2PSXA

Crystal structure of human kallikrein 5 in complex with leupeptin
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
227
structure length
227
Chain Sequence
IINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the zinc inhibition of human tissue kallikrein 5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Kallikrein-5
total genus 51
structure length 227
sequence length 227
ec nomenclature ec 3.4.21.-:
pdb deposition date 2007-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2psxA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2psxA02
1TB6H 5DP3A 1FY1A 1Z1IA 1C5LH 3S7KB 4AG2A 4AORA 4LOYH 1DVAH 3ZVDA 1ZPCA 5LPEA 1AQ7A 3B8JA 3SGAE 2FS8A 2ZDKA 2V0BA 1P03A 1C2GA 1FJSA 4UONA 2VIQA 1S6FA 5ESBA 3Q76A 1KLIH 1Z71A 1SGFA 1TFXA 2OBQA 2AMPA 1O2JA 2ZTZA 4X1NU 1GGDB 1BBRH 1LVBA 4BTIB 4NA9H 4X8UH 1TIOA 5HYOA 1TALA 4NZLA 4ZUHA 5LGOA 1MD8A 2HNTF 4D8NA 4JYTA 3GDSA 5E2PA 3RU4E 2J2UA 1UCYK 1HUTH 4X2WA 5CE1A 4YESB 1GBFA 2ALVA 1O2VA 1DFPA 2SGDE 3KIDU 1HIAA 2FDAA 1C2MA 2XRCA 1K2I1 2PLXA 3UWIA 2FOEA 3UNRA 1HDTH 2V6NA 1Q31A 3ZZAA 1CA0C 1SGEE 1W3CA 1DY9A 3SNBA 5JBCS 5A8YA 5T6DA 1JRTA 3E0NB 5C1UA 1O5FH 1O3AA 1P2MA 1NS3A 5L2ZH 1KTSB 1GBLA 2UUJB 3RXVA 1UVUH 2ZDAH 4BANB 5EXLA 5HMAA 3BEUA 1EPTC 1ELEE 3D23A 3V3MA 2H5CA 3I78A 3UQVA 1TBQH 2VINA 3R0FA 1V2UT 1TRYA 1QL8A 3SO3A 2F3CE 1G3BA 2Y5HA 1S83A 2J9NA 3RXSA 1QGFA 1P05A 1TPOA 4MPVA 1BJUA 1MTVA 4Y0ZE 1O3PB 1F0SA 2OQ5A 1C5QA 1BUIA 1DSTA 1MTSA 2CF8H 4D7GA 1GBMA 1C5UA 2HPQH 4J1YA 1XXDA 3VXFH 5AFYH 1P02A 2ZO3H 3GCTF 1EAUA 1ESTA 1O3LA 2Z9IA 1RFNA 2J38A 4BAMB 1IQEA 1KXEA 2BOKA 2WPMS 3O8DA 1SG8B 3GY3A 1C1TA 4Y8YA 4SGAE 2PKAA 2J95A 3UNSA 1TA6A 2R2WU 4Y8ZA 3ZVAA 1ZTLA 3QN7A 1H9LB 3SJIA 2P3UB 1CT4E 2XBWA 1BRBE 1MU6B 3MWIU 1SOTA 3RXAA 5AHGH 1C2EA 1V2OT 3VGCC 3VB7A 2QXIA 3M7QA 2P94A 3SU3A 1DWEH 1MKWH 1C1MA 1J16A 3MFJA 5FXLA 3P6ZB 1EAWA 3LGVA 3RXPA 2AMDA 1EAIA 5T6GA 1G3CA 3MU5A 3TK9A 4DT7B 2AFQB 2DUCA 1WSSH 1V2WT 1ETRH 1IAUA 3AAVA 3RXDA 1HAHH 5DK1A 3SQEE 1ETTH 1F92A 1ZR0A 3TNSA 4GUXA 2H2ZA 2QIQA 1QL7A 2XYAA 2FIRH 2OLGA 2GZ7A 1AB9B 7GCHF 1BQYA 3LGUA 4YOJA 3E91A 4X1QU 4DIIH 4INHA 3SHCH 1GWAA 1O2RA 3E16B 2D1JA 3QX5H 2ODYB 3BIVH 5SGAE 2WYJA 1DUEA 3FP7E 1GI1A 1GMDF 2XBVA 1MQ5A 4IMQA 2PGBB 1EPTB 3CP7A 3L6PA 2XWAA 4K2YA 1OP8A 2WPKS 2TGTA 2BY6X 1A3EH 3S0NA 3RC5A 4HTCH 2FI5E 1KIGH 4CRCA 4O03A 2VH0A 3PYHA 4MLFB 1C1RA 2Z9GA 3OU0A 4K8BA 3SBKA 2QXJA 3A83A 2RDLA 5FHTA 3UOUA 1H8IH 1A5IA 3STIA 3U1JB 3MMGA 1O37A 4CR9A 3SNCA 3MO6A 1P04A 1ZTJA 2GCHF 2P3TB 2V35A 3BSQA 4WH6A 2BVSH 1UK4A 2I6SA 2ZC9H 3ZZBA 1O5AB 2BY5X 5C2ZA 1TPSA 1BDAA 1C2LA 1SLWB 1AVXA 2Z3EA 1DY8A 1C2IA 2QN5T 2O8WA 5EXNA 1S85A 3ELAH 4DGJA 1LQEA 1OWIA 1O2OA 2ZU5A 2XC0A 2BZ6H 4DURA 4ISIH 1ABIH 1K1MA 2ANKH 1XUFA 4OS5A 1U6QA 1AO5A 1XKBC 4O3UA 2PTNA 2AIPA 1P12E 3GCOA 3D65E 4ESTE 4ZH8A 1K1IA 1YLCA 3QTOH 1GI8B 1DLKB 2FX4A 1RTKA 1T4VH 4I8HA 2A2QH 2H9HA 2VJ1A 4CRFA 4AB9A 3PMHB 5JYIA 4X8SH 2VIOA 1O2LA 2GMTC 1AZ8A 4ABHA 2QYIA 4IMZA 1TOCB 2Y5GA 5FBEA 1DITH 3BTWE 4O9VA 4F4OC 2PUQH 1HB0B 1HGTH 3LJOA 3ZVBA 1OWHA 4I33A 2H1UA 3BTFE 1THPB 1BZXE 2NWNA 2D2DA 1TNKA 4Q7ZA 1QIXB 2ZGBH 1VCQA 4AB8A 1FIWA 1AB9C 1E38B 2FS9A 2WINI 3LGIA 4WXVA 1GVKB 4ZAEA 3A89A 1YGCH 2YOLA 5AF9H 2XC4A 3A8DA 2UUFB 1ZSJA 1Z8JB 3IITA 1P2JA 1BMMH 3GCNA 4E05H 1TX8A 2VIDA 2O8UA 1QQUA 1OYTH 2G4UA 1D6RA 2ZFPH 3SHAH 2VGCB 1O38A 1GBTA 4DJZB 1BHXF 1MAXA 4JYVH 1ESAA 1TLDA 1GMCG 2CXVA 2HNTE 4IGDA 2F9NA 4X6MA 2GT7A 3KHVA 4B2AA 2OCVB 4INKA 3TLOA 4Y79A 1ARCA 4YT7H 1BMAA 1TNJA 2TBSA 3MU8A 4CRAA 4K1EA 5G4BA 1O2XA 1UCYH 2KAIA 2ZTYA 5BRRE 1BT7A 1C5XB 2G55A 2GD4B 2M5TA 2QXHA 2TGDA 4TY7A 3RMMH 1PYTC 4NG9H 2VWMA 2ZGCA 2IJOB 3ZVCA 4ZKOU 4OS4A 4RKJB 4XBDA 1VZQH 1TNHA 1TX7A 1Q2WA 1ARBA 3T26A 1V2PT 2BY8X 4NGAH 1L2EA 1IHSH 4Q7XA 2Z3CA 2PGQB 1YPHC 1YBWA 1HAYB 1C1NA 2EC9H 1GJ9B 1O3KA 3LKWA 3LU9B 3URDA 5F6MA 1SPJA 1GBCA 1C4Y2 4DOQA 5FPTA 1HAXB 1CU1A 5GXPA 2CGAA 4CHAB 1G9IE 3PLBA 2V3OH 1XUJA 1ZMJA 2C90B 3SNEA 4GCHG 3NCLA 3VGCB 3RXQA 1AVWA 2I6QA 3WY8A 2UWLA 1SGCA 4AFSA 1LHGH 1QA0A 4I32A 3ATWA 3KF2A 1Y3UA 1FDPA 3L3TA 4BXWA 4JK6A 1W2KH 2EEKA 3GCTG 1GGDC 2ZPQA 4JZ1A 1BBRE 2VIPA 3M3SA 1AU8A 4DCDA 1BTWA 2PHBA 2PKSC 1GBKA 5DGJA 3BG8A 3H7TA 3TH2H 3EAJA 5TJXA 1O3MA 3UIRA 2FYQA 3GCHC 3RXHA 6CHAC 1THSH 1VGCC 1BITA 1MZAA 2ZDMA 3GISB 3F1SB 4DG4A 8ESTE 1BTHH 1JIMA 2BD9A 1UCYE 2ODQA 2ZU2A 5E2OA 2F91A 1NT1A 3STJA 3VB4A 2GCHG 2W5EA 1MMJN 3A80A 3UFAA 3RXFA 2VIVA 1NN6A 4MQAA 5EQQA 3MH6A 2YNBA 1GCTB 1RD3B 3F9HA 1C1WH 4D76A 1C1OA 2BXTH 1LVMA 2HLCA 1AKSA 5EOKA 3P8OA 2BX4A 3BG4B 3BTEE 3TK5A 1ANEA 3SJ9A 3IG6B 2ZCKP 4NSYA 4HZHA 1AFQB 2OXSA 1UVOA 2EA3A 1QURH 2Z9JA 2PV9B 3Q77A 5EXMA 3VEQB 5IDKA 2Y82A 4AFUA 4O3TA 3OY6U 2NU0E 5BPEA 2OD3B 1C1VH 4SGBE 5H4IB 3ZZCA 4CH8B 4JZIA 4CHAC 1YP9A 2FEQH 5PTPA 1A0LA 1TX6A 3C1KA 2BDAA 3SU5A 6ESTA 3BTHE 1ZLRA 3HKIB 3QLPH 1SGYE 3M5OA 1SI5H 1UVTH 3M5LA 2GKVE 2A4QA 1LHEH 1SL3A 5JBAS 1SGNE 1LCYA 5A2MH 2GX4A 3GOVB 3E8LA 2OUAA 2QA9E 5C3NA 3RUOA 4NIXA 3A7YA 4AFZA 1HAPH 4Y10E 5DP7A 1F2SE 2OTVA 1KTTB 4ISLA 3RU4T 4JZDH 1SGTA 1KXBA 1GL0E 3I29A 4NFFA 2QC2A 2Z3DA 5C20A 1MBMA 2SFAA 1O2UA 4X6OA 3A81A 2V3HH 4FUIA 1LTOA 3M7TA 2FI4E 3LPRA 1SGFG 1UTLM 5EQSA 6CHAB 1V2ST 3V12A 2PKSB 1O2SA 2C8ZB 2GCTB 3GY7A 4U30A 1MTUA 1WYKA 1G3DA 1SOZA 1CVWH 3RXIA 1OSSA 5C67A 3TJOA 3ZVEA 4A1TA 2FX6A 5HGGA 4FUCA 1J15A 1F7ZA 1DLEA 4YOGA 5GCHF 1G30B 2ZPRA 1P2KA 2AYWA 3KL6A 1NFYA 4GCHF 2ZGXH 4ISHH 1WU1A 3FVFB 5FAHA 1GHVH 5JBBS 1YM0A 1HPGA 2LNCA 1E35B 2FTMA 1EP6A 1YCPK 1O34A 1S0QA 3D62A 2ZHDA 3Q3KA 3U98H 1C5TA 3S69A 2ZFRH 1K21H 5A09A 3E3TA 9LPRA 1TPAE 1RRKA 1BTYA 3BN9A 4IS5A 4OGYA 1C5VA 2HGTH 3P8NA 2GV6A 1W14U 1J9CH 1UTJA 1NPMA 2ZHEH 4E06H 1EKBB 4NA8A 3DFJA 3VPKA 1P9UA 2A7JA 1D6WA 4FUHA 5CMXH 3RXKA 3A8CA 1L1JA 4X1RU 1BJVA 3H5CB 4OGXA 5GIBA 3A7TA 3DT0H 4FUBA 1BA8B 4H6SB 4UEHH 2PTCE 2A31A 2HOBA 3H7OA 4K8YA 1Y5UT 4BAHB 1KXAA 1V2RT 1TQ0B 2C4FH 3ZZ7A 4A6LA 3SU1A 1HJAC 2NU3E 4GLYA 4BAQB 4M7GA 1EP5A 1GHXH 4NWLA 4MDSA 1C5OH 4CBOA 2XBXA 2XC5A 1ZRKA 2O8MA 4D7FA 1C5ZB 2VWNA 4ABDA 4AZ2B 2PWXA 3RU4D 3NZIA 4I8KA 1LPZB 1HAVB 1GHAG 1J17T 4ZHAA 1HJ9A 1DWDH 2ZU1A 5LPRA 1ZHPA 3KQBA 1PPZA 1V6DA 4R8TB 4X2YA 1GJ6A 2G5VA 2HWLB 3DD2H 2TGPZ 1IQKA 1Y5AT 3QWCH 4WH8A 4WVPE 2VWOA 3QGNB 3BTTE 1Z6EA 1HXFH 1SGDE 2QF0A 3BTGE 1ELVA 1MZDA 1C1QA 1RS0A 2BD4A 3T2NA 3D49H 3NXPA 1O2QA 4A92A 2HPPH 3G01A 1GHBG 4UE7H 3PTBA 2TPIZ 3ZZDA 3T28A 3P8GA 1UVSH 5TCAA 1Y59T 4XE4A 1W10U 3EA8A 4FU9A 5F8XA 1SGRE 2VVCA 2ZCHP 3RDZA 4TYDA 3HGPA 2UWPA 8KME2 1XVMA 2BDBA 4CRGA 3SJ8A 3C27B 1BRCE 1GG6B 2ZU3A 1GMCF 1MQ6A 2FM2A 2DE9A 3MNSA 2BM2A 1O5BB 3F9EA 3SNAA 1XX9A 2QAAA 1CHGA 1AZZA 2FODA 1GHYH 2GCTC 5JB8S 2STBE 4X1SU 1Y3YA 1A0JA 1MH0A 3M5NA 1WUNH 1D4PB 1W0ZU 2ZFSA 4WMFA 4FU7A 1FY8E 2B7DH 1Z6JH 2A5AA 1QRZA 1O5DH 1KLJH 3NKKA 4GAWA 4YLQH 1ELAA 2EI8A 7GCHG 1C4V2 1PPFE 1O0DH 1TBZH 3U9AH 1ANCA 4IBLH 4YOIA 2FOGA 4ZKSU 4Z6AH 4OS1A 5L6NH 1OWDA 1ZJKA 1A5GH 4MPUA 1C5SA 2G5NA 5LPFA 1BMLA 1DWCH 2ASUB 4WMDA 2F9UA 1HAVA 4VGCB 1UK2A 3QGJA 2SGQE 5DKMA 1GI9B 1HIAB 1RTFB 3T27A 4AOQA 4LXBH 3SNDA 4JCNA 2JETB 1A0HB 2PW8H 3QO6A 3MHWU 1GMHG 1LO6A 2VGCC 1GBBA 4WXIA 1SQTA 1WBGB 1E34B 1TPPA 5ETXA 2A32A 4WJG2 1FPHH 4WF8A 1CHOF 2F9VA 2BQWB 4FUJA 5EGMA 4XSKU 4K3JA 1EJNA 3A8BA 3JZ1B 1EOJA 3FANA 1AN1E 2FZZA 1UTMA 1O3NA 1QQ4A 3LOXA 4UFDH 3LC5A 1N6XA 1EX3A 1UMAH 1PQAA 3NWUA 5DJ7A 3V13A 4K5ZA 5JDUB 5IYTA 2PFEA 2BB4A 2FOAA 3BV9B 3UTUH 7LPRA 2PSYA 3PROA 5F03A 5GJ4B 3P92A 2VU8E 1NC6A 1BHXB 4Y7AA 4FUEA 1JRSA 3UWJH 1MAYA 5DP5A 3E90B 3M5MA 3SQHE 2B0FA 3U1IB 4TY6A 3TJVA 1TMBH 4X8VH 2RG3A 1G37A 1GI4A 2W26A 2ZDVH 1B5GH 1TAWA 1GBJA 1GHAF 3GY5A 1C5WB 4FUFA 2VVUA 1C5YB 2ZQ1A 3N7OA 1ZTKA 1AWFH 1HAGE 2Z7FE 1AI8H 2BQ6B 3GYLB 1TABE 2P3FH 2ZIQH 1WAYB 3UNQA 3FAOA 1T31A 1CGHA 2WPJS 2CHAC 3T5FH 1W12U 3V7TA 1S6HA 1WV7H 2Z9KA 5I46H 1LMWB 2XBYA 2ZWLH 2XWBI 4JZFH 1SGQE 1FONA 3ATMA 1GMDG 5A0AE 1TGTA 1ELFA 1UTQA 1E36B 3MI4A 1C1PA 3HK3B 2J34A 1K22H 2ZFQH 2ZZUH 8LPRA 3KCGH 3AW1A 3DUXH 3HK6B 1PPGE 4OS2A 1FN6A 4CRBA 1UTPA 2FTLE 3BTME 1D3DB 1SFQB 4NCYA 3ZZ3A 4B76A 2ZDNA 1ELCA 2D8WA 3BG4C 3KGPA 4ISNA 1S81A 1O3FA 3CS7A 3SU6A 1GCDA 1KXDA 5EW1H 1AIXH 2ZF0H 1W7XH 2ZA5A 3SORA 2ZGJA 3F68H 3PO1C 1WQVH 3P17H 2CJIA 1QNJA 2HVXA 2CN0H 4RKOB 4KELA 3MTYA 1E37B 2R0LA 3SUDA 1Z8GA 4FVBA 2WPHS 1OYQA 3LONA 2PKAB 2UUYA 1GL1A 2BD8A 3LIWA 2ANYA 1FN8A 2ZU4A 1VJ9U 4B75A 3RXCA 3ZYEA 3JZ2B 4UD9H 1SC8U 1TWXB 1TNGA 2F9PA 4K69A 5CHAC 4H42U 1P11E 4JYUH 4OS7A 3SJKA 1V2JT 2Y80A 1YF4A 1P01A 1NRRH 2JETC 3FFGA 3OY5U 3O8RA 2O9QA 1PQ5A 2FOHA 2YNAA 2BOHB 1NROH 5TCCA 6GCHF 5HM2A 1G2LA 5GCHG 1N6YA 3PB1E 1FXYA 2P93A 3KNXA 1C5NH 4ABAA 1MD7A 1K9OE 1N8OB 2O8TA 4Q7YA 5I25A 1LDTT 1F5RA 3GDVA 1J14A 1PFXC 1EB1H 2FOBA 2R3YA 1O2KA 1EUFA 1TE0A 3L33A 1AVGH 1NRNH 1UTNA 3MO3A 5CHAB 2WYGA 1XM1A 3PV4A 1ZJDA 1H9IE 3LC3A 1RIWC 5J4SA 4KTCA 2ZTXA 1QRXA 3KN2A 1O3CA 1CT0E 1QBNA 1T8OA 4YO9A 4U32A 3ZV8A 1YCPM 2A4RA 4A1XA 3GICB 9ESTA 3SV2H 2IPHA 4UFGH 1F0TA 1ZPZA 3TGJE 1MKXH 1C1UH 4MTBA 8GCHG 1EAXA 1CE5A 4TPIZ 1NRSH 2GT8A 3HKJB 1GBAA 1BBRK 1KSNA 3HGNA 1ZSKA 4H4FA 4AN7A 2XW9A 4KP0A 3RXLA 4VGCC 4UFFH 4B2CA 2SGAA 1XUHA 3K6YA 1JIRA 3PMJA 1QBOA 1SFIA 2Q6DA 1SHYA 2JH0D 1AE8H 1HAIH 1T8MA 1O2YA 1QBVH 1UVPA 2G52A 1OP2A 4ZKNU 1SLXB 1NU9A 4AX9H 2RCEA 1ZGVA 1PPBH 4INLA 1A3BH 4WY3A 4FUGA 2EI7A 1UK3A 1KYNA 1GI7B 1PQ8A 1JBUH 4UDWH 1EASA 1GJ8B 4MPXA 3ENSB 1CSOE 3F9FA 3UY9A 1QL9A 2NU4E 1O2IA 1P10A 3BF6H 3K9XB 1MTNB 2PUXB 4IW4E 2BLOA 4NIWA 4AGKA 2DE8A 2GGVB 4AG1A 3UUZA 1Y3VA 4MVNA 1FMGA 1O3JA 2FXRA 1GJAB 4CR5A 1XXFA 1JMOH 3SI3H 3UQOA 4GHTA 1SHHB 4MNXA 1KLTA 5DO4H 1HAZB 1T8NA 1GI2A 3SW2B 3TITA 1O2NA 1IQMA 1MKWK 3K65B 4MNWA 3SU4A 4X2VA 3PWBA 2UUKB 5E0GA 1QHRB 1TRNA 2H6MA 4Y71A 2JH6D 3SV8A 3ZV9A 1RXPA 3RC6A 4A7IB 1T4UH 1OXGA 1QTFA 1EJMA 3SU0A 1SGPE 1J8AA 3ATKA 2TRMA 2ZI2H 1ZGIA 2BD3A 1ELGA 2QCYA 1O2WA 5DP6A 1QCPA 1GHBF 1PPHE 1HBTH 6GCHG 5JBTA 2KAIB 2WV5A 3TGIE 1ELBA 3W95A 1GJBB 4ZKRU 4B2BA 1LHCH 1P0SH 4K1TA 2WV4A 4YTAA 1O3BA 2OC8A 2A5KA 3SV7A 1NU7B 2G51A 2P8OB 1IQNA 1HNEE 3S9AA 3VB5A 1VITH 1BTZA 1OX1A 3U8OH 4ISOA 2HRVA 1LQDB 5JPMH 2AGGX 1YPJH 3DHKH 1KXCA 1C5MD 4O97A 3KQDA 1Y5BT 5T6FA 4GVUA 2WUCA 3TPIZ 1OWKA 2BDIA 1TA2A 4BOHA 1UO6A 1DUAA 4XBCA 1YPLH 4FVDA 2K1QA 4X6NA 2A4OA 1W13U 2BD5A 1O3OA 3GY2A 5B6OA 3RXRA 1IQLA 4DVAU 4NFEA 2FOCA 3MYWA 4HFPB 1XUGA 2PR3A 2ZNKH 2GV7A 1MKXK 1D3QB 1PPCE 1AFEH 2BDGA 1OS8A 1IHTH 3A87A 1GPZA 3RXJA 3SV9A 1DM4B 4WWYA 1F5LA 1OOKB 1AGJA 1DS2E 2Y7XA 4IC6A 3S7HB 2J4IA 3U8RH 4Y11E 2CMYA 1AY6H 5LH8A 1ZMLA 1TONA 5EG4A 3O8BA 3QDZB 3UR6A 7KMEH 4Z0KA 1YPGH 1NFWA 2ZHFH 1EZQA 2ZPSA 1O2ZA 2ZQ2A 2R2MB 1FZZA 1GDUA 1SR5C 1JXPA 3SGBE 1OWEA 3M37A 2ZDLA 1BTPA 1RIWB 1GBDA 4TWWA 2BTCE 2GTBA 4K60A 4X6PA 2BXUH 1K1OA 2O8LA 5FBIA 2Q6GA 4D9QA 3ATIA 2BDHA 2OINA 3LT3A 1NM6A 2OC1A 1DT2A 4MG3A 3BTDE 2ZECA 1GCTC 2P95A 1W11U 2WPIS 1YYY1 4X0WU 2GMTB 2A7CA 1MTWA 1C5PA 3A7VA 4J2YB 4XBBA 2C3SA 1O2TA 3QUMP 1V2LT 1IQFA 2VVVA 5K0HA 4MNYA 4YM9A 1NESE 2SGFE 3RM2H 1BOQA 2Z6BD 1VGCB 2ESTE 2HNTC 4Q80A 1HV7A 4H6TA 2QF3A 1ETSH 1BMNH 3FP6E 3ODFA 1EZUC 4FXGH 1O2HA 1K28D 1D3TB 2RA3A 1QY6A 3GY8A 5A8XA 2AS9A 1SB1H 3P70B 1ID5H 2J94A 1FIZA 1A46H 4NWKA 1O5EH 2QV1A 1NY22 3TNTA 1EQ9A 3O8CA 1XUIA 3GDUA 3TJNA 1O2PA 2THFB 4R0IA 4GSOA 2SGPE 1O35A 2ALPA 1P9SA 2BX3A 1LKBA 2A5IA 1MTNC 1FPCH 3BIUH 2JKHA 2VWLA 3B9FH 1MBQA 2BHGA 1SLVB 1S84A 5C5OA 2C93B 1YPHE 1DICA 4D9RA 2AGEX 3A88A 1GJCB 2ANMH 3CENA 2GVFA 1PPEE 1GJ4H 1CBWB 3RXEA 4GPGA 5AVDA 4B1TA 1DOJA 2OBOA 1AMHA 3T25A 4ABIA 2AERH 1C2HA 1QB9A 1TYNA 1MUEB 3RC4A 6LPRA 1CT2E 3A85A 2P16A 1YLDA 4IC5A 1BTUA 2OP9A 1ORFA 1SQAA 1INCA 1OKXA 1EXFA 1YPKH 1O5CB 4ASHA 1FQ3A 3RXOA 1A7SA 2H9TH 1AKSB 5E0JA 1H8DH 1QFKH 1G36A 4K1SA 3U69H 1HFDA 3M3VA 3B23B 1LVOA 4Y76A 3M36A 3M61U 5A8ZA 4ZHLU 5FCRA 2G00A 1QB1A 4QT8C 1FV9A 5EW2H 3SZNA 4ABGA 1CHOG 1TNIA 2P8OC 4PROA 2BVXH 2IOTA 2ZCLP 3MH5A 1NRQH 3TH3H 1TMTH 4XOJA 1GBEA 4LZ1H 1SSXA 4AFQA 3MNCA 1GMHF 3TK6A 2BYAX 3MH7A 1TGCA 3ZZ6A 2QY0B 1TGSZ 2WUBA 3A86A 3M7UA 2ULLA 1B7XB 1XKAC 3ZZ9A 1QB6A 1VR1H 4HI3A 1YCPH 4XFQA 5GWZA 1F5KU 1H1BA 3LH3A 3EDXB 1ZMNA 2BLQA 1O5GH 1GI0A 3OYPA 3RLYH 3MO9A 5L30H 1GDQA 4X1PU 3BTKE 1FI8A 4ZXYH 2R0KA 3TGKE 2TIOA 2FOFA 1O36A 4ABBA 1DX5M 1EZSC 4JMYA 1AE5A 1GHWH 2NU2E 4I8JA 1D3PB 5T3HA 4KTSA 1ACBE 1LVYA 1ELDE 1N1LA 2PSXA 2P59A 1VCWA 1P8VC 3RMNH 1GG6C 3PMAB 3A84A 2BQ7B 1V2MT 5DG6A 2W3KA 2ODPA 4X8TH 3TU7H 3IWMA 3S9BA 1A5HA 1Z8RA 2Q1JA 4OS6A 3HATH 1FY5A 3OX7U 3PWCA 2XCFA 3BTQE 3ZZ5A 3K6ZA 1QRWA 1S0RA 3UPEA 1A2CH 2AMQA 5EODA 2STAE 2B9LA 2ANWA 1P2QA 2ZG0H 1QJ7B 2C8YB 3SN8A 1EZXC 1ZSLA 4YLUA 3VB6A 1IQJA 2GDDA 2BLVA 5FPSA 1C9PA 3SGQE 1NZQH 1UTKA 3FZDA 2SGEE 5C1YA 1NO9H 2Z9LA 5DPAA 2FMJA 4Y0YE 1V2TT 2FYRA 1L1GA 1XVOA 2ILNA 1OPHB 1K1JA 4RSPA 2BZAA 5EQRA 2BY9X 3KEEA 3A7WA 1C4U2 1O2MA 2Y5FA 5J4QA 1Y3WA 5K7RA 5F8ZA 2C8XB 3LGWA 4DY7B 1AUJA 1W8BH 3QZQA 5HXFA 3T29A 1LKAA 3GY6A 4E7RG 3GY4A 3QZRA 2ZFFH 3EA7A 1S82A 3AASA 3M3TA 4ZHMU 1A1RA 3LDXH 3GYMA 1JWTA 2H5DA 2BVRH 5ESTE 2AEIH 3T62A 4AYVB 1BB0B 1PJPA 2QXGA 2CV3A 4NIVA 5DP9A 1SLUB 1G2MA 4CREA 3UOPA 1YC0A 2A4GA 5C1XA 2GP9B 3EYDA 4LK4A 3W94A 1AD8H 1GJ7B 3BEFB 4CRDA 1HJ8A 1C2KA 1ZHRA 3RXUA 4I8GA 1OP0A 1WTHD 2FLRH 1ZZZA 3TJUA 4BXSA 1DXPA 1DSUA 3EGKH 3LGYA 2ZKSA 5AFZH 2ZEBA 3MNBA 1O3GA 4DW2U 1TOMH 1TQ7B 3K2UA 1HRTH 5ABWA 2R3UA 4JZEH 5GPIB 4B73A 3PTNA 3AW0A 1EB2A 1SMFE 1A4WH 3RM0H 2Y81A 4I31A 4U01A 1GDNA 3F6UH 3MNXA 4YT6H 2XCNA 2Z94A 1QJ6B 3S9CA 3VFEA 3Q3YA 1HYLA 1C5RA 1HAOH 3LH1A 1F0RA 1QA7A 3R3GB 4IN2A 2FOMB 1ELTA 1IQGA 1RGQA 1O2GH 4BNRA 2XTTB 2OC0A 2BMGB 3ZYDA 4X2XA 4FUDA 3TH4H 2F9BH 4WMEA 1O32A 1WTGH 3NK8A 3NUMA 1O33A 4CBNA 1UHBB 1SGIB 2Y6TA 2Y7ZA 2LPRA 1D9IA 2G4TA 1FAXA 1ZPBA 1KY9A 2SNVA 2GZ8A 5A0BA 2ZP0H 1P2NA 3SJOA 4Q2KA 1MCTA 4U2WA 1Q3XA 2ZGHA 5DP8A 4HGCA 1IQIA 1BTXA 2A2XH 1B0FA 1L4DA 3CS0A 5HM9A 1DXWA 1MCVA 3LGTA 3ZZ8A 1MU8B 3E6PH 4RN6A 1VITG 2FPZA 1OWJA 3E1XB 1FY3A 4CH2B 1NFXA 1C9TA 2B8OH 1P3CA 1NFUA 4ABJA 1GHZA 3MH4A 1QR3E 1GJDB 1CGJE 1IQHA 1BIOA 3GCHB 3AVZA 3A7XA 4E7NA 1EPTA 1GI3A 2F83A 2OQUA 1XMNB 1NTPA 2C8WB 4I8LA 3RXGA 4A1VA 3SOSA 1H4WA 4BTTB 1K1NA 2RA0A 1RJXB 3FZZA 1O39A 5E8EH 5FX6A 1WOFA 5EPNA 5EU8A 1HCGA 1S5SA 1VCPA 2F9OA 2G8TA 2VH6A 2J92A 3E0PB 4MNVA 1CGIE 4NSVA 1LPGB 1A61H 1FNIA 2NU1E 2TGAA 1T32A 3VB3A 1DDJA 1UTOA 1UJ1A 1HXEH 1O30A 4NA7A 1C2FA 2JH5D 3FP8E 2CHAB 1XUKA 2FWWA 1Y3XA 1THRH 1QJ1B 1TGNA 3EQ0H 5C5NA 2W7SA 1WCZA 1GVLA 2W3IA 3PLPA 2GDEH 3LJJA 1IOEA 1P2IA 4B71A 2BY7X 1LHFH 3RP2A 2W7UA 3P95A 1TNLA 1GI5A 1P57B 1FAKH 1P2OA 2UWOA 2GZ9A 5FX5A 1HJAB 1SBWA 2BD7A 2A45B 1GVZA 1UHBA 2CF9H 4XDEA 1ZOMA 4BAOB 5DP4A 3UR9A 1NRPH 3Q3XA 1RTLA 3BEIB 4Y7BA 1G32B 1KXFA 1C2JA 1O3EA 1H9HE 3RMOH 1EATA 1GI6A 1KDQB 4FU8A 3PM3A 4KGAA 4I7YH 1GJ5H 3A7ZA 2VIWA 3ODDA 3OSYA 2BDCA 2D26C 1ESBA 2ZHQH 1V3XA 1V2NT 3SV6A 3MOCA 1FLEE 3ATLA 5E0HA 1V2VT 1LPKB 1AWHB 1ANBA 1ZYOA 2B5TB 1Z1JA 1EOLA 1BRUP 5GDSH 3RXBA 4ZROA 2XNIA 3PMBB 1BCUH 2BLWA 2ZFTA 2A7HA 1B0EA 1PYTD 3M35A 3P8FA 3F9GA 2VNTA 1O3IA 1DE7H 1FUJA 1VITF 3MU4A 1Y8TA 3SUGA 4GHQA 1YPEH 3HPTB 3ZVFA 1SVPA 3KQEA 1L1NA 1GBIA 1TGBA 4KKDA 1ZHMA 3NPSA 3RMLH 5FCKA 1DWBH 1LHDH 2FO9A 1K1PA 2IN2A 1GBHA 1P09A 4ZXXH 1T7CA 5FPYA 3SUEA 1C2DA 1O3DA 3EE0B 5A0CA 1WQSA 3ESTA 4JK5A 4NIYA 1CA0B 2EI6A 3QTVH 1TRMA 4BAKB 1CO7E 4DIHH 2VB0A 3A8AA 4UFEH 1V2QT 1DANH 1N8OC 2BDYA 2SNWA 3TVJB 3URCA 4Y8XA 1PQ7A 1CBWC 3MU1A 4NZQA 1X7AC 2FESH 2AIQA 1C1SA 5L2YH 3SUFA 1Z8IB 4ABEA 2R9PA 2FP7B 5F8TA 1ZRBA 3SU2A 3SI4H 7ESTE 4AYYB 3A82A 1AUTC 2XXLA 3PO1B 1V2KT 1L4ZA 1EJAA 1T8LA 4BTUB 2FLBH 3Q00A 1AHTH 1CA8B 3ZVGA 1P06A 3QK1A 4TWYA 1K1LA 1YKTA 3RXTA 3ZZ4A 3OTJE 1YPMH 1F0UA 3PLKA 1KDQA 4KTUA 2A0QB 5EPYA 5JB9S 1SQOA 2QGRA 4ABFA 1BRAA 3VXEH 3AAUA 3V0XA 1ABJH 3I77A 1DPOA 1W7GH 2H9EH 1ANDA 2HALA 1E0FD 2G81E 4LZ4B 1L0ZA 2BD2A 3RXMA 3MU0A 2AGIX 4F49A 1VJAU 3ITIA 1AFQC 1P3EA 4IN1A 3TIUA 4YZUA 4AGJA 4A5TS 2FI3E 1M9UA 1TBRH 1FY4A 2WPLS 2OC7A 1G3EA 4THNH 2Q6FA 2ZHWH 1O31A 3DA9B 3U8TH 3UREA 3DFLA 1CQQA 3EA9A 4MPWA 3RLWH 8GCHF 1Z7KA 4Y6DA 1W0YH 4B74A 1HLTH 3KQCA 2A1DB 1TMUH 4ZMAH 2AH4X 1O3HA 1JOUB 4TPYA
chains in the Genus database with same CATH superfamily
1TB6H 5DP3A 4TSFD 1FY1A 1Z1IA 1C5LH 3S7KB 4AG2A 4AORA 4LOYH 1DVAH 3ZVDA 1ZPCA 5LPEA 1AQ7A 3B8JA 3SGAE 2FS8A 2ZDKA 2V0BA 1P03A 1C2GA 1FJSA 4HG6A 4UONA 2VIQA 1S6FA 5ESBA 3Q76A 1KLIH 1Z71A 1SGFA 1TFXA 2OBQA 2AMPA 1O2JA 2ZTZA 4X1NU 1GGDB 1BBRH 1LVBA 4BTIB 4NA9H 4X8UH 1TIOA 5HYOA 1TALA 4NZLA 4ZUHA 5LGOA 1MD8A 2HNTF 3OFND 4D8NA 4JYTA 3GDSA 5E2PA 3RU4E 2J2UA 1UCYK 1HUTH 1EFRD 4X2WA 5CE1A 4YESB 1GBFA 2ALVA 1O2VA 1DFPA 2SGDE 3KIDU 1HIAA 2FDAA 1C2MA 2XRCA 1K2I1 2PLXA 3UWIA 2FOEA 3UNRA 1HDTH 2V6NA 1Q31A 3ZZAA 1CA0C 1SGEE 1W3CA 1DY9A 3SNBA 5JBCS 5A8YA 5T6DA 1JRTA 3E0NB 5C1UA 2WHXA 1O5FH 1O3AA 1P2MA 1NS3A 5L2ZH 1KTSB 1GBLA 2UUJB 3RXVA 1UVUH 2ZDAH 4BANB 5EXLA 5HMAA 3BEUA 1EPTC 1ELEE 3D23A 3V3MA 2H5CA 3I78A 3UQVA 1TBQH 2VINA 3R0FA 1V2UT 1TRYA 1QL8A 3SO3A 2F3CE 1G3BA 2Y5HA 1S83A 2J9NA 1YLNA 3RXSA 1QGFA 1P05A 1TPOA 4MPVA 1BJUA 1MTVA 5KGOA 4Y0ZE 1O3PB 1F0SA 2OQ5A 1C5QA 1BUIA 4RT0A 1DSTA 1MTSA 2CF8H 4D7GA 1GBMA 1C5UA 5FL7D 2HPQH 4J1YA 1XXDA 3VXFH 5AFYH 1P02A 2ZO3H 3GCTF 1EAUA 1ESTA 1O3LA 2Z9IA 1RFNA 2J38A 4BAMB 1IQEA 1KXEA 2BOKA 2WPMS 3O8DA 1SG8B 3GY3A 1C1TA 4Y8YA 4SGAE 2PKAA 3OTPA 2J95A 3UNSA 1TA6A 2R2WU 4Y8ZA 3ZVAA 1ZTLA 3QN7A 1H9LB 3SJIA 2P3UB 1CT4E 2XBWA 1BRBE 1MU6B 3MWIU 1SOTA 3RXAA 5AHGH 1C2EA 1V2OT 3VGCC 3VB7A 2QXIA 3M7QA 2P94A 3SU3A 1DWEH 1MKWH 1C1MA 1J16A 3MFJA 3F2HA 5FXLA 3P6ZB 1EAWA 3LGVA 3RXPA 2AMDA 1EAIA 5T6GA 1G3CA 3MU5A 2OK5A 3TK9A 4DT7B 2AFQB 2KCYA 2DUCA 2J97A 1WSSH 1V2WT 4RI0A 1ETRH 1IAUA 3AAVA 3RXDA 1HAHH 5DK1A 3SQEE 1ETTH 1F92A 1NBMD 1ZR0A 4XD7D 3TNSA 4GUXA 2H2ZA 2QIQA 1QL7A 2XYAA 2FIRH 3PV5A 2OLGA 2GZ7A 1AB9B 7GCHF 1BQYA 3LGUA 4YOJA 3E91A 4X1QU 4DIIH 4INHA 3SHCH 1GWAA 1O2RA 3E16B 2D1JA 3QX5H 2ODYB 3BIVH 5SGAE 2WYJA 1DUEA 3FP7E 1GI1A 1GMDF 2XBVA 5GNDA 1MQ5A 4IMQA 2PGBB 1EPTB 3CP7A 3L6PA 2XWAA 4K2YA 1E1RD 1OP8A 2WPKS 2TGTA 2BY6X 1A3EH 3S0NA 3RC5A 4HTCH 2FI5E 1KIGH 4CRCA 4O03A 2VH0A 3PYHA 4MLFB 1C1RA 2Z9GA 3OU0A 4K8BA 3SBKA 2QXJA 3A83A 2RDLA 5FHTA 3UOUA 1H8IH 1A5IA 3STIA 3U1JB 3MMGA 1O37A 4CR9A 3SNCA 3MO6A 1P04A 1ZTJA 2GCHF 2P3TB 2V35A 3BSQA 4WH6A 2BVSH 1UK4A 2I6SA 2ZC9H 3ZZBA 1O5AB 2BY5X 2K8IA 3FN8A 1TPSA 5C2ZA 1BDAA 1C2LA 1SLWB 1AVXA 2Z3EA 1DY8A 1C2IA 2QN5T 2O8WA 5EXNA 1S85A 3ELAH 4DGJA 1LQEA 1OWIA 1O2OA 2ZU5A 2XC0A 2BZ6H 4DURA 4ISIH 1ABIH 1K1MA 2ANKH 1XUFA 4OS5A 1U6QA 1AO5A 1XKBC 4O3UA 2PTNA 2AIPA 1P12E 3GCOA 3D65E 4ESTE 4ZH8A 1K1IA 1YLCA 3QTOH 1GI8B 1DLKB 2FX4A 1RTKA 1T4VH 4I8HA 2A2QH 2H9HA 2VJ1A 4CRFA 4AB9A 2GJGA 3PMHB 5JYIA 4X8SH 2VIOA 1O2LA 2GMTC 1AZ8A 4ABHA 2AHME 2QYIA 4IMZA 1TOCB 2Y5GA 5FBEA 1DITH 3BTWE 4O9VA 4F4OC 2PUQH 1HB0B 1HGTH 3LJOA 3ZVBA 3DSPA 1OWHA 4I33A 2H1UA 3BTFE 1THPB 1BZXE 2NWNA 2D2DA 1TNKA 4Q7ZA 1QIXB 2ZGBH 1VCQA 4AB8A 1FIWA 1AB9C 1E38B 2FS9A 2WINI 3LGIA 4WXVA 1GVKB 4ZAEA 3A89A 1YGCH 1YY3A 2YOLA 5AF9H 3FKSD 2XC4A 3A8DA 2UUFB 1ZSJA 1Z8JB 3IITA 1P2JA 1BMMH 3GCNA 4E05H 1TX8A 2O8UA 2VIDA 1QQUA 1OYTH 2G4UA 1D6RA 2ZFPH 3SHAH 2VGCB 2LP6A 1O38A 1GBTA 4DJZB 1BHXF 1MAXA 4JYVH 1ESAA 1TLDA 1GMCG 2CXVA 2HNTE 4IGDA 2F9NA 4X6MA 2GT7A 3KHVA 4B2AA 2OCVB 4INKA 3TLOA 4Y79A 1ARCA 4YT7H 1BMAA 1TNJA 2TBSA 3MU8A 4CRAA 4K1EA 5G4BA 1O2XA 1UCYH 2KAIA 2ZTYA 5BRRE 1BT7A 1C5XB 1K0HA 2G55A 2GD4B 2M5TA 2QXHA 2TGDA 4TY7A 3RMMH 1PYTC 4NG9H 4P02A 5C17A 2VWMA 2ZGCA 1SKYE 1E79D 2IJOB 3ZVCA 4ZKOU 4OS4A 4RKJB 4XBDA 1VZQH 1TNHA 1TX7A 1Q2WA 1ARBA 3T26A 1V2PT 2BY8X 4NGAH 1L2EA 1IHSH 4Q7XA 2Z3CA 2PGQB 1YPHC 1YBWA 1HAYB 1C1NA 2EC9H 1GJ9B 1O3KA 3LKWA 3LU9B 3URDA 2JIZD 5F6MA 1SPJA 1GBCA 1C4Y2 4DOQA 3OEHD 5FPTA 1HAXB 1CU1A 5GXPA 2CGAA 4CHAB 1G9IE 3PLBA 2V3OH 1XUJA 1ZMJA 2C90B 3SNEA 4GCHG 3NCLA 3VGCB 3RXQA 1AVWA 2I6QA 2IPQX 3WY8A 2UWLA 1SGCA 4AFSA 1LHGH 1QA0A 4I32A 3ATWA 3KF2A 1Y3UA 1FDPA 3L3TA 4BXWA 4JK6A 1W2KH 2EEKA 3GCTG 1GGDC 4FOUC 2ZPQA 5EJ1A 4JZ1A 1BBRE 2VIPA 3M3SA 1AU8A 4DCDA 1BTWA 2PHBA 2PKSC 1GBKA 3OE7D 3DCLA 5DGJA 3BG8A 1H8ED 3H7TA 3TH2H 2JJ2D 3EAJA 5TJXA 1O3MA 3UIRA 2FYQA 3GCHC 3RXHA 6CHAC 1THSH 1VGCC 1BITA 1MZAA 2ZDMA 3GISB 3F1SB 5HIYA 4RT1A 4DG4A 2KZ4A 8ESTE 1BTHH 1JIMA 2BD9A 1UCYE 2ODQA 2ZU2A 5E2OA 2F91A 1NT1A 3STJA 3VB4A 2GCHG 2W5EA 1MMJN 3A80A 3UFAA 3RXFA 2VIVA 1NN6A 4MQAA 5EQQA 3MH6A 2YNBA 1GCTB 1RD3B 3F9HA 1C1WH 4D76A 1C1OA 2BXTH 1LVMA 2HLCA 1AKSA 5EOKA 3P8OA 2BX4A 3BG4B 3BTEE 3TK5A 1ANEA 3SJ9A 5HIZA 3IG6B 2ZCKP 4NSYA 4HZHA 1AFQB 2OXSA 1UVOA 2EA3A 1QURH 2Z9JA 2PV9B 3Q77A 5EXMA 3VEQB 5IDKA 2Y82A 4AFUA 4O3TA 3OY6U 2NU0E 4DT4A 5BPEA 2OD3B 1C1VH 4SGBE 5H4IB 3ZZCA 4CH8B 4JZIA 4CHAC 1YP9A 2FEQH 5PTPA 1A0LA 1TX6A 3C1KA 2BDAA 3SU5A 6ESTA 3BTHE 1ZLRA 3HKIB 3QLPH 1SGYE 3M5OA 1SI5H 1UVTH 3M5LA 2GKVE 2A4QA 1LHEH 1SL3A 5JBAS 1SGNE 3PRDA 1LCYA 5A2MH 2GX4A 3GOVB 3E8LA 2OUAA 2QA9E 5C3NA 3RUOA 4NIXA 3A7YA 4AFZA 1HAPH 4Y10E 5DP7A 1F2SE 2OTVA 1KTTB 4ISLA 3RU4T 4JZDH 1SGTA 1KXBA 1GL0E 3I29A 4NFFA 2QC2A 2KR7A 2Z3DA 5C20A 1MBMA 2W6ID 2SFAA 1O2UA 4X6OA 3A81A 2V3HH 4FUIA 1LTOA 3M7TA 2FI4E 3LPRA 1VKYA 3VG8A 1SGFG 1UTLM 5EQSA 6CHAB 1V2ST 3V12A 2PKSB 1O2SA 2C8ZB 2GCTB 3GY7A 4U30A 1MTUA 1WYKA 1G3DA 1SOZA 1CVWH 3RXIA 1OSSA 5C67A 3TJOA 3ZVEA 4A1TA 2FX6A 5HGGA 4FUCA 1J15A 1F7ZA 1DLEA 4YOGA 5GCHF 1G30B 2ZPRA 1P2KA 2AYWA 3KL6A 1NFYA 4GCHF 2ZGXH 4ISHH 1WU1A 3FVFB 5FAHA 1GHVH 5JBBS 1YM0A 1HPGA 2LNCA 1E35B 3SZEA 2FTMA 1EP6A 1YCPK 1O34A 1S0QA 3D62A 2ZHDA 3Q3KA 3U98H 1C5TA 3S69A 2ZFRH 1K21H 5A09A 3E3TA 9LPRA 1TPAE 1RRKA 1BTYA 3BN9A 4IS5A 1SQRA 1C5VA 4OGYA 2HGTH 3P8NA 2GV6A 2KFWA 1W14U 1J9CH 1UTJA 1NPMA 2ZHEH 4E06H 1EKBB 4NA8A 3DFJA 3VPKA 1P9UA 2A7JA 1D6WA 4FUHA 5CMXH 1OHHD 3RXKA 3A8CA 1L1JA 4X1RU 1BJVA 3H5CB 4OGXA 5GIBA 3A7TA 3DT0H 4FUBA 1BA8B 4H6SB 4UEHH 2PTCE 2A31A 2HOBA 3H7OA 4K8YA 1Y5UT 4BAHB 1KXAA 1V2RT 1TQ0B 2C4FH 3ZZ7A 4A6LA 3SU1A 3H09A 1HJAC 2NU3E 4GLYA 4BAQB 4M7GA 1EP5A 1GHXH 4NWLA 4MDSA 1C5OH 4CBOA 2XBXA 2XC5A 1ZRKA 2O8MA 4D7FA 1C5ZB 2VWNA 4ABDA 4AZ2B 2PWXA 3RU4D 3NZIA 4I8KA 1LPZB 1HAVB 1GHAG 1J17T 4ZHAA 1HJ9A 1DWDH 2ZU1A 5LPRA 1ZHPA 3KQBA 1PPZA 1V6DA 4R8TB 4X2YA 1GJ6A 2G5VA 2HWLB 3DD2H 2TGPZ 1IQKA 1Y5AT 3QWCH 4WH8A 4WVPE 2VWOA 3QGNB 3BTTE 1Z6EA 1HXFH 1SGDE 2QF0A 3BTGE 1ELVA 1MZDA 1C1QA 1RS0A 2BD4A 3T2NA 3D49H 3NXPA 1O2QA 4A92A 2HPPH 3G01A 1GHBG 4UE7H 3PTBA 2TPIZ 3ZZDA 3T28A 3P8GA 1UVSH 5TCAA 2WV9A 1Y59T 4XE4A 1W10U 3EA8A 4FU9A 5F8XA 1SGRE 2VVCA 2ZCHP 3RDZA 4TYDA 3HGPA 2UWPA 8KME2 1XVMA 2BDBA 4CRGA 3SJ8A 3C27B 1BRCE 1GG6B 2ZU3A 1GMCF 1MQ6A 2FM2A 2DE9A 3MNSA 2BM2A 1O5BB 3F9EA 3SNAA 1XX9A 2J98B 2QAAA 4B6FA 1CHGA 1AZZA 2FODA 1GHYH 2GCTC 5JB8S 2STBE 4X1SU 1Y3YA 1A0JA 1MH0A 3M5NA 1WUNH 1D4PB 1W0ZU 2ZFSA 4WMFA 3MQKC 4FU7A 1FY8E 2B7DH 4Z1MD 1Z6JH 2A5AA 1QRZA 1O5DH 1KLJH 3NKKA 4GAWA 4YLQH 1ELAA 2EI8A 7GCHG 1C4V2 1PPFE 1O0DH 1TBZH 3U9AH 1ANCA 4IBLH 4YOIA 2FOGA 2XOKD 4ZKSU 4Z6AH 4OS1A 5L6NH 1OWDA 1ZJKA 1A5GH 4MPUA 1C5SA 2G5NA 5LPFA 1BMLA 1DWCH 2ASUB 4WMDA 2F9UA 1HAVA 4VGCB 1UK2A 3QGJA 2SGQE 5DKMA 1GI9B 1HIAB 1RTFB 1KMHB 3T27A 4AOQA 4LXBH 3SNDA 4JCNA 2JETB 1A0HB 2PW8H 3QO6A 3MHWU 1GMHG 1LO6A 2VGCC 1GBBA 4WXIA 1SQTA 1WBGB 1E34B 1TPPA 5ETXA 2A32A 4WJG2 1FPHH 4WF8A 1CHOF 2F9VA 2BQWB 4FUJA 5EGMA 4XSKU 4K3JA 1EJNA 3A8BA 3JZ1B 1EOJA 3FANA 1AN1E 2FZZA 1UTMA 1O3NA 1QQ4A 3LOXA 4I86A 4UFDH 3LC5A 1N6XA 1EX3A 3GS9A 1UMAH 1PQAA 3NWUA 5DJ7A 3V13A 4K5ZA 5JDUB 5IYTA 2PFEA 2BB4A 2FOAA 3BV9B 3UTUH 7LPRA 2PSYA 3PROA 5F03A 5GJ4B 3P92A 2VU8E 1NC6A 1BHXB 4Y7AA 4FUEA 1JRSA 3UWJH 1MAYA 5DP5A 3E90B 3M5MA 3SQHE 2B0FA 3U1IB 4TY6A 3TJVA 1TMBH 4X8VH 2RG3A 2W6JD 1G37A 1GI4A 2W26A 2ZDVH 1B5GH 1TAWA 1GBJA 1GHAF 3GY5A 1C5WB 4FUFA 2VVUA 1C5YB 2ZQ1A 3N7OA 1ZTKA 1AWFH 1HAGE 2Z7FE 1AI8H 2BQ6B 3GYLB 1WDIA 1TABE 2P3FH 2ZIQH 1WAYB 3UNQA 3FAOA 1T31A 1CGHA 2WPJS 2CHAC 3KYGA 3T5FH 1W12U 3V7TA 1S6HA 1WV7H 2Z9KA 5I46H 1LMWB 2XBYA 2ZWLH 2XWBI 4JZFH 1SGQE 1FONA 3ATMA 1GMDG 5A0AE 1TGTA 1ELFA 1UTQA 1E36B 3MI4A 1C1PA 3HK3B 2J34A 1K22H 2ZFQH 2ZZUH 8LPRA 3KCGH 3AW1A 3DUXH 3HK6B 4ZCNA 1PPGE 5KECA 4OS2A 1FN6A 4CRBA 1UTPA 2FTLE 3U28C 3BTME 1D3DB 1SFQB 4NCYA 3ZZ3A 4B76A 2ZDNA 3OEED 1ELCA 2D8WA 3BG4C 3KGPA 4ISNA 5CHBA 1S81A 1O3FA 3CS7A 3SU6A 1GCDA 1KXDA 5EW1H 1AIXH 2ZF0H 1W7XH 1W0JD 2ZA5A 3SORA 2ZGJA 3F68H 3PO1C 1WQVH 3P17H 2CJIA 1QNJA 2HVXA 2CN0H 4RKOB 2QE7D 4KELA 3MTYA 3SYJA 1E37B 2QF4A 2R0LA 3SUDA 1Z8GA 4FVBA 2WPHS 1OYQA 3LONA 2PKAB 2UUYA 1GL1A 2BD8A 3LIWA 2ANYA 1FN8A 2ZU4A 1VJ9U 4B75A 3RXCA 3DSGA 3ZYEA 3JZ2B 4UD9H 1SC8U 1TWXB 1TNGA 2F9PA 4K69A 5CHAC 4H42U 1P11E 4JYUH 4ACBA 4OS7A 3SJKA 1V2JT 2Y80A 1YF4A 1P01A 1NRRH 2JETC 3FFGA 3OY5U 3O8RA 2O9QA 1PQ5A 2FOHA 2YNAA 2BOHB 1NROH 5TCCA 6GCHF 5HM2A 1G2LA 5GCHG 1N6YA 3PB1E 1FXYA 2P93A 3KNXA 1C5NH 4ABAA 1MD7A 1K9OE 1N8OB 2O8TA 4Q7YA 5I25A 1LDTT 1F5RA 3GDVA 1J14A 1PFXC 1EB1H 2FOBA 2R3YA 1O2KA 1EUFA 1TE0A 3L33A 1AVGH 1NRNH 1UTNA 3MO3A 5CHAB 2WYGA 1XM1A 3PV4A 1ZJDA 1H9IE 3LC3A 1RIWC 5J4SA 4KTCA 2ZTXA 5C0UA 1QRXA 3KN2A 1O3CA 1CT0E 1QBNA 1T8OA 4YO9A 4U32A 3ZV8A 1YCPM 2A4RA 4A1XA 3GICB 9ESTA 2YMSC 3SV2H 2IPHA 4UFGH 1F0TA 1ZPZA 3TGJE 1MKXH 2KX4A 1C1UH 4MTBA 8GCHG 1EAXA 3UB0A 1CE5A 4TPIZ 1NRSH 2GT8A 3HKJB 1GBAA 1BBRK 1KSNA 3HGNA 2M2AA 1ZSKA 4H4FA 4AN7A 2XW9A 4KP0A 3RXLA 4VGCC 4UFFH 4B2CA 2SGAA 1XUHA 3K6YA 1JIRA 3PMJA 1QBOA 1SFIA 2Q6DA 1SHYA 2JH0D 1AE8H 1HAIH 1T8MA 1O2YA 1QBVH 1UVPA 2G52A 1OP2A 4ZKNU 1SLXB 1NU9A 4AX9H 2RCEA 1ZGVA 1PPBH 4INLA 1A3BH 4WY3A 4FUGA 2EI7A 1UK3A 1KYNA 1GI7B 1PQ8A 1JBUH 4UDWH 1EASA 1GJ8B 4MPXA 3ENSB 3WW7A 1CSOE 3F9FA 3UY9A 1QL9A 2NU4E 1O2IA 1P10A 3BF6H 3K9XB 1MTNB 2PUXB 4IW4E 2BLOA 4NIWA 4AGKA 2DE8A 2GGVB 3WWBA 4AG1A 3UUZA 1Y3VA 4MVNA 1FMGA 1O3JA 2FXRA 1GJAB 4CR5A 1XXFA 1JMOH 3SI3H 3UQOA 4GHTA 1SHHB 4MNXA 1KLTA 5DO4H 1HAZB 1T8NA 1GI2A 3SW2B 3TITA 1O2NA 1IQMA 1MKWK 3K65B 4MNWA 3SU4A 4X2VA 3PWBA 2VBCA 2UUKB 5E0GA 1QHRB 1TRNA 2H6MA 4M9FA 4Y71A 2JH6D 3SV8A 3ZV9A 1RXPA 3RC6A 4A7IB 1T4UH 1OXGA 5KEDA 3F0OA 1QTFA 1EJMA 3SU0A 1SGPE 1J8AA 3ATKA 2TRMA 2ZI2H 1ZGIA 2BD3A 1ELGA 2QCYA 1O2WA 5DP6A 1QCPA 1GHBF 1PPHE 1HBTH 6GCHG 5JBTA 2KAIB 2WV5A 3TGIE 4B6EA 1ELBA 3W95A 1GJBB 4ZKRU 4B2BA 1LHCH 1P0SH 4K1TA 2WV4A 4YTAA 1O3BA 2OC8A 2A5KA 3SV7A 1NU7B 2G51A 2P8OB 1IQNA 1HNEE 3S9AA 3VB5A 1VITH 1BTZA 1OX1A 3U8OH 3EE7A 1W0KD 4ISOA 2HRVA 1LQDB 5JPMH 2AGGX 1YPJH 3DHKH 1KXCA 1C5MD 4O97A 3KQDA 1Y5BT 5T6FA 4GVUA 2WUCA 3TPIZ 1OWKA 2BDIA 1TA2A 4BOHA 1UO6A 1DUAA 4XBCA 1YPLH 4FVDA 2K1QA 4X6NA 2A4OA 1W13U 2BD5A 3F2GA 1O3OA 3GY2A 1MABB 2QF5A 5B6OA 3RXRA 1IQLA 4DVAU 4NFEA 2FOCA 3MYWA 4HFPB 1XUGA 2PR3A 2ZNKH 5IK2D 2GV7A 1MKXK 1D3QB 1PPCE 1AFEH 2BDGA 1OS8A 1IHTH 3A87A 1GPZA 3RXJA 3F2FA 3SV9A 1DM4B 4WWYA 1F5LA 1OOKB 1AGJA 1DS2E 2Y7XA 4IC6A 3S7HB 2J4IA 3U8RH 4Y11E 2CMYA 1AY6H 5LH8A 2RFKC 1ZMLA 1TONA 5EG4A 3O8BA 3QDZB 3UR6A 7KMEH 4Z0KA 1YPGH 1NFWA 2ZHFH 1EZQA 2ZPSA 1O2ZA 2ZQ2A 2R2MB 1FZZA 1GDUA 1SR5C 1JXPA 3SGBE 2F43B 1OWEA 3M37A 2ZDLA 2L6OA 1BTPA 1RIWB 1GBDA 4TWWA 2BTCE 2GTBA 4K60A 4X6PA 2BXUH 1FX0B 1K1OA 2O8LA 5FBIA 3DSOA 2Q6GA 4D9QA 3ATIA 2J5UA 2BDHA 2OINA 3LT3A 1NM6A 2OC1A 1DT2A 2CK3D 3BTDE 2ZECA 4MG3A 1GCTC 2P95A 5HKKD 1W11U 2WPIS 1YYY1 4X0WU 2GMTB 2A7CA 1MTWA 1C5PA 3A7VA 4J2YB 4XBBA 2C3SA 1O2TA 3QUMP 1V2LT 1IQFA 2VVVA 5K0HA 4MNYA 4YM9A 1NESE 2SGFE 3RM2H 1BOQA 1NBME 4OM9A 2Z6BD 1VGCB 2ESTE 2HNTC 4Q80A 1HV7A 4H6TA 2QF3A 1S6LA 1ETSH 1BMNH 3FP6E 3ODFA 1EZUC 4FXGH 1O2HA 1K28D 1D3TB 2RA3A 1QY6A 3GY8A 5A8XA 2AS9A 1SB1H 3P70B 1ID5H 2J94A 1FIZA 1A46H 4NWKA 1O5EH 2QV1A 1NY22 3TNTA 1EQ9A 3O8CA 2J98A 1XUIA 3GDUA 3TJNA 1O2PA 2THFB 4FETA 4R0IA 4GSOA 2SGPE 1O35A 2ALPA 1P9SA 2BX3A 1LKBA 2A5IA 1MTNC 1FPCH 3BIUH 2JKHA 2VWLA 2WZQA 3B9FH 1MBQA 2BHGA 1SLVB 1S84A 5C5OA 2C93B 1YPHE 1DICA 4D9RA 2AGEX 3A88A 1GJCB 2ANMH 3CENA 2GVFA 1PPEE 1GJ4H 1CBWB 3RXEA 4GPGA 5AVDA 4B1TA 1DOJA 2OBOA 1AMHA 3T25A 4ABIA 2AERH 1C2HA 1QB9A 1TYNA 1MUEB 3RC4A 6LPRA 1CT2E 3A85A 2P16A 1YLDA 4IC5A 1BTUA 2OP9A 1ORFA 1SQAA 1INCA 1OKXA 1EXFA 5T1VA 1YPKH 1O5CB 4ASHA 1FQ3A 3F3BA 3RXOA 1A7SA 2H9TH 1AKSB 5E0JA 1H8DH 1QFKH 1G36A 2K0QA 4K1SA 3U69H 1HFDA 3M3VA 3B23B 1LVOA 4Y76A 3M36A 3M61U 5A8ZA 4ZHLU 5FCRA 2G00A 1QB1A 4QT8C 1FV9A 5EW2H 3SZNA 4ABGA 1CHOG 1TNIA 2P8OC 4PROA 2BVXH 2IOTA 5EJZA 2ZCLP 3MH5A 1NRQH 3TH3H 1TMTH 4XOJA 1GBEA 4LZ1H 1SSXA 4AFQA 3MNCA 1GMHF 3TK6A 2BYAX 3MH7A 1TGCA 3ZZ6A 2QY0B 1TGSZ 2WUBA 3A86A 3M7UA 2ULLA 1B7XB 1XKAC 3ZZ9A 1QB6A 1VR1H 4HI3A 1YCPH 4XFQA 5GWZA 4TT3D 1F5KU 1H1BA 3LH3A 3EDXB 1ZMNA 2BLQA 1O5GH 1GI0A 3OYPA 3RLYH 1H8HD 3MO9A 2JDID 3W1EA 5L30H 1GDQA 4X1PU 3BTKE 1FI8A 4ZXYH 2R0KA 3TGKE 2TIOA 2FOFA 1O36A 4ABBA 1DX5M 1EZSC 4JMYA 1AE5A 1GHWH 2NU2E 4I8JA 1D3PB 5T3HA 4KTSA 1ACBE 1LVYA 1ELDE 4F55A 1YWUA 1N1LA 2PSXA 2P59A 1VCWA 2L74A 1P8VC 3RMNH 1GG6C 3PMAB 3A84A 2BQ7B 1V2MT 4XRNA 5DG6A 2W3KA 2ODPA 4X8TH 3TU7H 4P00A 3IWMA 3S9BA 1A5HA 1Z8RA 2Q1JA 4OS6A 2XNDD 3HATH 1FY5A 3OX7U 3PWCA 2XCFA 3BTQE 3ZZ5A 3K6ZA 1QRWA 1S0RA 3UPEA 1A2CH 2AMQA 5EODA 2STAE 5DSFA 2B9LA 2ANWA 1P2QA 2ZG0H 1QJ7B 2C8YB 3SN8A 1EZXC 1ZSLA 4YLUA 3VB6A 1IQJA 2GDDA 2BLVA 5FPSA 1C9PA 3SGQE 1NZQH 2KCPA 1UTKA 4AC9A 3FZDA 2SGEE 5C1YA 1NO9H 2Z9LA 5DPAA 2FMJA 4Y0YE 1V2TT 2FYRA 1L1GA 1XVOA 2ILNA 1OPHB 1K1JA 4RSPA 2KM0A 2BZAA 5EIYA 5EQRA 2BY9X 3KEEA 3A7WA 3AK5A 1C4U2 1O2MA 2Y5FA 5J4QA 1Y3WA 5K7RA 5F8ZA 2C8XB 3LGWA 4DY7B 1AUJA 4F48B 1W8BH 3QZQA 5F53A 4Q63A 5HXFA 3T29A 1LKAA 3GY6A 4E7RG 5CDFE 3GY4A 3QZRA 2ZFFH 3EA7A 1S82A 3AASA 3M3TA 4ZHMU 1A1RA 3LDXH 3GYMA 1E1QD 1JWTA 2H5DA 2BVRH 5ESTE 2AEIH 3T62A 4AYVB 1BB0B 1PJPA 2QXGA 2CV3A 4NIVA 5DP9A 2KCOA 1SLUB 1G2MA 4CREA 3UOPA 1YC0A 2A4GA 5C1XA 2GP9B 3EYDA 4LK4A 3W94A 1AD8H 1GJ7B 3BEFB 4CRDA 1HJ8A 1C2KA 1ZHRA 2HLDD 3RXUA 4I8GA 1OP0A 1WTHD 2FLRH 1ZZZA 3TJUA 4BXSA 1DXPA 1DSUA 3EGKH 3LGYA 2ZKSA 5AFZH 2ZEBA 3MNBA 1O3GA 2LELA 4DW2U 1TOMH 1TQ7B 3K2UA 3ZIAD 1HRTH 5ABWA 2R3UA 4JZEH 5GPIB 4B73A 3N7DA 3PTNA 3AW0A 1EB2A 1SMFE 1A4WH 3RM0H 2Y81A 4I31A 4U01A 1GDNA 3F6UH 3MNXA 5B6LA 4Q4LA 4YT6H 2XCNA 2Z94A 1QJ6B 3S9CA 3VFEA 3Q3YA 1HYLA 1C5RA 1HAOH 3LH1A 2F4LA 1F0RA 1QA7A 3R3GB 3F0PA 4IN2A 2FOMB 1ELTA 1IQGA 4YXWD 1RGQA 1O2GH 4BNRA 2XTTB 2OC0A 2BMGB 3ZYDA 4X2XA 4FUDA 3TH4H 2F9BH 4WMEA 1O32A 1WTGH 3NK8A 3N7EA 3NUMA 1O33A 3OAAD 4CBNA 1UHBB 1SGIB 2Y6TA 1QZ8A 2Y7ZA 2EQNA 2LPRA 1D9IA 2G4TA 1FAXA 1ZPBA 1KY9A 2SNVA 2GZ8A 5A0BA 2ZP0H 2PP6A 1P2NA 3SJOA 4Q2KA 1MCTA 4U2WA 1Q3XA 2ZGHA 5DP8A 4HGCA 1IQIA 1BTXA 2A2XH 1BMFD 1B0FA 1L4DA 3CS0A 5HM9A 1DXWA 1MCVA 3LGTA 3ZZ8A 1MU8B 3E6PH 4RN6A 1VITG 2FPZA 1OWJA 3FOAA 3E1XB 1FY3A 4CH2B 1NFXA 1C9TA 2B8OH 1P3CA 1NFUA 4ABJA 1GHZA 3MH4A 1QR3E 1GJDB 3WWFA 1CGJE 1IQHA 1BIOA 3GCHB 3AVZA 3A7XA 3PV2A 4E7NA 1EPTA 1GI3A 2F83A 2OQUA 1XMNB 1NTPA 2C8WB 4I8LA 3RXGA 4A1VA 3SOSA 1H4WA 4BTTB 1K1NA 2RA0A 1RJXB 3FZZA 2IJD1 1O39A 3FO8D 5E8EH 5FX6A 1WOFA 5EPNA 5EU8A 1HCGA 1S5SA 1VCPA 2F9OA 2G8TA 2J92A 2VH6A 3E0PB 4MNVA 1CGIE 4NSVA 1LPGB 2V7QD 1A61H 1FNIA 2NU1E 2TGAA 1T32A 3VB3A 1DDJA 1UTOA 1UJ1A 1HXEH 1O30A 4NA7A 1C2FA 2JH5D 3FP8E 2CHAB 1XUKA 3NRLA 2RDEA 2FWWA 1Y3XA 4ASUD 1THRH 1QJ1B 1TGNA 3EQ0H 2HVYB 5C5NA 2W7SA 1WCZA 1GVLA 2W3IA 2V3MA 2JJ1D 3PLPA 2GDEH 3LJJA 1IOEA 3N99A 1P2IA 4B71A 2BY7X 1LHFH 3UAIC 3RP2A 2EY4C 5DN6D 2W7UA 3P95A 1TNLA 1GI5A 1P57B 1FAKH 1P2OA 2UWOA 2GZ9A 5FX5A 1HJAB 1SBWA 2BD7A 2A45B 1GVZA 1UHBA 2CF9H 4XDEA 1ZOMA 4BAOB 5DP4A 3UR9A 1NRPH 3Q3XA 1RTLA 3BEIB 4Y7BA 1G32B 1KXFA 1C2JA 1O3EA 1H9HE 2WSSD 3RMOH 1EATA 1GI6A 1KDQB 4FU8A 3PM3A 4KGAA 4I7YH 1GJ5H 3A7ZA 2VIWA 3ODDA 3OSYA 2BDCA 2D26C 1ESBA 2ZHQH 1V3XA 1V2NT 3SV6A 3CNRA 3MOCA 1FLEE 3ATLA 5E0HA 1V2VT 1LPKB 1WXRA 1AWHB 1ANBA 1ZYOA 2B5TB 1Z1JA 1EOLA 1BRUP 5GDSH 3RXBA 4ZROA 2XNIA 3PMBB 1BCUH 5C94A 2BLWA 2ZFTA 2A7HA 5EJLA 1B0EA 1PYTD 3M35A 3P8FA 3F9GA 2VNTA 1O3IA 1DE7H 1FUJA 1VITF 3MU4A 1Y8TA 3SUGA 4GHQA 1YPEH 3HPTB 3ZVFA 1SVPA 2WPDD 3KQEA 1L1NA 1GBIA 1TGBA 4KKDA 1ZHMA 3NPSA 3RMLH 5FCKA 1DWBH 1LHDH 2FO9A 1K1PA 2IN2A 1GBHA 1COWD 1P09A 4ZXXH 1T7CA 5FPYA 3SUEA 1C2DA 1O3DA 3EE0B 3KQ5A 5A0CA 1WQSA 3ESTA 4JK5A 4NIYA 1CA0B 2EI6A 3QTVH 1TRMA 4BAKB 1CO7E 4DIHH 2VB0A 3A8AA 4UFEH 4ACAA 1V2QT 1DANH 1N8OC 2BDYA 2SNWA 3TVJB 3URCA 4Y8XA 1PQ7A 1CBWC 3MU1A 4NZQA 1X7AC 2FESH 2AIQA 1C1SA 5L2YH 3SUFA 1Z8IB 4ABEA 2YMSD 2R9PA 2FP7B 5F8TA 1ZRBA 3SU2A 3SI4H 7ESTE 4AYYB 3A82A 1AUTC 2XXLA 3PO1B 1V2KT 1L4ZA 1EJAA 1T8LA 5C0TA 2YMSB 4BTUB 2FLBH 3Q00A 1AHTH 1CA8B 3ZVGA 1P06A 3QK1A 4TWYA 1K1LA 1YKTA 3RXTA 3ZZ4A 3OTJE 1YPMH 1F0UA 3PLKA 1KDQA 4KTUA 2A0QB 5EPYA 5JB9S 1SQOA 2QGRA 4ABFA 1BRAA 3VXEH 3AAUA 3V0XA 1ABJH 3I77A 1DPOA 1W7GH 2H9EH 1ANDA 2HALA 1E0FD 2G81E 4LZ4B 1L0ZA 1UW7A 2BD2A 3RXMA 3MU0A 2AGIX 4F49A 1VJAU 3ITIA 1AFQC 1P3EA 4IN1A 3TIUA 4YZUA 4AGJA 4A5TS 2FI3E 1M9UA 1TBRH 1FY4A 2WPLS 2OC7A 1G3EA 4THNH 2Q6FA 2ZHWH 1O31A 3DA9B 3U8TH 3UREA 3DFLA 1CQQA 3EA9A 4MPWA 3RLWH 8GCHF 3PRBA 1Z7KA 4Y6DA 1W0YH 3KYFA 4B74A 1HLTH 3KQCA 2A1DB 1TMUH 4ZMAH 2KCAA 2AH4X 1O3HA 1JOUB 4TPYA
chains in the Genus database with same CATH topology
1TB6H 5DP3A 1FY1A 1Z1IA 1C5LH 3S7KB 4AG2A 4AORA 4LOYH 1DVAH 3ZVDA 1ZPCA 5LPEA 1AQ7A 3B8JA 3SGAE 2FS8A 2ZDKA 2V0BA 1P03A 1C2GA 1FJSA 4UONA 2VIQA 1S6FA 5ESBA 3Q76A 1KLIH 1Z71A 1SGFA 1TFXA 2OBQA 2AMPA 1O2JA 2ZTZA 4X1NU 1GGDB 1BBRH 1LVBA 4BTIB 4NA9H 4X8UH 1TIOA 5HYOA 1TALA 4NZLA 4ZUHA 5LGOA 1MD8A 2HNTF 4D8NA 4JYTA 3GDSA 5E2PA 3RU4E 2J2UA 1UCYK 1HUTH 4X2WA 5CE1A 4YESB 1GBFA 2ALVA 1O2VA 1DFPA 2SGDE 3KIDU 1HIAA 2FDAA 1C2MA 2XRCA 1K2I1 2PLXA 3UWIA 2FOEA 3UNRA 1HDTH 2V6NA 1Q31A 3ZZAA 1CA0C 1SGEE 1W3CA 1DY9A 3SNBA 5JBCS 5A8YA 5T6DA 1JRTA 3E0NB 5C1UA 1O5FH 1O3AA 1P2MA 1NS3A 5L2ZH 1KTSB 1GBLA 2UUJB 3RXVA 1UVUH 2ZDAH 4BANB 5EXLA 5HMAA 3BEUA 1EPTC 1ELEE 3D23A 3V3MA 2H5CA 3I78A 3UQVA 1TBQH 2VINA 3R0FA 1V2UT 1TRYA 1QL8A 3SO3A 2F3CE 1G3BA 2Y5HA 1S83A 2J9NA 3RXSA 1QGFA 1P05A 1TPOA 4MPVA 1BJUA 1MTVA 4Y0ZE 1O3PB 1F0SA 2OQ5A 1C5QA 1BUIA 1DSTA 1MTSA 2CF8H 4D7GA 1GBMA 1C5UA 2HPQH 4J1YA 1XXDA 3VXFH 5AFYH 1P02A 2ZO3H 3GCTF 1EAUA 1ESTA 1O3LA 2Z9IA 1RFNA 2J38A 4BAMB 1IQEA 1KXEA 2BOKA 2WPMS 3O8DA 1SG8B 3GY3A 1C1TA 4Y8YA 4SGAE 2PKAA 2J95A 3UNSA 1TA6A 2R2WU 4Y8ZA 3ZVAA 1ZTLA 3QN7A 1H9LB 3SJIA 2P3UB 1CT4E 2XBWA 1BRBE 1MU6B 3MWIU 1SOTA 3RXAA 5AHGH 1C2EA 1V2OT 3VGCC 3VB7A 2QXIA 3M7QA 2P94A 3SU3A 1DWEH 1MKWH 1C1MA 1J16A 3MFJA 5FXLA 3P6ZB 1EAWA 3LGVA 3RXPA 2AMDA 1EAIA 5T6GA 1G3CA 3MU5A 3TK9A 4DT7B 2AFQB 2DUCA 1WSSH 1V2WT 1ETRH 1IAUA 3AAVA 3RXDA 1HAHH 5DK1A 3SQEE 1ETTH 1F92A 1ZR0A 3TNSA 4GUXA 2H2ZA 2QIQA 1QL7A 2XYAA 2FIRH 2OLGA 2GZ7A 1AB9B 7GCHF 1BQYA 3LGUA 4YOJA 3E91A 4X1QU 4DIIH 4INHA 3SHCH 1GWAA 1O2RA 3E16B 2D1JA 3QX5H 2ODYB 3BIVH 5SGAE 2WYJA 1DUEA 3FP7E 1GI1A 1GMDF 2XBVA 1MQ5A 4IMQA 2PGBB 1EPTB 3CP7A 3L6PA 2XWAA 4K2YA 1OP8A 2WPKS 2TGTA 2BY6X 1A3EH 3S0NA 3RC5A 4HTCH 2FI5E 1KIGH 4CRCA 4O03A 2VH0A 3PYHA 4MLFB 1C1RA 2Z9GA 3OU0A 4K8BA 3SBKA 2QXJA 3A83A 2RDLA 5FHTA 3UOUA 1H8IH 1A5IA 3STIA 3U1JB 3MMGA 1O37A 4CR9A 3SNCA 3MO6A 1P04A 1ZTJA 2GCHF 2P3TB 2V35A 3BSQA 4WH6A 2BVSH 1UK4A 2I6SA 2ZC9H 3ZZBA 1O5AB 2BY5X 5C2ZA 1TPSA 1BDAA 1C2LA 1SLWB 1AVXA 2Z3EA 1DY8A 1C2IA 2QN5T 2O8WA 5EXNA 1S85A 3ELAH 4DGJA 1LQEA 1OWIA 1O2OA 2ZU5A 2XC0A 2BZ6H 4DURA 4ISIH 1ABIH 1K1MA 2ANKH 1XUFA 4OS5A 1U6QA 1AO5A 1XKBC 4O3UA 2PTNA 2AIPA 1P12E 3GCOA 3D65E 4ESTE 4ZH8A 1K1IA 1YLCA 3QTOH 1GI8B 1DLKB 2FX4A 1RTKA 1T4VH 4I8HA 2A2QH 2H9HA 2VJ1A 4CRFA 4AB9A 3PMHB 5JYIA 4X8SH 2VIOA 1O2LA 2GMTC 1AZ8A 4ABHA 2QYIA 4IMZA 1TOCB 2Y5GA 5FBEA 1DITH 3BTWE 4O9VA 4F4OC 2PUQH 1HB0B 1HGTH 3LJOA 3ZVBA 1OWHA 4I33A 2H1UA 3BTFE 1THPB 1BZXE 2NWNA 2D2DA 1TNKA 4Q7ZA 1QIXB 2ZGBH 1VCQA 4AB8A 1FIWA 1AB9C 1E38B 2FS9A 2WINI 3LGIA 4WXVA 1GVKB 4ZAEA 3A89A 1YGCH 2YOLA 5AF9H 2XC4A 3A8DA 2UUFB 1ZSJA 1Z8JB 3IITA 1P2JA 1BMMH 3GCNA 4E05H 1TX8A 2VIDA 2O8UA 1QQUA 1OYTH 2G4UA 1D6RA 2ZFPH 3SHAH 2VGCB 1O38A 1GBTA 4DJZB 1BHXF 1MAXA 4JYVH 1ESAA 1TLDA 1GMCG 2CXVA 2HNTE 4IGDA 2F9NA 4X6MA 2GT7A 3KHVA 4B2AA 2OCVB 4INKA 3TLOA 4Y79A 1ARCA 4YT7H 1BMAA 1TNJA 2TBSA 3MU8A 4CRAA 4K1EA 5G4BA 1O2XA 1UCYH 2KAIA 2ZTYA 5BRRE 1BT7A 1C5XB 2G55A 2GD4B 2M5TA 2QXHA 2TGDA 4TY7A 3RMMH 1PYTC 4NG9H 2VWMA 2ZGCA 2IJOB 3ZVCA 4ZKOU 4OS4A 4RKJB 4XBDA 1VZQH 1TNHA 1TX7A 1Q2WA 1ARBA 3T26A 1V2PT 2BY8X 4NGAH 1L2EA 1IHSH 4Q7XA 2Z3CA 2PGQB 1YPHC 1YBWA 1HAYB 1C1NA 2EC9H 1GJ9B 1O3KA 3LKWA 3LU9B 3URDA 5F6MA 1SPJA 1GBCA 1C4Y2 4DOQA 5FPTA 1HAXB 1CU1A 5GXPA 2CGAA 4CHAB 1G9IE 3PLBA 2V3OH 1XUJA 1ZMJA 2C90B 3SNEA 4GCHG 3NCLA 3VGCB 3RXQA 1AVWA 2I6QA 3WY8A 2UWLA 1SGCA 4AFSA 1LHGH 1QA0A 4I32A 3ATWA 3KF2A 1Y3UA 1FDPA 3L3TA 4BXWA 4JK6A 1W2KH 2EEKA 3GCTG 1GGDC 2ZPQA 4JZ1A 1BBRE 2VIPA 3M3SA 1AU8A 4DCDA 1BTWA 2PHBA 2PKSC 1GBKA 5DGJA 3BG8A 3H7TA 3TH2H 3EAJA 5TJXA 1O3MA 3UIRA 2FYQA 3GCHC 3RXHA 6CHAC 1THSH 1VGCC 1BITA 1MZAA 2ZDMA 3GISB 3F1SB 4DG4A 8ESTE 1BTHH 1JIMA 2BD9A 1UCYE 2ODQA 2ZU2A 5E2OA 2F91A 1NT1A 3STJA 3VB4A 2GCHG 2W5EA 1MMJN 3A80A 3UFAA 3RXFA 2VIVA 1NN6A 4MQAA 5EQQA 3MH6A 2YNBA 1GCTB 1RD3B 3F9HA 1C1WH 4D76A 1C1OA 2BXTH 1LVMA 2HLCA 1AKSA 5EOKA 3P8OA 2BX4A 3BG4B 3BTEE 3TK5A 1ANEA 3SJ9A 3IG6B 2ZCKP 4NSYA 4HZHA 1AFQB 2OXSA 1UVOA 2EA3A 1QURH 2Z9JA 2PV9B 3Q77A 5EXMA 3VEQB 5IDKA 2Y82A 4AFUA 4O3TA 3OY6U 2NU0E 5BPEA 2OD3B 1C1VH 4SGBE 5H4IB 3ZZCA 4CH8B 4JZIA 4CHAC 1YP9A 2FEQH 5PTPA 1A0LA 1TX6A 3C1KA 2BDAA 3SU5A 6ESTA 3BTHE 1ZLRA 3HKIB 3QLPH 1SGYE 3M5OA 1SI5H 1UVTH 3M5LA 2GKVE 2A4QA 1LHEH 1SL3A 5JBAS 1SGNE 1LCYA 5A2MH 2GX4A 3GOVB 3E8LA 2OUAA 2QA9E 5C3NA 3RUOA 4NIXA 3A7YA 4AFZA 1HAPH 4Y10E 5DP7A 1F2SE 2OTVA 1KTTB 4ISLA 3RU4T 4JZDH 1SGTA 1KXBA 1GL0E 3I29A 4NFFA 2QC2A 2Z3DA 5C20A 1MBMA 2SFAA 1O2UA 4X6OA 3A81A 2V3HH 4FUIA 1LTOA 3M7TA 2FI4E 3LPRA 1SGFG 1UTLM 5EQSA 6CHAB 1V2ST 3V12A 2PKSB 1O2SA 2C8ZB 2GCTB 3GY7A 4U30A 1MTUA 1WYKA 1G3DA 1SOZA 1CVWH 3RXIA 1OSSA 5C67A 3TJOA 3ZVEA 4A1TA 2FX6A 5HGGA 4FUCA 1J15A 1F7ZA 1DLEA 4YOGA 5GCHF 1G30B 2ZPRA 1P2KA 2AYWA 3KL6A 1NFYA 4GCHF 2ZGXH 4ISHH 1WU1A 3FVFB 5FAHA 1GHVH 5JBBS 1YM0A 1HPGA 2LNCA 1E35B 2FTMA 1EP6A 1YCPK 1O34A 1S0QA 3D62A 2ZHDA 3Q3KA 3U98H 1C5TA 3S69A 2ZFRH 1K21H 5A09A 3E3TA 9LPRA 1TPAE 1RRKA 1BTYA 3BN9A 4IS5A 4OGYA 1C5VA 2HGTH 3P8NA 2GV6A 1W14U 1J9CH 1UTJA 1NPMA 2ZHEH 4E06H 1EKBB 4NA8A 3DFJA 3VPKA 1P9UA 2A7JA 1D6WA 4FUHA 5CMXH 3RXKA 3A8CA 1L1JA 4X1RU 1BJVA 3H5CB 4OGXA 5GIBA 3A7TA 3DT0H 4FUBA 1BA8B 4H6SB 4UEHH 2PTCE 2A31A 2HOBA 3H7OA 4K8YA 1Y5UT 4BAHB 1KXAA 1V2RT 1TQ0B 2C4FH 3ZZ7A 4A6LA 3SU1A 1HJAC 2NU3E 4GLYA 4BAQB 4M7GA 1EP5A 1GHXH 4NWLA 4MDSA 1C5OH 4CBOA 2XBXA 2XC5A 1ZRKA 2O8MA 4D7FA 1C5ZB 2VWNA 4ABDA 4AZ2B 2PWXA 3RU4D 3NZIA 4I8KA 1LPZB 1HAVB 1GHAG 1J17T 4ZHAA 1HJ9A 1DWDH 2ZU1A 5LPRA 1ZHPA 3KQBA 1PPZA 1V6DA 4R8TB 4X2YA 1GJ6A 2G5VA 2HWLB 3DD2H 2TGPZ 1IQKA 1Y5AT 3QWCH 4WH8A 4WVPE 2VWOA 3QGNB 3BTTE 1Z6EA 1HXFH 1SGDE 2QF0A 3BTGE 1ELVA 1MZDA 1C1QA 1RS0A 2BD4A 3T2NA 3D49H 3NXPA 1O2QA 4A92A 2HPPH 3G01A 1GHBG 4UE7H 3PTBA 2TPIZ 3ZZDA 3T28A 3P8GA 1UVSH 5TCAA 1Y59T 4XE4A 1W10U 3EA8A 4FU9A 5F8XA 1SGRE 2VVCA 2ZCHP 3RDZA 4TYDA 3HGPA 2UWPA 8KME2 1XVMA 2BDBA 4CRGA 3SJ8A 3C27B 1BRCE 1GG6B 2ZU3A 1GMCF 1MQ6A 2FM2A 2DE9A 3MNSA 2BM2A 1O5BB 3F9EA 3SNAA 1XX9A 2QAAA 1CHGA 1AZZA 2FODA 1GHYH 2GCTC 5JB8S 2STBE 4X1SU 1Y3YA 1A0JA 1MH0A 3M5NA 1WUNH 1D4PB 1W0ZU 2ZFSA 4WMFA 4FU7A 1FY8E 2B7DH 1Z6JH 2A5AA 1QRZA 1O5DH 1KLJH 3NKKA 4GAWA 4YLQH 1ELAA 2EI8A 7GCHG 1C4V2 1PPFE 1O0DH 1TBZH 3U9AH 1ANCA 4IBLH 4YOIA 2FOGA 4ZKSU 4Z6AH 4OS1A 5L6NH 1OWDA 1ZJKA 1A5GH 4MPUA 1C5SA 2G5NA 5LPFA 1BMLA 1DWCH 2ASUB 4WMDA 2F9UA 1HAVA 4VGCB 1UK2A 3QGJA 2SGQE 5DKMA 1GI9B 1HIAB 1RTFB 3T27A 4AOQA 4LXBH 3SNDA 4JCNA 2JETB 1A0HB 2PW8H 3QO6A 3MHWU 1GMHG 1LO6A 2VGCC 1GBBA 4WXIA 1SQTA 1WBGB 1E34B 1TPPA 5ETXA 2A32A 4WJG2 1FPHH 4WF8A 1CHOF 2F9VA 2BQWB 4FUJA 5EGMA 4XSKU 4K3JA 1EJNA 3A8BA 3JZ1B 1EOJA 3FANA 1AN1E 2FZZA 1UTMA 1O3NA 1QQ4A 3LOXA 4UFDH 3LC5A 1N6XA 1EX3A 1UMAH 1PQAA 3NWUA 5DJ7A 3V13A 4K5ZA 5JDUB 5IYTA 2PFEA 2BB4A 2FOAA 3BV9B 3UTUH 7LPRA 2PSYA 3PROA 5F03A 5GJ4B 3P92A 2VU8E 1NC6A 1BHXB 4Y7AA 4FUEA 1JRSA 3UWJH 1MAYA 5DP5A 3E90B 3M5MA 3SQHE 2B0FA 3U1IB 4TY6A 3TJVA 1TMBH 4X8VH 2RG3A 1G37A 1GI4A 2W26A 2ZDVH 1B5GH 1TAWA 1GBJA 1GHAF 3GY5A 1C5WB 4FUFA 2VVUA 1C5YB 2ZQ1A 3N7OA 1ZTKA 1AWFH 1HAGE 2Z7FE 1AI8H 2BQ6B 3GYLB 1TABE 2P3FH 2ZIQH 1WAYB 3UNQA 3FAOA 1T31A 1CGHA 2WPJS 2CHAC 3T5FH 1W12U 3V7TA 1S6HA 1WV7H 2Z9KA 5I46H 1LMWB 2XBYA 2ZWLH 2XWBI 4JZFH 1SGQE 1FONA 3ATMA 1GMDG 5A0AE 1TGTA 1ELFA 1UTQA 1E36B 3MI4A 1C1PA 3HK3B 2J34A 1K22H 2ZFQH 2ZZUH 8LPRA 3KCGH 3AW1A 3DUXH 3HK6B 1PPGE 4OS2A 1FN6A 4CRBA 1UTPA 2FTLE 3BTME 1D3DB 1SFQB 4NCYA 3ZZ3A 4B76A 2ZDNA 1ELCA 2D8WA 3BG4C 3KGPA 4ISNA 1S81A 1O3FA 3CS7A 3SU6A 1GCDA 1KXDA 5EW1H 1AIXH 2ZF0H 1W7XH 2ZA5A 3SORA 2ZGJA 3F68H 3PO1C 1WQVH 3P17H 2CJIA 1QNJA 2HVXA 2CN0H 4RKOB 4KELA 3MTYA 1E37B 2R0LA 3SUDA 1Z8GA 4FVBA 2WPHS 1OYQA 3LONA 2PKAB 2UUYA 1GL1A 2BD8A 3LIWA 2ANYA 1FN8A 2ZU4A 1VJ9U 4B75A 3RXCA 3ZYEA 3JZ2B 4UD9H 1SC8U 1TWXB 1TNGA 2F9PA 4K69A 5CHAC 4H42U 1P11E 4JYUH 4OS7A 3SJKA 1V2JT 2Y80A 1YF4A 1P01A 1NRRH 2JETC