTVA 1GHYH 1PPGE 2A7HA 2BZ6H 2ZF0H 2ZPRA 1MH0A 4ABAA 1BJVA 3LC3A 2ANKH 2XBWA 4ISLA 3DHKH 2QC2A 1O5EH 2FP7B 1O2WA 2J9NA 4XE4A 3LJJA 2O8TA 4ZXYH 5FAHA 1FAXA 1RFNA 1WQSA 3I29A 4B2AA 2FO9A 1E37B 2CMYA 4E7RG 1PPCE 1LPZB 2C8ZB 1ZSJA 1YM0A 3MU4A 4UONA 1NN6A 1NFUA 2GZ8A 3LGWA 2BXTH 1PJPA 4B73A 4TYDA 1GBIA 1UHBA 3PLBA 5JPMH 1IQLA 2ANYA 1GHZA 2AYWA 1UTJA 1D3TB 3A84A 1BMMH 3R3GB 4AYVB 4BAQB 4X8SH 3FZZA 1TNGA 1GI2A 1QB6A 5GJ4B 5HM2A 5FPSA 2ZU1A 1ACBE 2JH6D 3MFJA 1AZZA 1QL8A 1GHAF 1GGDB 4I8KA 2HGTH 4Q7YA 1YPLH 3A8DA 1V2WT 3RXAA 1MUEB 1SGIB 2AFQB 4AN7A 4WJG2 2PGBB 2QF3A 2A2XH 1YPKH 1ANEA 1Y59T 3D65E 1HPGA 3RXUA 1GMCF 1PPBH 2FYQA 1H8DH 1Z6JH 1EPTC 3H7TA 2VJ1A 2PUXB 3MH6A 1HAXB 1L4DA 2J2UA 4MNWA 3K9XB 1G3BA 2XCNA 2ZG0H 1MBMA 1C5LH 5FX6A 3ATWA 3PO1C 3U8OH 4IBLH 1DS2E 1YBWA 1EZUC 4DOQA 3GDSA 3RXBA 2AIPA 1O3MA 1OP8A 1YF4A 3FVFB 3RXEA 3SJKA 1SLXB 4XBCA 1Y5BT 1C4V2 1V2KT 2QA9E 2ZDMA 2ZCLP 3E3TA 4JK5A 4Y71A 3BIVH 3KGPA 1LO6A 3KQCA 1SGEE 3SZNA 3ZZ7A 3BTME 1FZZA 3P95A 1K1OA 2GZ7A 1OWEA 1RIWB 2PHBA 3LPRA 1F2SE 3ATLA 2Z94A 2UUYA 3NPSA 3K6YA 4MQAA 4NFEA 4THNH 1A3EH 2BVXH 2BY7X 2A45B 1C2JA 2FIRH 1C5VA 1ZPBA 3MNSA 3T2NA 1CGHA 2BVSH 1O5AB 1P01A 1WSSH 2TGPZ 1NRPH 1C4U2 2TBSA 1A0LA 1KIGH 4DGJA 5DP8A 1S84A 2AEIH 4K3JA 3M36A 4SGAE 3BTGE 2FDAA 1MQ6A 1Y5UT 2P3TB 4WVPE 3V7TA 3RXJA 1SB1H 2ZQ2A 3LGIA 4YT6H 4Y8XA 3H7OA 3AAUA 1Z8IB 1UTLM 1QJ6B 4JYTA 4H4FA 3ZVBA 3GY8A 1SLVB 3PMJA 1BRUP 3BTQE 3TK5A 1HJ8A 3SUGA 1EJNA 2OC0A 2VWNA 1P2KA 1YCPM 1XKBC 1ZYOA 1HLTH 3PLPA 1EOLA 4LZ1H 4QT8C 3A8AA 3PTNA 1GI7B 3BF6H 1GHBG 3P8GA 2Q1JA 3SHCH 1EUFA 3SUDA 1GBKA 2A5AA 2GCHF 3B9FH 2VH0A 3ATMA 1BMNH 3ZVEA 1HAZB 5EXLA 4NWLA 1N6XA 1NS3A 2UWLA 5C20A 3UNQA 2QXGA 5FCKA 2TGDA 4INKA 3MO9A 1EAIA 1G37A 3SQHE 4BANB 2ZNKH 1WTGH 1O3KA 1AGJA 5E8EH 1O39A 1DLKB 1TNJA 4I7YH 1ZTKA 1EPTA 4X6MA 4NIYA 1AE5A 1UVSH 2G55A 3CENA 3GY5A 1DLEA 1P57B 1XUGA 2DUCA 1D3PB 2SGAA 2D26C 1V2RT 2R2MB 1OWDA 2NU3E 2C93B 1O5GH 6CHAC 1JBUH 2V35A 2GZ9A 5TCCA 3V12A 4CRGA 4AG2A 2ZC9H 4Y11E 1K1MA 1FV9A 1ANBA 1TQ0B 1GI6A 1ZHMA 3PM3A 4ZHAA 3UNSA 2FX6A 3VXFH 1DWCH 1O3AA 2OC8A 3IITA 1G2LA 3RXHA 1KXDA 1AQ7A 3C27B 2C90B 1C1WH 1NROH 4ZKOU 2PGQB 3RMOH 5K0HA 2OLGA 2FEQH 1F0TA 2W5EA 2BDHA 1Y3XA 1BTPA 5FPYA 2TIOA 5GCHF 1DPOA 3GCOA 3Q77A 3TLOA 2B9LA 3ODFA 1A1RA 2FM2A 1PPHE 1GL0E 1WCZA 1DANH 3JZ1B 1GI1A 4IMZA 4RN6A 1IQEA 4X6NA 2V0BA 2NU4E 1S5SA 4Z0KA 1GI8B 3QTOH 1AWFH 3U98H 6GCHG 1O3IA 4TWYA 1XXFA 1O2NA 1FN8A 1ELEE 1HAIH 1Q31A 1MBQA 1MTSA 1V2PT 5EXNA 3E90B 4BNRA 1GBDA 1NTPA 2QYIA 1O34A 4CHAB 1SHHB 4ZMAH 1VITH 2OP9A 5EXMA 1W0ZU 2UWPA 2PLXA 1A0HB 1XM1A 5FHTA 4AFUA 1GBMA 1T8NA 3UFAA 1Z71A 1TGSZ 1HAPH 1GGDC 4AFSA 5T6DA 2PSXA 3MNBA 3C1KA 5EQSA 2FOBA 4A7IB 1CT0E 3UOPA 2SNWA 3EYDA 4AB9A 1AUTC 4VGCB 1C5UA 1OXGA 7GCHF 4GPGA 5CE1A 1BMAA 2V6NA 3Q3XA 4ASHA 3LGTA 3M3VA 5C5OA 4DT7B 4O97A 3TNTA 2O8UA 1W12U 4WMEA 4AZ2B 2GDEH 3E8LA 3E6PH 4X0WU 1AHTH 3M5MA 4FUDA 1TNHA 1W10U 5JYIA 1KLJH 1TPOA 2OC1A 1O31A 3BV9B 4GLYA 5GIBA 3SHAH 3PB1E 5I46H 1NU9A 3E91A 2QIQA 3PTBA 2W7SA 2F9VA 1V2VT 5L30H 1VR1H 2B0FA 1K1IA 1FUJA 1TA2A 8KME2 1HGTH 4FUHA 3I77A 4K8BA 4TY7A 1VCPA 4ABIA 1LPGB 2F3CE 1O0DH 2R0KA 1F5KU 1C1SA 1TE0A 1WU1A 1TNLA 1RIWC 1BQYA 2RA0A 2V3OH 2FI5E 2ZEBA 3SU4A 1O5DH 2ZFRH 2AMPA 2B7DH 2FS9A 5FPTA 1ANCA 1ZGIA 1O30A 4UEHH 1LVBA 1W0YH 2ZU3A 1V2OT 2HNTE 2ZP0H 3F1SB 1RD3B 2RG3A 2WINI 1C5PA 1UK4A 2FTMA 3E16B 1RJXB 1TX7A 2J95A 3URCA 7ESTE 4MTBA 5DP7A 3DUXH 3SJOA 4GCHF 2TPIZ 2J34A 4NSVA 3RXIA 3MYWA 1BBRE 4ZH8A 3OX7U 1MQ5A 4K1SA 4HI3A 3GY4A 4JZFH 3RXKA 2A4OA 1AVXA 2BLWA 3BEIB 1H4WA 3SJIA 3KEEA 3NCLA 3RXFA 4R0IA 2ZCHP 4RKOB 3S69A 1TBRH 2Z9IA 1EQ9A 3RMNH 4B74A 3VFEA 1SQTA 2SGDE 2ZFPH 2ODQA 1QBNA 2F9UA 3RDZA 2SGPE 1THPB 1ABIH 1FY1A 2A5IA 1F5RA 5EW2H 1TX6A 5C2ZA 8GCHF 2BDCA 3UNRA 1O2MA 2O8MA 2Q6FA 3LONA 3NUMA 1TALA 3GY6A 4Q80A 3RXCA 2WPMS 3MU8A 4AFQA 1JRTA 2Z7FE 1E36B 3GCHB 2FYRA 1O2YA 5LGOA 3S9BA 1FQ3A 1O37A 3LIWA 1A5HA 1HCGA 1AB9C 5DKMA 1DE7H 1SGDE 1MTWA 5A09A 3SUEA 5E2PA 3EDXB 1GBFA 5A8YA 3UQOA 2P95A 1UTPA 1C1OA 1WOFA 3DD2H 1BJUA 4B1TA 2PTNA 2XXLA 3GDUA 1W11U 4A5TS 2TGTA 4U2WA 5A2MH 1KLTA 2D1JA 1QJ1B 1O33A 2BX3A 2FS8A 3SW2B 3ZVGA 3BTHE 1XUJA 3ZZDA 1BRAA 2ZGBH 5HYOA 2RCEA 1GJ9B 1P2JA 1S6HA 2PW8H 1NU7B 1KXEA 1OWKA 1CGJE 4ZHMU 2VNTA 2WPHS 3M5OA 3SV6A 4DIIH 4CR5A 1EAWA 1O2VA 3URDA 2ZPSA 2TRMA 4I8JA 1ZTJA 1BB0B 1OYTH 1VGCB 2GDDA 1P9UA 3MU5A 2NWNA 1GJ5H 1HB0B 1C2GA 1B5GH 1JOUB 1ZPZA 1GHAG 3LH3A 1L0ZA 1O2LA 4D8NA 3G01A 1YP9A 1SFIA 2W26A 3TJOA 2FLBH 1P09A 4M7GA 3A7TA 1GJDB 1SBWA 1MKWK 2SNVA 2ESTE 1BTUA 4I8GA 3KNXA 2GVFA 2Z9JA 1EAXA 1Z7KA 3MH5A 3D49H 1CSOE 2Z9KA 1FN6A 3ATIA 4NIVA 2HPPH 2ZCKP 4FUGA 2C8WB 5JB8S 2AIQA 5C1YA 2HLCA 3VB4A 4BTUB 1QL7A 5J4QA 1JMOH 2ZFQH 4ZXXH 4I8HA 4CHAC 2IJOB 1V3XA 3ITIA 1C5QA 2DE8A 1ETTH 1FONA 1O2UA 2ZWLH 3ATKA 5F8XA 1GBCA 1MAXA 2G81E 3KQBA 4NA9H 1EP5A 3NK8A 1HAHH 5TJXA 3RUOA 4Y79A 3LU9B 3S7KB 3U9AH 2AGEX 4Z6AH 3PLKA 3IWMA 3KF2A 1WBGB 2VH6A 5C5NA 1SOTA 5T6GA 1N1LA 1P0SH 1SQAA 5EG4A 2ZDKA 1MKXK 1THRH 1O2XA 1MTVA 2PKAB 1C5ZB 4UFFH 5LPRA 4VGCC 2OD3B 3D62A 3ZZCA 1T4VH 1O2OA 2FODA 1C5MD 3CS7A 3PWBA 1QB9A 1TRYA 2VVUA 3ZZBA 1BA8B 2H9TH 4IMQA 1BCUH 2BVRH 1PQ8A 2VINA 1O3BA 5AVDA 1TIOA 1DDJA 2JETB 1UTMA 1THSH 1EAUA 1KYNA 4Y0ZE 4DCDA 1JIMA 1EJAA 1S85A 1TLDA 5C3NA 1TWXB 2FMJA 3SI3H 3M7UA 4X1PU 1OX1A 2ZGJA 2G4UA 1SGYE 1Y3UA 2HWLB 3ZZ8A 1BTXA 2A7CA 1UK2A 1NO9H 2SFAA 3AW1A 1U6QA 3FANA 4UDWH 3TH2H 3QDZB 2F9OA 1C1MA 1GI0A 1DXWA 1BTYA 3M5LA 1ZHRA 2Z3CA 4LK4A 1ORFA 2HPQH 4CR9A 1UO6A 4MPVA 2VVVA 1O2KA 1CT2E 2BD2A 4IS5A 1F92A 4ISNA 1ZRKA 1BITA 1C1PA 1VJAU 3P8FA 2UUKB 3ELAH 5DP5A 1DUEA 1AD8H 1T8OA 2W3IA 1UTNA 2C8XB 1RXPA 2K1QA 1YPGH 2QCYA 1Q2WA 3RM2H 3RU4E 5DP6A 4F4OC 5JBCS 2GT7A 3TGKE 2CF9H 2WYJA 2EEKA 3QZRA 1MKWH 3EGKH 3TJVA 2EI8A 2VWMA 1GMHF 4CRAA 1FXYA 2I6SA 2Z9GA 4FU8A 1S6FA 1NZQH 1SPJA 1H9HE 2P3FH 1V2UT 1TGTA 1V2JT 2ZU5A 1CA0B 4NCYA 5C1UA 1GCDA 4D76A 3FP6E 2ZPQA 1V2TT 2G51A 1ARBA 1IHSH 1W3CA 2FPZA 3QX5H 4NA8A 2FXRA 2H5CA 2M5TA 1ZMLA 1O2TA 1V2NT 5GWZA 1TMUH 4BAMB 5E0GA 4K2YA 3STJA 4O3UA 3E0NB 2VIWA 2BLQA 3FP7E 1ZHPA 1YKTA 1ZJDA 2ZI2H 4FUJA 1SGQE 1IQHA 1K2I1 3GCHC 1MKXH 3OYPA 2JH5D 1OPHB 2R3YA 2B8OH 1Y5AT 5EGMA 1N6YA 1C2MA 3S7HB 5G4BA 1HIAB 1SQOA 3HPTB 1P04A 1QB1A 2ANWA 2F9BH 2ODYB 3TVJB 5JBBS 1QL9A 1UTOA 1XKAC 3M37A 1ELVA 4SGBE 3QZQA 1T8LA 2BM2A 2FOHA 3HK6B 1O3HA 5HGGA 3A88A 1RRKA 1RTLA 2BY8X 2FOGA 3V0XA 1FPCH 1D6WA 5H4IB 1TONA 1O3DA 1O35A 3BEFB 1GI3A 4FXGH 5T6FA 4ABJA 1LVOA 4K8YA 4ABBA 1YLCA 5J4SA 1V2ST 3TPIZ 3SV8A 4NZQA 1F0RA 3IG6B 3MO3A 3RLYH 1P02A 2PKSB 3LH1A 1TQ7B 1QIXB 2QY0B 1A2CH 1AY6H 5EOKA 1UK3A 1TPPA 3LDXH 5LH8A 3VEQB 1P9SA 1D4PB 1NESE 1EB1H 1EASA 1TNKA 4HZHA 2GMTC 2THFB 3RXGA 3SV7A 1GI5A 1XX9A 3Q3YA 2BY5X 3RC4A 1VJ9U 4MNVA 3MH7A 3RXPA 1VGCC 4INLA 4X8VH 1O2RA 3RMMH 1C5SA 1P2MA 1GBEA 1PYTD 1YPHE 2FI4E 1AB9B 1SLWB 2OQUA 5IYTA 4I32A 4YLUA 4UE7H 1TOCB 5C1XA 1BTHH 3EA7A 1GBHA 2VIPA 1P3CA 3QN7A 1INCA 1TNIA 2H2ZA 2HNTF 4HGCA 4WH8A 3SJ9A 1RGQA 1PQ7A 3E0PB 1TOMH 3MTYA 1AI8H 3EAJA 1OWIA 3MI4A 5DP9A 1OP2A 4WMDA 3M3SA 2HRVA 4Y7AA 5JBTA 5K7RA 3TJUA 1LHCH 1P10A 2OXSA 1GJAB 1JXPA 2BDIA 4GHQA 4PROA 4H6SB 2OINA 4IW4E
chains in the Genus database with same CATH superfamily
2CGAA 3QUMP 2FWWA 4YZUA 1LHFH 1HBTH 3JZ2B 1QHRB 5DPAA 3M7TA 4K60A 2QN5T 3CP7A 4A92A 4BXSA 1YYY1 3TU7H 3QLPH 1A5IA 1HDTH 1GG6B 1O5FH 5DG6A 2BDGA 3LT3A 1KXAA 2AMQA 2WPJS 2BX4A 1C1VH 1SGTA 2KZ4A 5EPNA 2Z3DA 3E1XB 1H8IH 1BTZA 1DUAA 3A86A 4P02A 1YPJH 4CRFA 2V3HH 1Z1IA 1DITH 1V6DA 1EATA 5DP4A 3O8RA 1DOJA 1SGRE 4AOQA 2BYAX 4ZROA 2PWXA 4OS7A 5DN6D 2VWOA 2JETC 1AWHB 1OP0A 1QQ4A 3SU6A 1FJSA 3BG8A 3GYMA 5A0AE 5EU8A 3M5NA 1E35B 1B0FA 2F9NA 4X2YA 1E1QD 1TX8A 2Y81A 1ZJKA 5AFZH 1EOJA 2XTTB 4OS1A 2ALPA 2WUBA 4AYYB 1QJ7B 2P3UB 4XBDA 2XC5A 3T29A 1COWD 1CA8B 2EI7A 3A81A 1P2OA 3T25A 3H09A 3W94A 1G3EA 3MMGA 4OS4A 1P12E 1UTQA 4MPWA 1GL1A 1IQIA 1O2PA 3TGJE 1EB2A 1BHXF 1GHBF 1SOZA 2VGCB 2XRCA 2ZZUH 3U69H 3KL6A 1AKSB 3SNBA 1Y3WA 1DSTA 3SNDA 3UR9A 3ZZ6A 2AMDA 1LHEH 4INHA 3PRDA 2GV7A 1SGNE 2BOKA 4JCNA 2R2WU 5GPIB 3FKSD 1ELFA 2ZDLA 1VZQH 1BT7A 1IQGA 3P8OA 3MNXA 1GVKB 1K1NA 3RXVA 2G52A 4FVDA 2XWBI 3STIA 1YPEH 1QY6A 2ZDNA 4ABDA 4Y8ZA 1LKAA 2WPIS 2W3KA 1AFEH 3OTJE 4KP0A 1A46H 3UREA 1RTKA 3UWIA 5L2YH 4YESB 3SUFA 1LVYA 2K8IA 1EFRD 1CA0C 1ZMJA 3RXMA 5CDFE 2CV3A 1DWBH 1HJAC 1ESAA 3HKIB 4FU9A 4WF8A 3GY2A 2ZTXA 3NRLA 1F5LA 1WQVH 4MPXA 2CXVA 2XNDD 5T1VA 4ZKRU 1TGNA 5DO4H 2G5VA 5IDKA 1JWTA 1K1PA 1SFQB 1S0QA 4WXVA 3U28C 3F0OA 3K6ZA 1G3CA 1AFQC 1C2FA 1UVTH 3RC5A 2FOCA 1GJ8B 1DXPA 5A0CA 2VB0A 2ZDAH 4I31A 3TJNA 1S6LA 2G00A 5DSFA 1MTNB 1O3FA 4Y0YE 3K65B 3P8NA 3H5CB 4RT0A 2ASUB 5A8XA 1BIOA 2L6OA 1IOEA 1E1RD 1E0FD 2HNTC 1GHXH 1ZOMA 1FDPA 5HMAA 5JBAS 5F6MA 4IC5A 1PPZA 2O8LA 2GV6A 4K1TA 4Y8YA 3Q00A 2AH4X 1HFDA 3VPKA 3A7WA 2Y82A 3F9HA 4AFZA 2A4RA 1O3CA 4I86A 1GMDG 1G2MA 1NFYA 1ABJH 1DY9A 4A1XA 1GBLA 6GCHF 2ODPA 1A7SA 1BTWA 2C4FH 2YMSC 2O9QA 9ESTA 3BTWE 1TMTH 1UVOA 3CS0A 1MU8B 1C5RA 2WPKS 3ZYDA 1SHYA 7KMEH 3BTEE 1LMWB 4YO9A 4B75A 3D23A 1IQMA 2EC9H 5AHGH 2PKSC 1K28D 5I25A 1C5OH 3RXOA 1J17T 2BLVA 1CHGA 1G32B 2ZHWH 1W14U 3GCTG 1TYNA 2F9PA 2ZIQH 4O03A 1QZ8A 1TAWA 1HXEH 4ZCNA 6ESTA 4YTAA 1ESTA 1LDTT 2FLRH 3PV5A 1AVWA 2ZA5A 1FAKH 4RT1A 5FXLA 3MH4A 1OKXA 4ISHH 2VBCA 2HVXA 4X1QU 3MU0A 1O3JA 3BTDE 1C5NH 2PUQH 2XC0A 4HTCH 4ZUHA 3NWUA 3SV9A 2P94A 2GD4B 4XDEA 2ZHFH 5BRRE 2STAE 5LPFA 1UCYK 3MHWU 3ZVFA 4FUBA 4H6TA 3EA8A 1CHOG 2PR3A 4A1VA 4GAWA 2A2QH 1SLUB 4JYUH 4LOYH 1HRTH 5JDUB 3OE7D 2F83A 3F9EA 2LELA 1PQAA 2EY4C 4BAOB 2GCTB 3RXLA 1AMHA 2Y6TA 3F9GA 5CHBA 1LQEA 2H5DA 3ZVDA 1YGCH 1D3QB 4ZHLU 4ABFA 1O3NA 3HATH 1EZSC 5DP3A 2KM0A 1E38B 2SGQE 1BRCE 1K1LA 2BLOA 2GX4A 1VKYA 3M61U 2XCFA 1RS0A 1B7XB 1GDQA 3ZZ3A 2GMTB 1GG6C 1W8BH 2ZU2A 4U01A 4YT7H 1AVGH 3A80A 4FUEA 3OEHD 5DJ7A 1MAYA 1MMJN 3F6UH 5A8ZA 3UTUH 4OS5A 4KKDA 1HIAA 3QO6A 1S82A 4ESTE 2XBVA 3GY3A 1CVWH 1G30B 1H9LB 3UIRA 2QXJA 2WYGA 3SU1A 1XUHA 1J15A 4MNYA 1GHVH 2G4TA 3OTPA 1FX0B 1GBBA 2R3UA 3ZZ4A 4YOGA 3VB7A 1A3BH 2VIOA 1FY8E 1GCTB 2ZHEH 2ZTYA 4O9VA 1PQ5A 1QBVH 1AU8A 1F0SA 1P8VC 1LHGH 3NZIA 1QRWA 2ZFTA 1O3EA 5C0UA 1SC8U 4FUIA 1ESBA 3GOVB 5FCRA 1GMCG 3DSOA 2PV9B 4JZEH 2D2DA 1MZAA 1TRNA 3MU1A 4NG9H 1MCVA 1Z8JB 3T28A 2ZDVH 1QQUA 2XBXA 2FX4A 3RMLH 1BMLA 2ZQ1A 4O3TA 1JIRA 1KSNA 1Y3VA 3FZDA 4P00A 1CGIE 1OOKB 3O8CA 1Z6EA 1BRBE 1W7XH 2FI3E 3LKWA 1H8HD 2FOAA 1GBAA 4JZIA 4NGAH 1A4WH 1CU1A 2BQ6B 5HKKD 1XXDA 2VGCC 1C5YB 2D8WA 2AGGX 5F53A 2P16A 3T62A 3F2GA 3ZV8A 5ESBA 5E0HA 1FY4A 1NRSH 4MG3A 3BTKE 1GBTA 4GSOA 2KCYA 1O3GA 3OY6U 3O8BA 1GVLA 2OK5A 1WV7H 2YMSD 1SR5C 4E06H 1LPKB 1QCPA 1Y3YA 1UCYH 3SNCA 3UPEA 3OU0A 3QGNB 2WZQA 2EI6A 3DFLA 3GICB 3FO8D 1OSSA 3GYLB 2BQ7B 1WUNH 1QR3E 2P59A 4YOIA 3ZV9A 4AORA 1SSXA 1C5WB 1SI5H 1J16A 2STBE 1ZRBA 4ABHA 4AGJA 4BAKB 2Y7ZA 2WSSD 1Z8GA 1PYTC 3SGBE 3P6ZB 4MVNA 3SU3A 4IGDA 1VITF 3DT0H 1C2LA 3SU5A 3SI4H 1F7ZA 1MCTA 4KTUA 1TBQH 2GJGA 2ILNA 4X2XA 3SORA 2BDYA 1LVMA 1C5TA 2A4GA 5ABWA 2A1DB 3PMBB 8ESTE 3AAVA 3TGIE 4Q4LA 2ULLA 4KGAA 1KDQB 1PPEE 4TPIZ 3UQVA 2FOFA 1TMBH 3M7QA 2A7JA 1K1JA 2Q6GA 2KX4A 1MTNC 4UFDH 1DM4B 3A7ZA 1MZDA 1YC0A 2BD9A 4JYVH 4X2VA 3SN8A 1C2IA 1ETSH 4X8UH 5HM9A 1GBJA 2QXIA 2JJ1D 3A85A 1EXFA 3PWCA 3A89A 1NBMD 3V13A 3QK1A 3PRBA 1FNIA 2Y5FA 4CRBA 4XBBA 1TABE 1QRZA 2GCHG 3RLWH 1O2IA 3P70B 1KTSB 1WTHD 5C67A 3TK9A 3WWFA 2WPDD 3AW0A 5FX5A 5A0BA 5DK1A 3SGQE 1C4Y2 4Y76A 4ACBA 4MNXA 3SGAE 3SNAA 2F91A 1ZR0A 3U1JB 1C2HA 2CHAC 3U1IB 3SV2H 1HJAB 1O36A 3AVZA 4WH6A 5ETXA 4GHTA 4BTTB 3TH3H 1AZ8A 2IOTA 4X6OA 1O3OA 2OCVB 4U32A 1DT2A 4X1NU 3TNSA 4WY3A 4NSYA 4E05H 3TH4H 3EA9A 6LPRA 1QA0A 4CRDA 2F4LA 1XUIA 2KAIB 2Z9LA 1AFQB 3K2UA 1O2HA 1ZPCA 1C1NA 1GI4A 1AKSA 2BD3A 4Q63A 2FESH 2J38A 1XUKA 1HNEE 3VB3A 1D9IA 1O2ZA 2AERH 3WW7A 1UVUH 2L74A 1J8AA 1NFWA 2A5KA 4Y10E 4ASUD 4CH2B 4JMYA 2BXUH 2UWOA 3PROA 1C2EA 1XVOA 1KMHB 2SGEE 4TPYA 3UWJH 4DURA 2IN2A 4MLFB 3ZYEA 2QXHA 2CN0H 1AIXH 2FTLE 2B5TB 2O8WA 4KTCA 1EZQA 1W0JD 5GCHG 3VXEH 2PTCE 2QE7D 1C9PA 4OGXA 1L1NA 1W13U 3EQ0H 1HAVB 3MNCA 1MABB 1NM6A 2YMSB 1C1TA 1XUFA 3KQEA 1W7GH 2G8TA 2GCTC 1TBZH 1P2IA 3F68H 1ELCA 4NWKA 3BSQA 1Z8RA 3FFGA 1NRQH 3RC6A 5B6OA 4LZ4B 2XWAA 3M3TA 2DE9A 2ALVA 5F8TA 4XFQA 3S9AA 3VGCB 4DJZB 3ZVCA 1CT4E 2HALA 3A7VA 1O5BB 1V2MT 3BTFE 2AS9A 1CQQA 1DVAH 2ZGXH 5GXPA 2Y5HA 2F43B 2TGAA 1AE8H 2ZGCA 4BTIB 1LKBA 4TWWA 2BY6X 1OYQA 2VIDA 2BB4A 1UMAH 3MQKC 1SGFA 3QTVH 4B6EA 2VWLA 4Z1MD 1C1RA 1YPHC 3LGUA 1G9IE 4A6LA 3A7XA 1PFXC 2BDBA 2H9EH 1KXFA 2J98B 2XW9A 4ABGA 4XRNA 1GCTC 2BQWB 1IQKA 3A7YA 1ZSKA 2W6JD 4B76A 5BPEA 2ANMH 2FOMB 1W2KH 2XC4A 7GCHG 1HAOH 1M9UA 3TITA 1GDUA 2J97A 1NPMA 1ETRH 3FAOA 5DGJA 2WV4A 4R8TB 3SU0A 3KHVA 4D9RA 2YNBA 1HXFH 1N8OC 1GHWH 1GJ6A 4JZDH 4B71A 3DFJA 1GPZA 3BIUH 4X1RU 1BHXB 1E79D 2VIVA 3PV4A 1QTFA 2BD4A 1V2QT 1XVMA 1IHTH 4UFGH 3F0PA 2A4QA 1GDNA 4UD9H 1ZZZA 3RU4D 1Y8TA 4OGYA 4Y7BA 4D9QA 4WWYA 5PTPA 1UHBB 1C2DA 1TPSA 1P05A 4I33A 1L2EA 4J2YB 1ZMNA 5EJLA 1T31A 4WMFA 2JDID 1G3DA 1RTFB 3TK6A 1DWEH 2J4IA 1XMNB 1K21H 2GTBA 1HAGE 2XOKD 1IQFA 3LGVA 4BXWA 4X2WA 3LGYA 1MU6B 2YNAA 3GISB 4I8LA 1A5GH 5JB9S 1FY3A 2BD8A 3HK3B 1NRNH 3TIUA 1NFXA 3BG4B 2OBOA 4H42U 3L3TA 2GGVB 4TY6A 3S9CA 4KELA 1P06A 1S0RA 1MD8A 3A8BA 1OWJA 1ELDE 2NU0E 2GT8A 1DICA 4ZKNU 1F0UA 3RXQA 2H1UA 1CBWB 5HXFA 4GCHG 2BOHB 3BTTE 3EE0B 1OS8A 2ZTZA 1ZSLA 1FI8A 1TRMA 1ID5H 2P8OB 2LNCA 3FP8E 2H6MA 4K1EA 5TCAA 1J14A 3KN2A 1FPHH 1T7CA 2BD5A 5IK2D 2I6QA 1GWAA 1WYKA 1TGBA 2FOEA 5HIYA 1CO7E 1BDAA 3LJOA 3M35A 2ZECA 2IPHA 2ZGHA 3SU2A 2J94A 4OM9A 3ZZ9A 1AN1E 3L6PA 1NC6A 1SVPA 1ZGVA 2W6ID 2EA3A 4KTSA 3GCNA 1LQDB 8GCHG 4OS2A 1ANDA 3SJ8A 1E34B 1K9OE 2VVCA 4NZLA 4F55A 5F8ZA 2Z3EA 2VU8E 3P92A 2Z6BD 1GJ7B 1ELGA 1EP6A 2NU1E 1EKBB 1EJMA 3OEED 3BEUA 2Y7XA 3KIDU 3NXPA 3DA9B 4NA7A 1ELAA 3ODDA 3PYHA 1P3EA 4X6PA 2SGFE 1CE5A 1FY5A 4FETA 5CHAB 3MO6A 1B0EA 3UR6A 3MOCA 4NFFA 3LOXA 1KLIH 1GJBB 4AG1A 4D7FA 5ESTE 2R9PA 1GJCB 1QNJA 3RXTA 1DY8A 3B8JA 3T26A 5SGAE 3GY7A 5FBIA 1C1UH 4ISOA 1SGFG 1IQNA 2A32A 3A83A 2BD7A 1PPFE 2GKVE 3A82A 2XBYA 3UY9A 3KCGH 1O2JA 2BY9X 4JZ1A 1C1QA 3HGNA 1S81A 2BHGA 1KXBA 4RSPA 2QF0A 2OQ5A 1QURH 3ZVAA 1L1JA 3VB6A 1O38A 2PKAA 3Q3KA 3LC5A 5EQRA 1BBRK 4F49A 1DWDH 2QV1A 2QGRA 4YM9A 1GJ4H 1K22H 1KTTB 1H9IE 1ZTLA 2Y5GA 4DW2U 5C0TA 2PSYA 1DSUA 1BZXE 3U8RH 2OC7A 2HOBA 2NU2E 1T4UH 1NY22 1UTKA 3QWCH 1L4ZA 2WV5A 1AUJA 4DVAU 2BMGB 4OS6A 2A31A 5AFYH 4XOJA 4CH8B 4M9FA 1TGCA 1SGPE 3DCLA 1AO5A 1ELBA 3ENSB 5EQQA 2ZKSA 1FMGA 1SMFE 2CHAB 2RFKC 4TT3D 1A0JA 4B6FA 1EPTB 4DG4A 4ZKSU 3RXSA 1FIZA 2XNIA 2G5NA 5KEDA 4Q7ZA 3U8TH 4AGKA 1QFKH 3VB5A 3VGCC 2ZFFH 1VCQA 5L6NH 1KY9A 2XYAA 2ZO3H 3PO1B 3GDVA 1KDQA 4A1TA 2H9HA 4AB8A 1O3PB 1MTUA 4BOHA 5E2OA 1NT1A 2CF8H 1BOQA 1UW7A 1O5CB 4X1SU 2ZFSA 2OUAA 3BN9A 2C3SA 1ELTA 4GUXA 5GDSH 5FBEA 1YCPK 1YPMH 1DX5M 1LTOA 4CBNA 3KQDA 1HJ9A 1T32A 1O2GH 1BUIA 1C9TA 1EX3A 3UUZA 2BDAA 5LPEA 4CREA 2BZAA 8LPRA 2JKHA 2PFEA 1O2SA 4ABEA 1ZLRA 1C2KA 4Q7XA 4U30A 4E7NA 5AF9H 4IN2A 4YLQH 1SGCA 4WXIA 1T8MA 1O32A 1V2LT 1IAUA 3F9FA 3ZZ5A 4UFEH 1DFPA 4IN1A 4B2BA 4D7GA 4CBOA 2WPLS 4Y6DA 3S0NA 1LHDH 1HUTH 3ZZAA 3RXDA 3MWIU 2CJIA 3RXRA 4FUCA 3W95A 2HLDD 4ISIH 1QBOA 3Q76A 2YOLA 1TB6H 4NIXA 4FUFA 2A0QB 2R0LA 1YY3A 2KAIA 1NRRH 1MD7A 1UCYE 3GS9A 1TPAE 2Y80A 1VITG 1QRXA 2EQNA 9LPRA 2ZHDA 1UVPA 1P2QA 2ZU4A 1BBRH 1O2QA 3SO3A 2GP9B 1HAYB 1ARCA 1QGFA 3PMAB 1GI9B 2RDLA 1H1BA 1P2NA 3SOSA 3RP2A 1FIWA 1WAYB 1HV7A 3CNRA 1SL3A 5EODA 2ZHQH 3A8CA 4FU7A 1IQJA 4FVBA 4AX9H 3AASA 3BG4C 4JK6A 1JRSA 1GMDF 2WUCA 3R0FA 5E0JA 5F03A 2J92A 1D6RA 3OY5U 4MDSA 5L2ZH 1EZXC 4HFPB 3SNEA 4GVUA 1HAVA 2BTCE 4CRCA 1YLDA 1Z1JA 3SBKA 4DIHH 3T5FH 1CBWC 1TFXA 2UUFB 1N8OB 4K5ZA 1GVZA 2JH0D 1A61H 2FZZA 3OSYA 1UJ1A 3UOUA 2RA3A 2P93A 1C5XB 2UUJB 2AGIX 4K69A 3RU4T 2P8OC 1GMHG 4BAHB 3B23B 1J9CH 2AHME 5T3HA 2OBQA 4XSKU 2Q6DA 3A87A 1FLEE 1OWHA 3I78A 3HKJB 2VIQA 3N7OA 3GCTF 4YOJA 3SQEE 4J1YA 2QAAA 1X7AC 4B2CA 1LCYA 3PMHB 6CHAB 3NKKA 4DY7B 1YCPH 1Q3XA 3QGJA 1KXCA 4X8TH 3WY8A 4Q2KA 1G36A 1O3LA 5EW1H 3L33A 5CMXH 2C8YB 4NIWA 3HGPA 1VCWA 3ESTA 1S83A 4IC6A 4MPUA 2LPRA 1D3DB 2LP6A 1P03A 4LXBH 1SG8B 2J98A 2W7UA 5EPYA 1CHOF 3T27A 3P17H 4ZAEA 4RKJB 1QA7A 1HYLA 3O8DA 1TA6A 3RM0H 5CHAC 1L1GA 3V3MA 7LPRA 1P11E 2OTVA 1GHYH 1PPGE 2A7HA 2BZ6H 2JIZD 2ZF0H 2ZPRA 1MH0A 4ABAA 1BJVA 3LC3A 2ANKH 2XBWA 4ISLA 3DHKH 2QC2A 1O5EH 2FP7B 1O2WA 2J9NA 4XE4A 3LJJA 2O8TA 4ZXYH 5FAHA 1FAXA 1RFNA 1WQSA 3I29A 4B2AA 2FO9A 1E37B 2CMYA 4E7RG 1PPCE 2V3MA 1LPZB 2C8ZB 1ZSJA 1YM0A 3MU4A 4UONA 1NN6A 1NFUA 2GZ8A 3LGWA 2BXTH 1PJPA 4B73A 4TYDA 1GBIA 1UHBA 3PLBA 5JPMH 1IQLA 2ANYA 1GHZA 2AYWA 1UTJA 1D3TB 3A84A 1BMMH 3R3GB 4AYVB 4BAQB 4X8SH 3FZZA 1TNGA 1GI2A 1QB6A 5GJ4B 5HM2A 5FPSA 1WDIA 2KCOA 2ZU1A 1ACBE 1K0HA 2JH6D 3MFJA 1AZZA 1QL8A 1GHAF 1GGDB 4I8KA 2HGTH 4Q7YA 1YPLH 3A8DA 1V2WT 3RXAA 1MUEB 1SGIB 2AFQB 4AN7A 4WJG2 2PGBB 2QF3A 2A2XH 3KYFA 2RDEA 1YPKH 1ANEA 1Y59T 3D65E 1HPGA 3RXUA 1GMCF 1PPBH 2FYQA 1H8DH 1Z6JH 1EPTC 3H7TA 2VJ1A 2PUXB 3MH6A 5C94A 1HAXB 1L4DA 2J2UA 4MNWA 3K9XB 1G3BA 2XCNA 2ZG0H 1MBMA 1C5LH 5FX6A 3ATWA 3PO1C 3U8OH 4IBLH 1DS2E 1YBWA 1EZUC 4DOQA 3GDSA 5B6LA 3RXBA 2AIPA 1O3MA 1OP8A 1YF4A 3FVFB 3RXEA 3SJKA 1SLXB 4XBCA 1Y5BT 1C4V2 1V2KT 2QA9E 2ZDMA 2ZCLP 3E3TA 4JK5A 4Y71A 3BIVH 3KGPA 1LO6A 3KQCA 1SGEE 3SZNA 3ZZ7A 3BTME 1FZZA 3P95A 1K1OA 2GZ7A 1OWEA 1RIWB 2PHBA 3LPRA 1F2SE 3ATLA 2Z94A 2UUYA 3NPSA 3K6YA 4MQAA 4NFEA 4THNH 1A3EH 2M2AA 2BVXH 2BY7X 2A45B 1C2JA 2FIRH 1C5VA 1ZPBA 3MNSA 3T2NA 1CGHA 2BVSH 1O5AB 1P01A 1WSSH 2TGPZ 1NRPH 1C4U2 2TBSA 1A0LA 1KIGH 4DGJA 5DP8A 1S84A 2AEIH 4K3JA 3M36A 5KECA 4SGAE 3BTGE 2FDAA 1MQ6A 1Y5UT 2P3TB 4WVPE 3V7TA 3RXJA 1SB1H 2ZQ2A 3LGIA 4YT6H 4Y8XA 3H7OA 3AAUA 1Z8IB 1UTLM 1QJ6B 4JYTA 3FOAA 4H4FA 3ZVBA 3GY8A 1SLVB 3PMJA 1BRUP 3BTQE 3TK5A 1HJ8A 3SUGA 1EJNA 2OC0A 2VWNA 1P2KA 1YCPM 1XKBC 1ZYOA 1HLTH 3PLPA 1EOLA 4LZ1H 4QT8C 3A8AA 3PTNA 1GI7B 3BF6H 1GHBG 3P8GA 2Q1JA 3SHCH 1EUFA 3SUDA 1GBKA 2A5AA 2GCHF 3B9FH 2VH0A 3ATMA 1BMNH 3ZVEA 1HAZB 5EXLA 4NWLA 1N6XA 1NS3A 2UWLA 5C20A 3UNQA 2QXGA 5FCKA 2TGDA 4INKA 3MO9A 1EAIA 1G37A 3SQHE 4BANB 5EIYA 2ZNKH 1WTGH 1O3KA 1AGJA 5E8EH 1O39A 1DLKB 1TNJA 4I7YH 1ZTKA 1EPTA 4X6MA 4NIYA 1AE5A 1UVSH 2G55A 3CENA 3GY5A 1DLEA 1P57B 1XUGA 2DUCA 1D3PB 2SGAA 2D26C 1V2RT 2R2MB 1OWDA 2NU3E 2C93B 4DT4A 1O5GH 6CHAC 1JBUH 2V35A 2GZ9A 5TCCA 3OAAD 3V12A 4CRGA 4AG2A 2ZC9H 4Y11E 1K1MA 5FL7D 1FV9A 1ANBA 1TQ0B 1GI6A 1ZHMA 3PM3A 4ZHAA 3UNSA 2FX6A 3VXFH 1DWCH 1O3AA 2OC8A 3IITA 1G2LA 3RXHA 1KXDA 1AQ7A 3C27B 2C90B 1C1WH 1NROH 4ZKOU 2PGQB 3KQ5A 3RMOH 2OLGA 5K0HA 2FEQH 1F0TA 2W5EA 2BDHA 1Y3XA 1BTPA 5FPYA 2TIOA 5GCHF 1SKYE 1DPOA 3GCOA 3Q77A 4FOUC 3TLOA 2B9LA 3ODFA 1A1RA 2FM2A 1PPHE 1GL0E 1WCZA 1DANH 3JZ1B 1GI1A 4IMZA 4RN6A 1IQEA 4X6NA 2V0BA 2NU4E 1S5SA 4Z0KA 1GI8B 3QTOH 1AWFH 3U98H 6GCHG 1O3IA 4TWYA 1XXFA 1O2NA 1FN8A 1ELEE 1HAIH 1Q31A 1MBQA 1MTSA 1V2PT 5EXNA 3KYGA 3E90B 4BNRA 1GBDA 1NTPA 2QYIA 4XD7D 1O34A 4CHAB 1SHHB 4ZMAH 1VITH 2OP9A 5EXMA 1W0ZU 2UWPA 2PLXA 1A0HB 2QF5A 1XM1A 5FHTA 4AFUA 1GBMA 1T8NA 3UFAA 1Z71A 1TGSZ 1HAPH 1GGDC 3SYJA 4AFSA 5T6DA 2PSXA 3MNBA 3C1KA 2KCPA 5EQSA 2K0QA 2FOBA 4A7IB 1CT0E 3UOPA 2SNWA 3EYDA 4AB9A 1AUTC 4VGCB 1C5UA 1OXGA 7GCHF 4GPGA 5CE1A 1BMAA 2V6NA 3Q3XA 4ASHA 3LGTA 2HVYB 2IJD1 3M3VA 5C5OA 4DT7B 4O97A 3TNTA 2O8UA 1W12U 4WMEA 4AZ2B 2GDEH 3E8LA 3E6PH 4X0WU 1AHTH 3M5MA 4FUDA 1TNHA 1W10U 5JYIA 1KLJH 1TPOA 2OC1A 1O31A 3BV9B 4GLYA 5GIBA 3SHAH 3PB1E 5I46H 1NU9A 3E91A 2QIQA 3PTBA 2W7SA 2F9VA 1V2VT 5L30H 1VR1H 2IPQX 1OHHD 2B0FA 1K1IA 1FUJA 1TA2A 1YLNA 8KME2 1HGTH 4FUHA 3I77A 4K8BA 4TY7A 1VCPA 4ABIA 1LPGB 2F3CE 1O0DH 2R0KA 1F5KU 1C1SA 1TE0A 1WU1A 1TNLA 1RIWC 1BQYA 2RA0A 2V3OH 2FI5E 2ZEBA 3SU4A 1O5DH 2ZFRH 2AMPA 2B7DH 2FS9A 5FPTA 1ANCA 1ZGIA 1O30A 2CK3D 4UEHH 1LVBA 1W0YH 2ZU3A 1V2OT 2HNTE 2ZP0H 3F1SB 1RD3B 2RG3A 2KCAA 2WINI 3FN8A 1C5PA 1UK4A 2FTMA 3E16B 1RJXB 1TX7A 2J95A 3URCA 7ESTE 4MTBA 5DP7A 3DUXH 3SJOA 4RI0A 4GCHF 2TPIZ 2J34A 4NSVA 3RXIA 3MYWA 1BBRE 4ZH8A 3OX7U 1MQ5A 4K1SA 4HI3A 3GY4A 4JZFH 3RXKA 2A4OA 1AVXA 2BLWA 3BEIB 1H4WA 3SJIA 3KEEA 3NCLA 3RXFA 4R0IA 2ZCHP 4RKOB 3S69A 1TBRH 2Z9IA 1EQ9A 3RMNH 4B74A 3VFEA 1SQTA 1H8ED 2SGDE 2ZFPH 2ODQA 1QBNA 2F9UA 3RDZA 2SGPE 1THPB 1ABIH 1FY1A 2A5IA 1F5RA 5EW2H 1TX6A 5C2ZA 8GCHF 2BDCA 3UNRA 1O2MA 2O8MA 2Q6FA 3LONA 3NUMA 1TALA 3GY6A 4Q80A 3RXCA 2WPMS 5HIZA 3MU8A 4AFQA 1JRTA 2Z7FE 1E36B 3GCHB 2FYRA 1O2YA 5LGOA 3S9BA 1FQ3A 1O37A 3LIWA 1A5HA 1HCGA 1AB9C 5DKMA 2KFWA 1DE7H 1SGDE 1MTWA 5A09A 3SUEA 5E2PA 3EDXB 1GBFA 5A8YA 3UQOA 2P95A 1UTPA 1C1OA 1WOFA 3DD2H 1BJUA 4B1TA 2PTNA 2XXLA 3GDUA 1W11U 4A5TS 2TGTA 4U2WA 5A2MH 1KLTA 2D1JA 1QJ1B 1O33A 2BX3A 2FS8A 3SW2B 1NBME 3N99A 2PP6A 3ZVGA 3BTHE 1XUJA 3ZZDA 1BRAA 2ZGBH 5HYOA 2RCEA 1GJ9B 1P2JA 1S6HA 2PW8H 1NU7B 1KXEA 1OWKA 1CGJE 4ZHMU 2VNTA 2WPHS 3M5OA 3SV6A 4DIIH 4CR5A 1EAWA 1O2VA 3URDA 2ZPSA 2TRMA 4I8JA 4AC9A 1ZTJA 1BB0B 1OYTH 1VGCB 2GDDA 1P9UA 3MU5A 2NWNA 1GJ5H 1HB0B 1C2GA 1B5GH 1JOUB 1ZPZA 1GHAG 3LH3A 1L0ZA 1O2LA 4D8NA 3G01A 1YP9A 1SFIA 2W26A 3TJOA 2FLBH 1P09A 3OFND 4M7GA 3A7TA 1GJDB 3SZEA 1SBWA 1MKWK 2SNVA 2ESTE 1BTUA 4I8GA 3KNXA 2GVFA 2Z9JA 1EAXA 1Z7KA 3MH5A 3D49H 1CSOE 2Z9KA 1FN6A 3ATIA 4NIVA 2HPPH 2ZCKP 4FUGA 2C8WB 5JB8S 2AIQA 5C1YA 2HLCA 3VB4A 4BTUB 1QL7A 5J4QA 1JMOH 2ZFQH 4ZXXH 4I8HA 4CHAC 2IJOB 1V3XA 3ITIA 1C5QA 2DE8A 1ETTH 1FONA 1O2UA 2ZWLH 3ATKA 5F8XA 1GBCA 1MAXA 2G81E 3KQBA 4NA9H 1EP5A 3NK8A 1HAHH 5TJXA 3RUOA 4Y79A 3LU9B 3S7KB 3U9AH 2AGEX 1WXRA 4Z6AH 3PLKA 3IWMA 3KF2A 1WBGB 2VH6A 5C5NA 1SOTA 5T6GA 1N1LA 5KGOA 3N7EA 1P0SH 1SQAA 5EG4A 2ZDKA 1MKXK 1THRH 1O2XA 1MTVA 2PKAB 1C5ZB 4UFFH 5LPRA 4VGCC 2OD3B 3D62A 3ZZCA 1T4VH 1O2OA 2FODA 2KR7A 1C5MD 3CS7A 3PWBA 1QB9A 1TRYA 2VVUA 3ZZBA 1BA8B 2H9TH 4IMQA 1BCUH 2BVRH 1PQ8A 2VINA 1O3BA 5AVDA 1TIOA 1DDJA 2JETB 1UTMA 1THSH 1EAUA 1KYNA 4Y0ZE 4DCDA 1JIMA 1EJAA 1S85A 1TLDA 5C3NA 3PV2A 1TWXB 2FMJA 3N7DA 3SI3H 3M7UA 4X1PU 1OX1A 2QF4A 2ZGJA 2G4UA 1SGYE 1Y3UA 2HWLB 3ZZ8A 1BTXA 2A7CA 1UK2A 1NO9H 2SFAA 3AW1A 1U6QA 3FANA 4UDWH 3TH2H 3QDZB 2F9OA 1C1MA 1GI0A 1DXWA 1BTYA 3M5LA 1ZHRA 2Z3CA 4LK4A 4TSFD 1ORFA 2HPQH 4CR9A 1UO6A 4MPVA 2VVVA 1O2KA 1CT2E 2BD2A 4IS5A 1F92A 4ISNA 1ZRKA 1BITA 4HG6A 1C1PA 1VJAU 3P8FA 2UUKB 3ELAH 3F3BA 3VG8A 5DP5A 1DUEA 1AD8H 1T8OA 2W3IA 4F48B 1UTNA 2C8XB 1RXPA 2K1QA 1YPGH 2QCYA 1Q2WA 3RM2H 3RU4E 5DP6A 4F4OC 5JBCS 2GT7A 3TGKE 2CF9H 2WYJA 2EEKA 3QZRA 1MKWH 3EGKH 3TJVA 2EI8A 2VWMA 1GMHF 4CRAA 1FXYA 2I6SA 2Z9GA 4FU8A 1S6FA 1NZQH 1SPJA 1H9HE 5GNDA 2P3FH 1V2UT 1TGTA 1V2JT 2ZU5A 1CA0B 3DSGA 4NCYA 1GCDA 4D76A 5C1UA 3FP6E 2ZPQA 1V2TT 2G51A 1ARBA 2J5UA 1IHSH 3F2HA 1W3CA 2FPZA 3QX5H 1BMFD 4NA8A 2FXRA 2H5CA 2M5TA 1ZMLA 1O2TA 1V2NT 5GWZA 1TMUH 4BAMB 5E0GA 4K2YA 3STJA 4O3UA 3E0NB 2VIWA 2BLQA 3FP7E 2WV9A 1ZHPA 1YKTA 1ZJDA 2ZI2H 4FUJA 1SGQE 1IQHA 1K2I1 3GCHC 1MKXH 3OYPA 2JH5D 1OPHB 2R3YA 3WWBA 2JJ2D 2B8OH 1Y5AT 5EGMA 1N6YA 1C2MA 3S7HB 5G4BA 1HIAB 1SQOA 3AK5A 2V7QD 3HPTB 1P04A 1QB1A 2ANWA 2F9BH 2ODYB 3DSPA 3TVJB 5JBBS 1QL9A 1UTOA 1XKAC 3M37A 1ELVA 5EJ1A 4SGBE 3QZQA 1T8LA 2BM2A 2FOHA 4ACAA 3HK6B 1O3HA 5HGGA 3A88A 1RRKA 1W0KD 1RTLA 2BY8X 2FOGA 3V0XA 1FPCH 3W1EA 1D6WA 5H4IB 4YXWD 1TONA 1O3DA 3F2FA 1O35A 3BEFB 1GI3A 4FXGH 5T6FA 4ABJA 1LVOA 4K8YA 4ABBA 1YLCA 5J4SA 1V2ST 3TPIZ 3SV8A 4NZQA 1F0RA 3IG6B 3MO3A 3RLYH 1P02A 3ZIAD 2PKSB 3LH1A 1TQ7B 1QIXB 2QY0B 1A2CH 1AY6H 5EOKA 1UK3A 1TPPA 3LDXH 5LH8A 3VEQB 1P9SA 1D4PB 1NESE 1EB1H 1EASA 1TNKA 4HZHA 2GMTC 2THFB 3RXGA 3SV7A 1GI5A 1SQRA 1XX9A 3Q3YA 2BY5X 3RC4A 1VJ9U 4MNVA 3MH7A 3RXPA 1VGCC 2WHXA 4INLA 5EJZA 4X8VH 1O2RA 3RMMH 3UB0A 1C5SA 1P2MA 1GBEA 1YWUA 1PYTD 1YPHE 3UAIC 2FI4E 1AB9B 1SLWB 2OQUA 5IYTA 4I32A 4YLUA 4UE7H 1TOCB 5C1XA 1BTHH 3EA7A 1GBHA 2VIPA 1P3CA 3QN7A 1INCA 1TNIA 2H2ZA 2HNTF 3EE7A 4HGCA 4WH8A 1RGQA 3SJ9A 1PQ7A 3E0PB 1TOMH 3MTYA 1AI8H 3EAJA 1OWIA 3MI4A 5DP9A 1OP2A 4WMDA 3M3SA 2HRVA 4Y7AA 5JBTA 5K7RA 3TJUA 1LHCH 1P10A 5C17A 2OXSA 1GJAB 1JXPA 2BDIA 4GHQA 4PROA 4H6SB 2OINA 4IW4E
chains in the Genus database with same CATH topology
2CGAA 3QUMP 2FWWA 4YZUA 1LHFH 1HBTH 3JZ2B 1QHRB 5DPAA 3M7TA 4K60A 2QN5T 3CP7A 4A92A 4BXSA 1YYY1 3TU7H 3QLPH 1A5IA 1HDTH 1GG6B 1O5FH 5DG6A 2BDGA 3LT3A 1KXAA 2AMQA 2WPJS 2BX4A 1C1VH 1SGTA 5EPNA 2Z3DA 3E1XB 1H8IH 1BTZA 1DUAA 3A86A 1YPJH 4CRFA 2V3HH 1Z1IA 1DITH 1V6DA 1EATA 5DP4A 3O8RA 1DOJA 1SGRE 4AOQA 2BYAX 4ZROA 2PWXA 4OS7A 2VWOA 2JETC 1AWHB 1OP0A 1QQ4A 3SU6A 1FJSA 3BG8A 3GYMA 5A0AE 5EU8A 3M5NA 1E35B 1B0FA 2F9NA 4X2YA 1TX8A 2Y81A 1ZJKA 5AFZH 1EOJA 2XTTB 4OS1A 2ALPA 2WUBA 4AYYB 1QJ7B 2P3UB 4XBDA 2XC5A 3T29A 1CA8B 2EI7A 3A81A 1P2OA 3T25A 3W94A 1G3EA 3MMGA 4OS4A 1P12E 1UTQA 4MPWA 1GL1A 1IQIA 1O2PA 3TGJE 1EB2A 1BHXF 1GHBF 1SOZA 2VGCB 2XRCA 2ZZUH 3U69H 3KL6A 1AKSB 3SNBA 1Y3WA 1DSTA 3SNDA 3UR9A 3ZZ6A 2AMDA 1LHEH 4INHA 2GV7A 1SGNE 2BOKA 4JCNA 2R2WU 5GPIB 1ELFA 2ZDLA 1VZQH 1BT7A 1IQGA 3P8OA 3MNXA 1GVKB 1K1NA 3RXVA 2G52A 4FVDA 2XWBI 3STIA 1YPEH 1QY6A 2ZDNA 4ABDA 4Y8ZA 1LKAA 2WPIS 2W3KA 1AFEH 3OTJE 4KP0A 1A46H 3UREA 1RTKA 3UWIA 5L2YH 4YESB 3SUFA 1LVYA 1CA0C 1ZMJA 3RXMA 2CV3A 1DWBH 1HJAC 1ESAA 3HKIB 4FU9A 4WF8A 3GY2A 2ZTXA 1F5LA 1WQVH 4MPXA 2CXVA 4ZKRU 1TGNA 5DO4H 2G5VA 5IDKA 1JWTA 1K1PA 1SFQB 1S0QA 4WXVA 3K6ZA 1G3CA 1AFQC 1C2FA 1UVTH 3RC5A 2FOCA 1GJ8B 1DXPA 5A0CA 2VB0A 2ZDAH 4I31A 3TJNA 2G00A 1MTNB 1O3FA 4Y0YE 3K65B 3P8NA 3H5CB 2ASUB 5A8XA 1BIOA 1IOEA 1E0FD 2HNTC 1GHXH 1ZOMA 1FDPA 5HMAA 5JBAS 5F6MA 4IC5A 1PPZA 2O8LA 2GV6A 4K1TA 4Y8YA 3Q00A 2AH4X 1HFDA 3VPKA 3A7WA 2Y82A 3F9HA 4AFZA 2A4RA 1O3CA 1GMDG 1G2MA 1NFYA 1ABJH 1DY9A 4A1XA 1GBLA 6GCHF 2ODPA 1A7SA 1BTWA 2C4FH 2O9QA 9ESTA 3BTWE 1TMTH 1UVOA 3CS0A 1MU8B 1C5RA 2WPKS 3ZYDA 1SHYA 7KMEH 3BTEE 1LMWB 4YO9A 4B75A 3D23A 1IQMA 2EC9H 5AHGH 2PKSC 1K28D 5I25A 1C5OH 3RXOA 1J17T 2BLVA 1CHGA 1G32B 2ZHWH 1W14U 3GCTG 1TYNA 2F9PA 2ZIQH 4O03A 1TAWA 1HXEH 6ESTA 4YTAA 1ESTA 1LDTT 2FLRH 1AVWA 2ZA5A 1FAKH 5FXLA 3MH4A 1OKXA 4ISHH 2HVXA 4X1QU 3MU0A 1O3JA 3BTDE 1C5NH 2PUQH 2XC0A 4HTCH 4ZUHA 3NWUA 3SV9A 2P94A 2GD4B 4XDEA 2ZHFH 5BRRE 2STAE 5LPFA 1UCYK 3MHWU 3ZVFA 4FUBA 4H6TA 3EA8A 1CHOG 2PR3A 4A1VA 4GAWA 2A2QH 1SLUB 4JYUH 4LOYH 1HRTH 5JDUB 2F83A 3F9EA 1PQAA 4BAOB 2GCTB 3RXLA 1AMHA 2Y6TA 3F9GA 1LQEA 2H5DA 3ZVDA 1YGCH 1D3QB 4ZHLU 4ABFA 1O3NA 3HATH 1EZSC 5DP3A 1E38B 2SGQE 1BRCE 1K1LA 2BLOA 2GX4A 3M61U 2XCFA 1RS0A 1B7XB 1GDQA 3ZZ3A 2GMTB 1GG6C 1W8BH 2ZU2A 4U01A 4YT7H 1AVGH 3A80A 4FUEA 5DJ7A 1MAYA 1MMJN 3F6UH 5A8ZA 3UTUH 4OS5A 4KKDA 1HIAA 3QO6A 1S82A 4ESTE 2XBVA 3GY3A 1CVWH 1G30B 1H9LB 3UIRA 2QXJA 2WYGA 3SU1A 1XUHA 1J15A 4MNYA 1GHVH 2G4TA 1GBBA 2R3UA 3ZZ4A 4YOGA 3VB7A 1A3BH 2VIOA 1FY8E 1GCTB 2ZHEH 2ZTYA 4O9VA 1PQ5A 1QBVH 1AU8A 1F0SA 1P8VC 1LHGH 3NZIA 1QRWA 2ZFTA 1O3EA 1SC8U 4FUIA 1ESBA 3GOVB 5FCRA 1GMCG 2PV9B 4JZEH 2D2DA 1MZAA 1TRNA 3MU1A 4NG9H 1MCVA 1Z8JB 3T28A 2ZDVH 1QQUA 2XBXA 2FX4A 3RMLH 1BMLA 2ZQ1A 4O3TA 1JIRA 1KSNA 1Y3VA 3FZDA 1CGIE 1OOKB 3O8CA 1Z6EA 1BRBE 1W7XH 2FI3E 3LKWA 4JZIA 2FOAA 1GBAA 4NGAH 1A4WH 1CU1A 2BQ6B 1XXDA 2VGCC 1C5YB 2D8WA 2AGGX 2P16A 3T62A 3ZV8A 5ESBA 5E0HA 1FY4A 1NRSH 4MG3A 3BTKE 1GBTA 4GSOA 1O3GA 3OY6U 3O8BA 1GVLA 1WV7H 1SR5C 4E06H 1LPKB 1QCPA 1Y3YA 1UCYH 3SNCA 3UPEA 3OU0A 3QGNB 2EI6A 3DFLA 3GICB 1OSSA 3GYLB 2BQ7B 1WUNH 1QR3E 2P59A 4YOIA 3ZV9A 4AORA 1SSXA 1C5WB 1SI5H 1J16A 2STBE 1ZRBA 4ABHA 4AGJA 4BAKB 2Y7ZA 1Z8GA 1PYTC 3SGBE 3P6ZB 4MVNA 3SU3A 4IGDA 1VITF 3DT0H 1C2LA 3SU5A 3SI4H 1F7ZA 1MCTA 4KTUA 1TBQH 2ILNA 4X2XA 3SORA 2BDYA 1LVMA 1C5TA 2A4GA 5ABWA 2A1DB 3PMBB 8ESTE 3AAVA 3TGIE 2ULLA 4KGAA 1KDQB 1PPEE 4TPIZ 3UQVA 2FOFA 1TMBH 3M7QA 2A7JA 1K1JA 2Q6GA 1MTNC 4UFDH 1DM4B 3A7ZA 1MZDA 1YC0A 2BD9A 4JYVH 4X2VA 3SN8A 1C2IA 1ETSH 4X8UH 5HM9A 1GBJA 2QXIA 3A85A 3PWCA 1EXFA 3A89A 3V13A 3QK1A 1FNIA 2Y5FA 4CRBA 4XBBA 1TABE 1QRZA 2GCHG 3RLWH 1O2IA 3P70B 1KTSB 1WTHD 5C67A 3TK9A 3AW0A 5FX5A 5A0BA 5DK1A 3SGQE 1C4Y2 4Y76A 4MNXA 3SGAE 3SNAA 2F91A 1ZR0A 3U1JB 1C2HA 2CHAC 3U1IB 3SV2H 1HJAB 1O36A 3AVZA 4WH6A 5ETXA 4GHTA 4BTTB 3TH3H 1AZ8A 2IOTA 4X6OA 1O3OA 2OCVB 4U32A 1DT2A 4X1NU 3TNSA 4WY3A 4NSYA 4E05H 3TH4H 3EA9A 6LPRA 1QA0A 4CRDA 1XUIA 2KAIB 2Z9LA 1AFQB 3K2UA 1O2HA 1ZPCA 1C1NA 1GI4A 1AKSA 2BD3A 2FESH 2J38A 1XUKA 1HNEE 3VB3A 1D9IA 1O2ZA 2AERH 1UVUH 1J8AA 1NFWA 2A5KA 4Y10E 4CH2B 4JMYA 2BXUH 2UWOA 3PROA 1C2EA 1XVOA 2SGEE 4TPYA 3UWJH 4DURA 2IN2A 4MLFB 3ZYEA 2QXHA 2CN0H 1AIXH 2FTLE 2B5TB 2O8WA 4KTCA 1EZQA 5GCHG 3VXEH 2PTCE 1C9PA 4OGXA 1L1NA 1W13U 3EQ0H 1HAVB 3MNCA 1NM6A 1C1TA 1XUFA 3KQEA 1W7GH 2G8TA 2GCTC 1TBZH 1P2IA 3F68H 1ELCA 4NWKA 3BSQA 1Z8RA 3FFGA 1NRQH 3RC6A 5B6OA 4LZ4B 2XWAA 3M3TA 2DE9A 2ALVA 5F8TA 4XFQA 3S9AA 3VGCB 4DJZB 3ZVCA 1CT4E 2HALA 3A7VA 1O5BB 1V2MT 3BTFE 2AS9A 1CQQA 1DVAH 2ZGXH 5GXPA 2Y5HA 2TGAA 1AE8H 2ZGCA 4BTIB 1LKBA 4TWWA 2BY6X 1OYQA 2VIDA 2BB4A 1UMAH 1SGFA 3QTVH 2VWLA 1C1RA 1YPHC 3LGUA 1G9IE 4A6LA 3A7XA 1PFXC 2BDBA 2H9EH 1KXFA 2XW9A 4ABGA 1GCTC 2BQWB 1IQKA 3A7YA 1ZSKA 4B76A 5BPEA 2ANMH 2FOMB 1W2KH 2XC4A 7GCHG 1HAOH 1M9UA 3TITA 1GDUA 1NPMA 1ETRH 3FAOA 5DGJA 2WV4A 4R8TB 3SU0A 3KHVA 4D9RA 2YNBA 1HXFH 1N8OC 1GHWH 1GJ6A 4JZDH 4B71A 3DFJA 1GPZA 3BIUH 4X1RU 1BHXB 2VIVA 3PV4A 1QTFA 2BD4A 1V2QT 1XVMA 1IHTH 4UFGH 2A4QA 1GDNA 4UD9H 1ZZZA 3RU4D 1Y8TA 4OGYA 4Y7BA 4D9QA 4WWYA 5PTPA 1UHBB 1C2DA 1TPSA 1P05A 4I33A 1L2EA 4J2YB 1ZMNA 1T31A 4WMFA 1G3DA 1RTFB 3TK6A 1DWEH 2J4IA 1XMNB 1K21H 2GTBA 1HAGE 1IQFA 3LGVA 4BXWA 4X2WA 3LGYA 1MU6B 2YNAA 3GISB 4I8LA 1A5GH 5JB9S 1FY3A 2BD8A 3HK3B 1NRNH 3TIUA 1NFXA 3BG4B 2OBOA 4H42U 3L3TA 2GGVB 4TY6A 3S9CA 4KELA 1P06A 1S0RA 1MD8A 3A8BA 1OWJA 1ELDE 2NU0E 2GT8A 1DICA 4ZKNU 1F0UA 3RXQA 2H1UA 1CBWB 5HXFA 4GCHG 2BOHB 3BTTE 3EE0B 1OS8A 2ZTZA 1ZSLA 1FI8A 1TRMA 1ID5H 2P8OB 2LNCA 3FP8E 2H6MA 4K1EA 5TCAA 1J14A 3KN2A 1FPHH 1T7CA 2BD5A 2I6QA 1GWAA 1WYKA 1TGBA 2FOEA 1CO7E 1BDAA 3LJOA 3M35A 2ZECA 2IPHA 2ZGHA 3SU2A 2J94A 3ZZ9A 1AN1E 3L6PA 1NC6A 1SVPA 1ZGVA 2EA3A 4KTSA 3GCNA 1LQDB 8GCHG 4OS2A 1ANDA 3SJ8A 1E34B 1K9OE 2VVCA 4NZLA 5F8ZA 2Z3EA 2VU8E 3P92A 2Z6BD 1GJ7B 1ELGA 1EP6A 2NU1E 1EKBB 1EJMA 3BEUA 2Y7XA 3KIDU 3NXPA 3DA9B 4NA7A 1ELAA 3ODDA 3PYHA 1P3EA 4X6PA 2SGFE 1CE5A 1FY5A 5CHAB 3MO6A 1B0EA 3UR6A 3MOCA 4NFFA 3LOXA 1KLIH 1GJBB 4AG1A 4D7FA 5ESTE 2R9PA 1GJCB 1QNJA 3RXTA 1DY8A 3B8JA 3T26A 5SGAE 3GY7A 5FBIA 1C1UH 4ISOA 1SGFG 1IQNA 2A32A 3A83A 2BD7A 1PPFE 2GKVE 3A82A 2XBYA 3UY9A 3KCGH 1O2JA 2BY9X 4JZ1A 1C1QA 3HGNA 1S81A 2BHGA 1KXBA 4RSPA 2QF0A 2OQ5A 1QURH 3ZVAA 1L1JA 3VB6A 1O38A 2PKAA 3Q3KA 3LC5A 5EQRA 1BBRK 4F49A 1DWDH 2QV1A 2QGRA 4YM9A 1GJ4H 1K22H 1KTTB 1H9IE 1ZTLA 2Y5GA 4DW2U 2PSYA 1DSUA 1BZXE 3U8RH 2OC7A 2HOBA 2NU2E 1T4UH 1NY22 1UTKA 3QWCH 1L4ZA 2WV5A 1AUJA 4DVAU 2BMGB 4OS6A 2A31A 5AFYH 4XOJA 4CH8B 1TGCA 1SGPE 1AO5A 1ELBA 3ENSB 5EQQA 2ZKSA 1FMGA 1SMFE 2CHAB 1A0JA 1EPTB 4DG4A 4ZKSU 3RXSA 1FIZA 2XNIA 2G5NA 4Q7ZA 3U8TH 4AGKA 1QFKH 3VB5A 3VGCC 2ZFFH 1VCQA 5L6NH 1KY9A 2XYAA 2ZO3H 3PO1B 3GDVA 1KDQA 4A1TA 2H9HA 4AB8A 1O3PB 1MTUA 4BOHA 5E2OA 1NT1A 2CF8H 1BOQA 4X1SU 1O5CB 2ZFSA 2OUAA 3BN9A 2C3SA 1ELTA 4GUXA 5GDSH 5FBEA 1YCPK 1YPMH 1DX5M 1LTOA 4CBNA 3KQDA 1HJ9A 1T32A 1O2GH 1BUIA 1C9TA 1EX3A 3UUZA 2BDAA 5LPEA 4CREA 2BZAA 8LPRA 2JKHA 2PFEA 1O2SA 4ABEA 1ZLRA 1C2KA 4Q7XA 4U30A 4E7NA 5AF9H 4IN2A 4YLQH 1SGCA 4WXIA 1T8MA 1O32A 1V2LT 1IAUA 3F9FA 3ZZ5A 4UFEH 1DFPA 4IN1A 4B2BA 4D7GA 4CBOA 2WPLS 4Y6DA 3S0NA 1LHDH 1HUTH 3ZZAA 3RXDA 3MWIU 2CJIA 3RXRA 4FUCA 3W95A 4ISIH 1QBOA 3Q76A 2YOLA 1TB6H 4NIXA 4FUFA 2A0QB 2R0LA 1NRRH 1MD7A 2KAIA 1UCYE 1TPAE 2Y80A 1VITG 1QRXA 9LPRA 2ZHDA 1UVPA 1P2QA 2ZU4A 1BBRH 1O2QA 3SO3A 2GP9B 1HAYB 1ARCA 1QGFA 3PMAB 1GI9B 2RDLA 1H1BA 1P2NA 3SOSA 3RP2A 1FIWA 1WAYB 1HV7A 1SL3A 5EODA 2ZHQH 3A8CA 4FU7A 1IQJA 4FVBA 4AX9H 3AASA 3BG4C 4JK6A 1JRSA 1GMDF 2WUCA 3R0FA 5E0JA 5F03A 2J92A 1D6RA 3OY5U 4MDSA 5L2ZH 1EZXC 4HFPB 3SNEA 4GVUA 1HAVA 2BTCE 4CRCA 1YLDA 1Z1JA 3SBKA 4DIHH 3T5FH 1CBWC 1TFXA 2UUFB 1N8OB 4K5ZA 1GVZA 2JH0D 1A61H 2FZZA 3OSYA 1UJ1A 3UOUA 2RA3A 2P93A 1C5XB 2UUJB 2AGIX 4K69A 3RU4T 2P8OC 1GMHG 4BAHB 3B23B 1J9CH 5T3HA 2OBQA 4XSKU </