2PTGA

Crystal structure of eimeria tenella enoyl reductase
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
307
structure length
224
Chain Sequence
PLPVDLRGKTAFVAGVADSNGYGWAICKLLRAAGARVLVGTWPPVYSIFKKVFDKIYPLDAVFDTPQDVPPEVSSNYAGVGGFTISEVAEAVRADVGQIDILVHSLANGPEVTKPLLQTSRKGYLAAVSSSSYSFVSLLQHFLPLMKEGGSALALSYIALESDCRTLAFEAGRARAVRVNCISAGPLKELESDDVGRAALFLLSPLARAVTGATLYVDNGLHAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-acyl carrier reductase
publication title Type I and type II fatty acid biosynthesis in Eimeria tenella: Enoyl reductase activity and structure
pubmed doi rcsb
source organism Eimeria tenella
molecule tags Oxidoreductase
total genus 68
structure length 224
sequence length 307
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ptgA01
1NQOA 1GADO 3A14A 5AXDA 4DIFA 4OXYA 5CDUA 1LUAA 1PZHA 3A1NA 5JAMA 1TVEA 1G0OA 2EP7A 4I5FA 3RUFA 5BQFA 3GNSA 1VC2A 5ENDA 4IGEA 1ZZEA 4JROA 4U0KA 4UVDA 3GUYA 1P1JA 3JQ9A 3RBVA 1HL3A 1O9BA 1H93A 1U7TA 1UXHA 1MC5A 1I5RA 1JKJA 3AUTA 3LT4A 2W2LD 1DIHA 2WE8A 5JMWA 1XR3A 1BRMA 2FR0A 4HV4A 2O3QA 4ZA2A 1ZXBA 1JWBB 4JNKA 2PGJA 1HYHA 5JLAA 3D3WB 4TROA 2GN6A 1B26A 3I3OA 3I6QA 4PLWA 3ASVA 3RUDA 2DPHA 1Q7GA 5CHEA 4IIVA 3WWYA 3ZWAA 2I67A 3WGGA 2QW8A 3OJ0A 2WMDA 4BNIA 3O4RA 2PGLA 3HUDA 2E82A 4RVSA 4JLWA 5TRTA 1LSOA 4DC1A 3C1AA 2YDXA 3OA2A 1DJNA 4ITUA 4DBVO 4DBZA 4FC7A 1QG6A 3F46A 1QP8A 2E37A 3U4CA 1M2WA 2Q46A 4BGIA 1N2SA 1YB5A 4O0LA 2O3RA 1VLLA 3DAFA 3L9XA 3MTGA 4BNXA 1P9LA 3EY4A 2YYYA 1EEHA 1JLLA 3F1LA 3HDJA 3IAHA 2EXXA 5TIIA 5A3VA 4BNTA 1DC6A 1PS9A 2PFGA 3OF2A 4CM5A 1ISHA 3KEOA 1KETA 3L6EA 2PK3A 1NP3A 1QORA 1YXMA 3VPHA 1P45A 2D5AA 3FF4A 2LDXA 4RF2A 2WJPA 2PLAA 1VJ0A 1SAYA 3UOGA 5DCUA 1XLTA 4L4XA 2WYVA 1B2LA 4AG3A 4BNWA 1R37A 1D4FA 1HDYA 8ADHA 4DLBA 5IAAA 3Q11A 3PGJA 3KYCA 3RUCA 1BW9B 2JJYA 4LSMA 3COSA 2GUGA 3PHJA 1EE9A 1JU9A 4MDHA 3NT2A 3RJ5A 5KJ1A 4XJSA 3QE3A 2UYYA 1ADBA 1UDBA 5JCXA 3WGYA 4GLLA 5DOZA 3QWFA 2BELA 2AEMA 5FYDA 4WPGA 1X0VA 3C85A 4XQGA 3GLQA 3TRIA 2FWMX 1EVZA 3EC7A 1AN9A 3QHAA 5CDYA 1S6YA 1SO8A 3OMLA 2W8ZA 3OIDA 1YOVA 3E03A 1C0LA 4OXNA 1GQQA 2BRUA 1IE3A 4YB8A 4AJHA 2CVZA 4IIUA 2ZJ1A 4LCEA 2DVMA 1YE3A 2G5CA 2NTVA 3U5TA 3L6OO 2VWGA 2R2GA 3IKVA 1CIVA 3EW7A 4CUJA 1NHGA 3BMNB 3K6JA 3VH3A 4YACA 1NM5A 3K31A 2AQ8A 3GHHA 4WE3A 1DC4A 5G4KB 3O03A 1H94A 2CSUA 3MWEB 5DDIP 4B3HA 3DOOA 2Q1SA 2G1UA 3PVZA 4PG5A 2W2KB 1Z7BA 3NTRA 4RORA 1H5QA 3I52A 3HDQA 1UDCA 4NHEA 5B4VA 1KC1A 1YQXA 2AE2A 4R5MA 1HE5A 1X1EA 1IZ9A 2UUOA 4URFA 3STHA 1V8BA 4E32A 3QVTA 2YQ5A 3C1TA 2X86A 4FS3A 3ABIA 4WECA 3PIDA 5KKCA 2ZTUA 4RPGA 4CPDA 2FSSA 5A5FA 3DOCA 4O63O 5IDQA 3HSKA 3SLGA 4E5NA 1EDOA 4PLGA 2I65A 4GLOA 4PVDA 4E30A 4IDGA 4DMMA 4D46A 4BL5A 1YONA 4PZCA 2Y1CA 1R4NA 1LSJA 3VH4A 3RKUA 5TT0A 1GY8A 1CDOA 2B0JA 3GZNB 1NFFA 2HLPA 2YFHA 2A92A 3CZRA 3ONEA 1K6IA 3DHNA 2BF7A 2B5WA 2VT3A 4NJOA 4UVHA 1DLJA 1XQ6A 5F21A 2C7GA 3OIGA 3D64A 4CMEA 4MVJD 2Y67A 1FDSA 1FDUA 1N9GB 1PEDA 1IY8A 1UZMA 3WJAA 4CV1A 1ORRA 4BNFA 4NU5A 1BXGB 2WDZA 1ZSYA 4LMPA 1UP7A 4ALJA 2AW5A 2D2IA 2GN8A 2HRZA 5ER6A 3JYLA 3VC7A 3DMYA 5KWEA 3UFXA 3WICA 4CV0A 1Y8QB 4XGNA 1LEHA 2G76A 5JXWA 3I23A 3WFJA 3MJVA 3EVNA 1UXIA 3WQSB 1O6ZA 2W90A 1F0YA 1GZ3A 2ILTA 3BAZA 1GUFA 3KETA 4Y8VA 5IDYA 5T6BA 4A10A 3V8BA 5LC1A 1QV6A 4LVUA 3F1KA 3NJ4A 1MG5A 4PN3A 1ZK0A 1AGNA 5GMOA 4TVBA 1PGNA 5L45A 3WIDA 2P68A 2YFQA 1H6BA 3WWZA 5H83A 3JQEA 4CLOB 4N5MA 1N1EA 3OSUA 1NVGA 2FPIA 3ROPA 3JQ6A 3WB9A 3RUEA 2YZ7A 1QRRA 5ADHA 4WCFC 5JAZA 3M6IA 2E48A 3EUWA 3WGHA 1L7DA 3UN1A 5JO9A 4CMIA 3K73O 1LDBA 1HRDA 2XXBA 2ZQZA 1VSUA 4NBRA 2C59A 3PHGA 4F6CA 3FI9A 2B36A 1YS4A 4U5QA 5TLSA 3FD8A 1IUKA 3BTVA 2HSDA 2O48X 4DLAA 5JSFA 4GX1A 2DKNA 3FR7A 3LF1A 2Q2QA 2V7PA 5K0ZA 3PWZA 5C3MA 2NADA 4XJTA 4J1TA 1MLDA 4EZBA 3ANMA 3VH1A 4AJJA 1P74A 5B12A 4CQLB 1LTHR 1IOLA 4HXYA 1QMGA 4GVXA 4DPLA 4E4YA 3TL2A 1WDMA 1E1LA 1CWUA 3ZGYA 1PQPA 2C54A 4B4VA 2DBRA 3GNQA 1P1KA 1H6DA 3ONFA 2Q3EA 4S1VA 2WWRA 3OP4A 4TWRA 1HETA 4MIEA 2WEKA 2YV3A 5BSHA 1PGOA 1M76A 3CUKA 2NTJA 3F5SA 5AXBA 4RVFA 5KJ6A 1PJTA 4GH5A 4PLZA 3GVIA 2JFFA 4Z9YA 1CQJA 5EQDA 3H3JA 5DULA 3F3SA 4W99A 5THKA 3AM4A 5L9AA 4RPJA 3C1OA 1VPDA 1DFGA 3Q0EA 2DTEA 4WCFA 1X14A 3GFBA 2IDZA 4GX2A 4NFHA 4FFPA 2OZPA 3E5RA 3CXRA 3RUIA 1H9AA 3KOUA 4XCVA 5THQA 2V6GA 3IC5A 4XRGA 1R15A 1ULUA 4CM6A 1FDVA 2D0IA 1DIGA 2C20A 3FNFA 4WK6A 1KVQA 1QLJA 3ZNOA 1EUCA 1I10A 3JQFC 4CJXA 1ZEJA 4MKXA 4W9NC 2EGGA 1U4SA 3DEYX 3O26A 7ADHA 3NGXA 3H6KA 4DWVA 3ITDA 4XA8A 2C29D 1DIAA 2DTXA 4FGSA 1YB1A 1HDXA 3G79A 1N7HA 3ZV3A 3PJGA 2VYND 3BMQB 2ZATA 3GRPA 3KYBA 3IL2A 1KS9A 4CLHA 5JDIC 1TA4A 3ETDA 5C7OO 2YV2A 2HQ1A 3LYLA 3KXDA 3EGOA 3OECA 4PRKA 4WGGA 1I36A 4W7IA 5BSGA 2AMFA 5I8WA 4HNGA 4BNLA 4XDYA 4ZD6A 3ANNA 1PS0A 1HYGA 4UEOA 1DHTA 4YXFA 4IS3A 4K28A 3LC2O 4BQRA 3PGXA 1U3TA 3GG9A 1SC6A 1JW9B 2QG4A 3ZZNA 1GD1O 1PJ2A 5I7EA 4QQRA 3RUAA 4CL8A 4YT4A 3OJLA 1Z73A 1ISJA 5T5QA 5K9ZA 1F12A 1A27A 4NU6A 4CMKA 3JQAD 4YRAA 3U09A 3PJEA 4YR9A 2VZ8A 4O6VA 1GFSA 3OJOA 2B4QA 3DFUA 3OM9A 1OAAA 3GRKA 4B8ZA 3UW3A 2C5AA 1K6JA 4JP3A 5IG2A 4OL9A 1GUZA 1O95A 1T25A 4XD2A 1T1SA 3JD0A 4IMRA 3GVPA 4XKJA 3NT4A 2PH3A 4TZTA 3V2UA 1BMDA 3JQFA 4CQMB 2A9FA 1GYPA 5J23A 4W9NA 4XYBA 4IXTA 2EEZA 3OA0A 3OFSA 1Q0LA 1T24A 3PRJA 1JAXA 4YAEA 5TS3A 4TKMA 4WLOA 4PLVA 4BO3A 5EERA 3TOZA 5JDIA 3QSGA 1E3IA 1GR0A 5C37A 1EMDA 1E1KA 1UXGA 4N18A 1E3WB 3Q2KA 4O1MA 4EGFA 3TF5A 3U0BA 4BV8A 1U4OA 4J4BA 5HS6A 4E12A 1TI7A 2E4AA 5EIOA 4A03A 2CY0A 3JV7A 1HDCA 4CM7A 1X1TA 4HBGA 2GZ1A 1V9LA 4IXWA 4Q39A 1NQTA 2EKLA 4RVGA 5COQA 4CM1A 5C5IA 3JQ7B 2BD0A 1YL5A 4L76A 4OH1A 3VKVA 1ENPA 1LDNA 5JE8A 3C7AA 2PKQO 3JQCA 3QWIA 3K8ZA 4L73A 3EMKA 4TKLA 1I01A 1M67A 5LCXA 2QYSA 3ROMA 1OBFO 1PTJA 3D3WA 3RSHA 4NIMA 4ZQGA 4Q3NA 3ZV5A 3WTBA 1X7GA 4B7UA 4GBJA 3NTQA 2PGDA 4IPTA 4QECA 4RQUA 4EEXA 5A5EA 1BDBA 1KVSA 2FSVA 2Q4BA 2VRCA 1VKNA 3WSWA 1I2ZA 3GA0A 5KJEA 1RM0A 1U2DA 4KDFA 1E3EA 4D42A 3T4EA 5IDXA 1LDYA 3WDSA 3PQFA 1P31A 3CH6A 3CSDA 1B3RA 4JN6B 1L1FA 5HTOA 4BB6A 2Q99A 3BZUA 3JQ8B 5ER9A 1QKIA 2NM0A 3OIFA 4Z0TA 2QRKA 5IJZA 1SB8A 2WE7A 1MGOA 4DPKA 5JCJA 1HKUA 3UCXA 2A94A 3WJ7A 3PHIA 4II3A 3W4KA 1CJCA 2EHDA 1B8VA 1SOWA 4XYMA 3WIEA 5IFLA 4RLHA 1IHYA 4Z0HO 1LLQA 5TGDA 4QUKA 4CV2A 1U3VA 5EESA 3KHUA 3PQDA 4B79A 3MJSA 4NBWA 4OKNA 3I1JA 2DT5A 3FPCA 2EWMA 3HG7A 3INTA 3NDJA 1E7WA 2FHSA 1KY4A 3E18A 4YVFA 3VVBA 3ZCXA 2J5RA 1ZUD1 4B4WA 4BO6A 1UXJA 2OO5A 3LT2A 3NGLA 3PK0A 2XPCA 4EUFA 1EDZA 2GLXA 5B4TA 1BW9A 1UJMA 2FY8A 1EK6A 3I4FA 4BKUA 5JFOA 4UUMA 1UZNA 4HWKA 4RPKA 3FN4A 1ZO8A 4MIYA 2XAAA 3DFZA 4RCVA 4NR0A 1R16A 1RM4A 2HRBA 3GF4A 4MVJG 1F8FA 3FNGA 4GI2A 2GNAA 1ZW1A 2Y1GA 4BNHA 2GZ2A 3JTMA 1PJQA 5TJHA 1V3TA 3GMDA 2GCGA 2SCUA 4ILKA 4CM3A 4Y6PA 5DT9A 3GPIA 4Q3EA 5U4QA 1ML3A 1MFZA 1E7MA 4DQUA 3GEGA 4EJ0A 2Y1DA 4BVAA 3I9KA 5A9SB 1EBUA 5H82A 4E21A 1YQDA 3JQDA 1T2AA 3H2ZA 4UVGA 3ZU2A 1PU2A 2YDYA 2EIHA 3FWZA 1DIRA 1LLUA 3R1IA 4RDIA 3WTCA 5EPOA 3CMMA 4R3WA 1QR6A 1MG0A 2Y1OA 3BMNA 3P5SA 4ALLA 1QXSA 2VYVA 1Y81A 1CRWG 3P2OA 5CEFA 2BHLA 5G4KA 4XYLA 1FK8A 4CODB 4PG8A 4FIZA 3GR6A 1YBMA 4TMFA 2W2KA 3ICPA 1BG6A 3WQQA 5KOIA 3EYWA 3GDOA 3W6UA 5KVVA 4IDDA 2OXIA 4KQXA 4D0RA 4IMPA 4R69A 1ZVMA 3LLSA 3AM5A 3TWOA 2Q50A 1EZ4A 2DAPA 2BI7A 4RVDA 1C0PA 1MP0A 2YW9A 5A1TA 2HMVA 3RCBA 2H6EA 1U8FO 5U9CA 1HSOA 4IJWA 5CG1A 3ZWYA 4JJIA 3ZWPA 3I9NA 3A28A 3JYPA 3QY9A 4WASA 2XF8A 2VHWA 4RQTA 4TRNA 1Y9AA 2X6TA 1I30A 3PFFA 3LVFO 4FQ8A 3IOYA 4ONEA 4PGFA 3A06A 2VZ0A 4DGSA 2D59A 5I7VA 4IZIA 1VM6A 4OMUA 1C1XB 2BGKA 4XR9A 2I5PO 3GZNA 4DLLA 4XIYA 1PJCA 4FPXA 2PKRA 4GKVA 4JK3A 2PH5A 3JQGB 1I0ZA 3CTMA 3WQRA 4P4NA 3KBOA 4GPD1 4YQZA 2DBZA 4N7RA 1N9GA 2O2SA 2IODA 4OM8A 2HO5A 4W7HA 3EK2A 2ZKLA 3AOEC 4OGWA 5F1KA 2I9PA 2NWQA 4XX0A 4M1QA 4W4TA 3WYCA 1BXGA 1G0NA 2VOJA 4PZEA 4AJKA 3BHIA 4ALIA 1Y8QA 3UHAA 3N7UA 4RVHA 1QV7A 2NNLD 2VOEA 2IEDA 3R0IA 3TQHA 4EUHA 4ZGWA 3FSRA 3PWKA 3E1KA 5KNLA 3GVXA 3TOXA 3ULKA 4R1UA 4NJMB 4WEQA 4XRRA 4CR7A 9LDBA 3OBBA 3CE6A 1BXZA 4MVJM 4S3MA 2VNAA 1I24A 1EVYA 2Q1UA 4D43A 3GC6A 4IBOA 1E6EA 3NDRA 1PR3A 1NAIA 4KOAA 3PDJA 4BNMA 3EVTA 3WSVA 3RIHA 3WLFA 3PDUA 5U1PA 4XIJA 1WVGA 3ZWBA 4BKOA 1ARZA 2H63A 4GGOA 2B35A 5TSDA 4UUOA 1KVTA 5H81A 3DBRB 1DHRA 2EP5A 4AJNA 5DF1A 4CLOA 3N74A 3SEFA 3GVHA 2CNBA 4E2ZA 1M66A 2DUUA 3E48A 1ZKMA 4J1QA 2BFOA 3DZGA 3O8QB 4P22A 1WW8A 4DRYA 5DZSA 2AXQA 2QIOA 1RKXA 3DBLA 1Q1NA 1Z82A 2V65A 4PIVA 4ALMA 5L95A 1Z74A 1WPQA 1JDJA 1ADGA 1ZCJA 2D3TA 4CMGA 4BNNA 2CZCA 1LBEA 2PV7A 4A2CA 2B37A 3U49A 3K5PA 4DC0A 3AOEA 1NQAO 3FTPA 3ZWXA 4RLSA 2HKIA 3ROKA 3DXFA 2IXAA 4J2HA 4HFRA 1DAPA 2UVDA 2VHXA 5TC4A 2JD2A 2O2YA 4B7CA 4CQLA 4XQCA 4M55A 5DP1A 1WAMA 3H9JA 2EGHA 4EEZA 3WGOA 5I8ZA 4FB5A 1OMOA 4NNJA 4KWHA 3KM0A 2NLOA 4RL6A 5L53A 1K6XA 4J9VA 2I66A 1YDEA 3S2EA 1TT5B 2BGMA 1JTVA 3WG9A 2ET6A 2NTNA 1U9JA 3MOIA 2FZWA 4LMRA 2HUNA 3ZW8A 4GAEA 3W4JA 2P9GA 5TNXA 3FRJA 3S55A 2VHZA 2GERA 2WD7B 5AXAA 8LDHA 1AUPA 2C5EA 4UEKA 4J7XA 4B3JA 1PJLA 1B14A 5JY6A 4OOFA 4E5MA 2P5UA 4EUEA 3F47A 1TXGA 2ZYDA 4YJHB 4XYGA 1NFRA 2Y93A 3GUCA 5DOVA 2CDCA 4A73A 4ALNA 4BNKA 2DLDA 2EERA 2PKQP 2BGLA 2ZTMA 1WZEA 4MIOA 5LDHA 2ZYAA 2UV8A 3JD1A 1EE2A 3IP1A 3QIVA 5HM8A 3VDRA 3WBBA 4E2YA 3LQFA 5L51A 4WCDA 2OHXA 3T4XA 3ZWMA 3I4CA 3WR5A 4QO8A 4M8SA 1R0SA 3MWDB 4W82A 2PY6A 3DZFA 3I5MA 4HP8A 1LNQA 4RJTA 3K2EA 1R4MB 2VRBA 5L7YA 2ZB3A 2H5LA 2X0JA 3JYOA 1T2EA 4D44A 5L4SA 3DR3A 4IDCA 3TZCA 3HN2A 3WMWA 1JA9A 1LDEA 1VKOA 2P91A 3BHJA 3H4VA 4AJ1A 4CV3A 5FI3A 3BMQA 4J1SA 1NVTA 3NJ8A 1XYGA 2WYUA 4AVYA 4DIOA 5CDTA 3HQ4O 4J2OA 2AQHA 3UCEA 4R51A 1ENYA 3ADPA 4FOOA 3GEDA 2RH4A 2HK8A 4OYRA 2AE1A 4MKZA 4E5KA 1KEWA 4NZ9A 1V3VA 3DZBA 2FRDA 5G0TA 5JAIA 1DIBA 4FFRA 1PL8A 3FHLA 4TQGA 1FDWA 3VZQA 4DVJA 1O89A 1HDGO 1SBYA 4H16A 1DRVA 3P19A 4G2NA 1DAOA 2X23A 3MJCA 1A9ZA 1E3JA 2W4QA 3QVOA 5JC1A 4INAA 3DHEA 3F9IA 3LT0A 1PWZA 4CM8B 4FJ2A 5EJ2A 3TDKA 1BHSA 1GPDG 3H9EO 4XDZA 2Y99A 4YAIA 5KIAA 4KP7A 2DFDA 3NKLA 4R1NA 4AJPA 3ZU4A 2V6BA 4R1SA 3AFMA 4M86A 1MXHA 2Y66A 2BFPA 2GO1A 2B5VA 3ZHYA 4LISA 4LRSB 2PD3A 1V6AA 4C7KA 3H5AA 3DZHA 1C3VA 2O3TA 4DQXA 4DA9A 4IJUA 1I3MA 4OSPA 1WZIA 2I3GA 1Q7BA 3BMCB 2Q45A 2AEJA 3K2BA 3MJTA 3QJ5A 3K92A 1NQ5A 1VJTA 1U3WA 1N5DA 4YJFB 3QWHA 3L77A 3VKUA 4GQAA 3GG2A 4BMSA 2I3AA 1LC3A 1J4AA 4CLXA 1PGPA 3IQDB 4E0BA 4ZQEA 3H5NA 1DLIA 3JYQA 2V6FA 3L9WA 4CQMA 5K6AC 2C2XA 2NU9A 4RZHA 3PQEA 4CUKA 1GEEA 3H9QA 5JW6A 1KVRA 2VUSA 1YWGO 1T26A 4IY1A 1NBOA 3RUHA 1ZH8A 2JFGA 4K1LA 4BGEA 3ZHBA 2IZZA 5EN4A 5JYDA 3FNHA 1C0IA 4A0SA 2HAEA 1A4UA 4PVCA 1U5AA 1ID1A 1A7KA 1E6WA 5F1PA 4CR6A 1E3WA 4HFMA 4I9NA 4AL4A 2I76A 4KUEA 2VRCD 1HE2A 3G49A 1SCUA 3GGOA 1IB6A 3B6ZA 1P1RA 4WNIA 1A9YA 1BTOA 1Y7TA 3WMXA 1P33A 4BKRA 3TFOA 1ZMOA 4U8GA 3NEPX 1MC4A 2NQTA 4TRMA 5BNTA 1EUDA 1LDMA 4N54A 2C2YA 5JCJD 3GOHA 4CLRB 1BDMA 2G17A 2ZCVA 2Z1NA 4HY3A 4Q3CA 4IS2A 3TPCA 1MUUA 3ZH2A 3ZV4A 1Y8RB 3PLNA 4BO5A 1YQGA 5ITVA 4YRBA 2NV6A 5KKAA 3UCFA 3ANLA 1YO6A 3SBOA 1WWKA 4D45A 5CAEA 3CINA 4GKBA 2BKAA 1GV0A 1JN0A 4YEDA 5ES3A 3RD5A 3H3FA 1UP4A 1NR1A 4BHTA 2NVUB 4D79A 1CERA 3G1TA 2J5QA 2UDPA 1RYDA 2GASA 4Z9FA 3V2GA 3OETA 1WP4A 2BLLA 2C07A 1GAEO 4OKIA 1YH3A 3RBXA 2EV9A 5G0SA 4IM7A 3I9MA 1HF3A 4E2XA 3H2SA 5IZ4A 3KLMX 4MVJE 3BTOA 2YHIB 5T8KC 3S1LA 5K6AA 4FOSA 1ULSA 3JQ8A 1H2BA 3E6AA 3NUGA 2CMDA 3B1FA 2WYWA 1HEUA 1LU9A 4GSLA 1PQUA 5BSFA 4HKTA 4R5HA 4AJ2A 1MX3A 1FXSA 1Q0HA 1HYEA 3VTFA 2X58A 2HJRA 4KZPA 4OJNA 1FMCA 1J5PA 6ADHA 3CKYA 2OP0A 3FWNA 4D0SA 2C7VA 1HE3A 1PZGA 3GN1A 4K6FA 1XU7A 1R0KA 1JVBA 2Y0EA 4IDEA 3HFSA 4K9DA 3W6ZA 4WNCA 3BHMA 5DBFA 4TRRA 4Z9XA 5FF9A 1ZFNA 1ZSVA 3RFVA 5HBRA 1ADFA 4Q3BA 1HDZA 4LK3A 2GF2A 3WBFA 5JAQA 3I9JA 4AJLA 2Y1FA 5COAA 3EZLA 3V1TC 2VYVD 5I9LA 1CQIA 3SC6A 3AI2A 3AW9A 4QX6A 3RU9A 4DYVA 3FTNA 2WD8A 1Y5MA 3GZ4A 1MA0A 2FZEA 5F1OA 4JGBA 5A9RA 3BMOB 3WXBA 1ZJZA 2PZJA 4A7PA 3VAZA 2FR8A 4LCJA 4PFJA 3RBZA 5KVSA 4Z3KA 5A4DA 1HXHA 4NFYA 1B16A 4BGUA 1Z75A 4XQ9A 3IIEA 5JDCC 4B4UA 3RKRA 4J90A 4FC6A 1HT0A 4F3YA 1JAYA 1ZIDA 1VL8A 4C4OA 3NV9A 4J91A 4YBZA 1IPFA 3WGZA 1KY5A 3ADOA 3VZSA 3ZWOA 3B1KA 5T8KA 5JO0A 1G1AA 5AXCA 3TFQA 4NH4A 1LQTA 2CF5A 5A02A 3AUAA 3RFTA 4PLHA 1Y9EA 3OEWA 2HMUA 3V5NA 4YT2A 3QLJA 1P1HA 3UGKA 2CUKA 5DNAA 3D5TA 3SC4A 4I9UA 2RHCA 3LU1A 3U4IA 2B83A 4YT5A 2LDBA 3KZVA 1A7AA 1VI2A 4ZHSA 2O4UX 3MJEA 3RC2A 3D3EA 1KERA 3GGPA 5HWSA 1QYVA 5KTKA 1RJWA 4GMFA 4XR4A 1C1DB 4O59O 3TJRA 3GAZA 3E9QA 1RPNA 1UZLA 1E5LA 2DU8A 4JJGA 4NQZA 4JBGA 1EVJA 3RROA 4U6QA 1SMKA 3CIFA 4WLFA 5CP8A 2G0TA 1KOLA 5L7WA 3ICCA 3DZKA 2F1KA 4GX0A 5A05A 4OQZA 5IN5A 3D4NA 2XOXA 4PRLA 1GQ2A 1SB9A 4J1NA 4KWIA 1LJ8A 3OQBA 1C1XA 1CETA 4PG7A 5MGBA 3DZJA 2CDAA 3RASA 4M49A 4C7JA 4CUZA 2FPPA 1XDWA 2EW2A 3KVOA 1UAYA 3WS7A 1UXKA 3WYEA 2X9VA 3KB6A 3GHYA 3ENKA 1OI7A 3ENNA 3SJUA 5LDGA 2JCYA 3PYLA 2NU6A 5T64A 4D3FA 1I2CA 4ZQBA 3C7DB 3TZQA 3VHRA 4UULA 3ETEA 3F5QA 1SPXA 3LC7O 4IJVA 1N1GA 2PZMA 4KUGA 4YDRA 4BO4A 4JBHA 3OEYA 5CEEA 1F06A 5JS6A 3GDGA 4MVJH 1PZEA 4QTZA 5ICMA 3L4BC 4KQWA 5JY1A 3DL2A 2OUIA 4WLVA 5TF4A 4A27A 1R12A 5EINA 2JHFA 4BNZA 1KEVA 4IDBA 1UR5A 4J43A 3VTZA 4F46A 3OICA 4R1TA 4EITA 2ZIZA 2YV1A 1P44A 4I1IA 2GSDA 2P2SA 3PLRA 3A4VA 4NJMA 3QVWA 1X0XA 1EFKA 1KIFA 2A35A 3GEMA 3GGGA 1YL6A 4RDHA 4U6SA 3C24A 1CYDA 4MKRA 2DBQA 4E2WA 2QZZA 2IE0A 1D7OA 1N92A 4HFNA 4I5EA 4U7WA 4WOKA 3LZ6A 1EVIA 3JD2A 3RC9A 5BR7A 4LSWA 1ZK1A 5JBIA 3AOGA 2X22A 1TT7A 2B4RO 3I9OA 3LLVA 4RZIA 1E7SA 3DBRA 1B7GO 4IINA 3TZKA 3I83A 1W6UA 1YRLA 1P77A 1T2DA 5IN4A 1PR9A 3NRCA 1FDTA 4Q3AA 4I9HA 5DN9A 1I32A 2E49A 3IJPA 2PZLA 3O8QA 2JL1A 2HK7A 5F5LA 3NDIA 2AG8A 5B4UA 4RGBA 1HWYA 1Z45A 4MP6A 3DDNA 4G81A 2CF6A 3RU7A 1QSGA 4RPHA 4LGVA 3FPLA 1YL7A 3EHEA 2HMTA 3K30A 1DDOA 5TX7A 3UF0A 3X2FA 2HMSA 2RH8A 3TZ6A 3VPSA 1ENZA 4FFOA 4CLEA 3MZ0A 1KBZA 3LC1O 5JNLA 1IYZA 4L9RA 3GK3A 1QLHA 5CPFA 3L4BA 1PJ4A 2BH9A 1I2BA 3PWSA 1E3LA 4YAKA 1HTBA 3KYDB 2FPGA 1JKFA 3U3XA 3ZN2A 2Q49A 2ZQYA 3QVSA 3JQ9C 2HCTA 4Y67A 3Q2IA 2VCYA 1IULA 1EBFA 1NWHA 1ONPA 3IP3A 4FR5A 1YVEI 3VPGA 3K9QO 4Z0PA 3H9UA 5AYVA 4CM4B 2RIRA 4ZICA 3OQ6A 4FBGA 5JC8A 5BSEA 1TT5A 5I9NA 4PLFA 2TMGA 4BO2A 4MVJF 2Q1WA 3AM3A 4IGFA 1X7HA 2O3SA 3WFIA 3RFXA 3D7LA 2GGSA 3L0DA 4ZVVA 4E5YA 2WD7A 2JD0A 4CM9A 3ON5A 5ICSA 1DC5A 3Q3CA 5DBGA 1SEPA 2BMAA 3INGA 2DC1A 2GN4A 3X2EA 4BGVA 3DTYA 2FN7A 4CMCA 1DB3A 3VZRA 4ROSA 1LRKA 1AE1A 1BVUA 1A72A 2WSBA 4IUYA 4DQVA 3WLEA 3GY0A 3DHYA 4LW8A 4RVUA 1K3TA 3VH2A 5KVQA 5FEUA 3FBTA 2OBYA 4IQ8A 4YJGB 3DMTC 3ZV6A 1VRWA 3U4HA 5A03A 4AJIA 3PZBA 3KSDO 4ZRMA 1R4MA 1DOHA 1YBVA 4CR8A 3GAFA 2GPTA 4TSKA 2HU2A 1K89A 3NYWA 3HB4X 4BV9A 1GV1A 2Q2VA 2QZ9A 5CPBA 1Z6ZA 5G4LA 1GQYA 5L4LA 5FI5A 5ITWA 1MB4A 1J0XO 2J6IA 1B8UA 3D5QA 2AQIA 3L6DA 4ALKA 1MV8A 2FR1A 4TZKA 4FGWA 3HN7A 4BMNA 4MINA 1VL0A 2YY7A 1O94A 1M6WA 3VOSA 2X5JO 1Y1PA 3WGTA 1LA2A 1J6UA 1BVRA 1MFPA 1DFIA 1Q0QA 1LSSA 2ZK7A 3N58A 4PG4A 2DUWA 1DXYA 2EKPA 4IQGA 1P3DA 4RPLA 4CQMD 4RO0A 3JSAA 4CLDA 2Q2WA 2HMWA 4AJEA 3GN2A 2ZJ0A 4IDAA 4XB2A 4YRDA 3ZNNA 4BNJA 1G6KA 4BO0A 1AHHA 3VPFA 4CM8A 3DO5A 3H65A 3TL3A 5DBIA 4FFLA 1O0SA 2R6JA 2JHGA 2OFPA 4MPDA 3RAJA 3OQ1A 2W98A 2BI8A 1XSEA 4B7XA 5GZ3A 4JCOA 1PJSA 3ZHXA 4P4LA 4CMBA 1B0AA 2EF1A 1O5IA 4M89A 3UXYA 1E92A 4PLTA 3QWBA 2OGUA 1QYCA 3HFGA 1RYEA 3IMFA 2IZ1A 1ZSNA 2OP1A 3B20A 4KUHA 4QFDA 1PGJA 3MCVA 4E33A 3BMCA 5ENVA 2ZB4A 4XGIA 1DEHA 2O7QA 4E13A 4YJFA 2IYPA 2DQ4A 2X5KO 2AHRA 1A71A 2AG5A 3DMTA 3M1LA 1NPTO 3QRWA 4BNUA 3O9ZA 4HADA 4JX8A 4KDEA 2H1SA 1GEGA 4ZJUA 1XG5A 1ZBQA 2NQ8A 5G0UA 4P4GA 5IZCC 1XQ1A 4B3IA 1D1TA 1UUFA 1IL0A 1AHIA 1NNUA 1K5HA 1B3BA 5A06A 3VPXA 1YGYA 1PL6A 3GPDG 4RF3A 3PYMA 2TMDA 1ISIA 2IYOA 4FD3A 5CDGA 3GQVA 4NBUA 1DPGA 2NSDA 5IXYA 1H6AA 1EQ2A 3KSUA 2OL4A 3FCOA 3NTOA 3QA9A 5IDWA 2VTEA 5B37A 2WM3A 3Q9UA 1YDWA 1PGQA 2PZKA 2OBNA 2Q1TA 4G65A 4IDFA 1KEPA 1DRWA 3TNLA 5GZ1A 1T1RA 5KVCA 4YJDA 1PJ3A 1TB4A 4OSOA 4H15A 3KLPX 2O7SA 4FCCA 4BNGA 1U7HA 2D4AA 4ND1A 5FFFA 4CMEC 1K0UA 4H7PA 2VHVA 2JFHA 2NACA 4N5LA 4CLRA 2OORA 2XXJA 3ETGA 1ZMTA 2X9GA 2ZTVA 1PIWA 4L8VA 3L07A 1XCBA 1Y8RA 3AY6A 4UREA 2VQ3A 3DBHB 4NFSA 1UH5A 4JQCA 3ORFA 4ND5A 3LSYA 1NFQA 4MP3A 1HDRA 2X0RA 1LLDA 1XELA 3I9LA 4R9RA 4TRJA 3D0OA 3BIOA 1B8PA 2NVUA 3AFNA 3ITKA 2R00C 4J7CA 3WNQA 4XGKA 3CEAA 4L74A 1SNYA 3UKOA 1ADCA 3PTZA 1I8TA 4BMVA 5IZCA 1EK5A 1NPYA 2CVQA 4N5NA 5KCZA 3MJ4A 4WKGA 1DRUA 2YHIA 4JJFA 2C0CA 4KTVE 3S2FA 1DC3A 4CMAA 4WOJA 3G3EA 2A4KA 3BA1A 4UEJA 1VL6A 3SLKA 4YA6A 3JQAB 3PI7A 3Q9NA 1BGVA 4Z3DA 4BQPA 2J8ZA 4BOYA 3R3SA 3PZRA 4NK5A 4DL9A 3LK7A 5L4NA 4CMJA 4I08A 4J49A 4J4TA 3H8VA 4PG6A 1GU7A 1NAHA 2WTBA 2VWQA 3LDHA 4M54A 5B1YA 1T2FA 1YB4A 3KEQA 2CDBA 1V0JA 5A04A 1L7EA 2YHUA 2PD6A 5T67A 2ZCUA 3S2GA 5BNFA 3SX2A 1F17A 1UAGA 3FR8A 1YJ8A 3T7EA 1GCOA 3GDFA 1CF2O 3Q6IA 1E1NA 4O5OA 1E0DA 3Q1LA 1HE4A 1Y5RA 2X8LA 1A5ZA 2Y0CA 4BB5A 2BFMA 3BYZA 4ZQHA 3HJAA 4GX5A 5HRUA 1VE9A 4DIBA 1GZ6A 5CFZA 1U5CA 3D4PA 3E8XA 4ESOA 4FFNA 4IZHA 4OAQA 4R16A 4RF5A 4JIGA 5HA5A 4ZN6A 3HNPA 3D1LA 1N7GA 1R6DA 3BMOA 3E5MA 4I5GA 1W73A 1RWBA 1M6HA 1SZJG 3DQPA 4LN1A 4NG5A 2ZB8A 4NPCA 1F14A 1XA0A 3TSCA 5KJFA 5KJCA 1P1IA 4GSKA 3RQSA 4E5PA 1BSVA 1WNTA 2GYYA 3AY7A 3F4BA 3IS3A 4Z6KA 2DPGA 1MXFA 2O3JA 1E3SA 2AEFA 2HK9A 2R00A 5ILOA 1HSZA 3PJFA 2NUAA 4OQYA 4KTTE 3UAGA 2UUPA 4G5HA 4J0FA 3CPSA 2AA3A 3ZHZA 4W6ZA 3PHHA 2JAPA 5G0WA 4UUPA 2QX7A 2J3HA 1SEVA 1TEHA 4BO7A 4UVEA 2W2LA 5DCWA 2RAFA 2Q4EA 5EL0A 2CFCA 4A26A 4HUJA 5I7FA 1F8GA 3D4OA 3QWAA 1ENOA 3PP8A 4EDFA 1B15A 4ND2A 5A3JA 1LDGA 2B4TO 3HZZA 2AQKA 4IJKA 4YYZA 4ZRNA 4BO9A 4UVIA 4EW6A 2VWPA 2VT2A 1XHLA 3IUSA 3E9MA 2Z1MA 5COBA 5AQ1A 5ILGA 1PSDA 3C8MA 3MTJA 2JCVA 1V3UA 1J49A 4X54A 1RM3A 2I6TA 2RBEA 1FJHA 1XKQA 1C1DA 1UDAA 2VUTA 3KYCB 4DTIA 3P7MA 3PEFA 3QW2A 3DBLB 3AU9A 5DP2A 2P4QA 2GN9A 3EZYA 3DTTA 5F5NA 4P38A 2H9IA 4GVLA 5BNIA 3U9LA 4HFJA 5JYEA 1E7YA 2DFVA 3PFWO 3IUPA 4EBFA 3ZW9A 1LRLA 1Z7EA 3ZWNA 3QP9A 3AK4A 3ZWWA 3WYBA 2EKQA 3GVCA 3IJRA 3DOJA 4FN4A 4BUCA 5L40A 4CL3A 4B4OA 2Y1EA 2GZ3A 3JD3A 4J9UE 2RHRA 1NPDA 1YOVB 2JKVA 5L7TA 3JQ7A 4YQYA 3VVCA 4ID9A 3F4LA 4MJLA 3M2PA 4R01A 4BNYA 2X0NA 1NXQA 1WMBA 2J3JA 1WXDA 2YUTA 1NX6A 1AXEA 5A9TA 3OJFA 2J3IA 3V1YA 1NVMB 1YJQA 4NI5A 3CZMA 3DAPA 1X15A 1M75A 3AUSA 1P0CA 4OIMA 1P1FA 3DONA 5EQFA 3DBVO 3RC7A 2OMEA 2IRWA 1I33A 2EJVA 4R41A 4AICA 1QYXA 3S8MA 4GWKA 1GPJA 4LVCA 2VNSA 3PJDA 4DUPA 3AI1A 6LDHA 4MOWA 3JCZA 1FF9A 4XEHA 4MVJP 2F00A 3DAGA 4J0EA 4UAGA 3ST7A 2EG9A 4DXHA 1GCUA 1GYQA 1KVUA 4L75A 4NMHA 5I9MA 4R4JA 4YTEA 3T7CA 4J3FA 4OOEA 5JPIA 3V1UA 3EAGA 4L0QA 1OZAA 3UICA 2X5OA 4FFMA 5HS4A 4XYEA 3V2HA 3NAQA 4PCVA 1P0FA 1C0KA 1PWXA 1BWSA 4TVOA 3ZI0A 2QRJA 4L4RA 2GR9A 1Q2XA 4DREA 4F45A 1U8XX 2HJSA 3PYXA 4YT8A 4ND4A 2P5YA 4GGPA 1R4NB 2HDHA 3ZU3A 5C7LO 4PLYA 3OHSX 3BXXA 3A9WA 3W8DA 1LRJA 1ZXLA 1E6UA 1LXCA 1X7DA 2X0IA 1WDLA 1ZK4A 3U62A 3AU8A 1KC3A 4BIIA 4HNHA 3K96A 1HZZA 1CEQA 3W8EA 4R68A 4XWYA 5TJ9A 1ONNA 1I3KA 2NU8A 3RC1A 4FJ0A 1NASA 4I8XA 1S7CA 4KMSA 1W0CA 5MDHA 1IHXA 1KYQA 5L3ZA 4BKQA 1I3NA 4E3ZA 1ZJYA 3HDYA 3F6YA 4Y6RA 1H6CA 4CM9D 3WGQA 2PR2A 4OXKA 2JAHA 1PL7A 5AOVA 3LT1A 4AJ4A 1GZ4A 1ISMA 2X1HA 2BFAA 3BTUA 3GNTA 3KUXA 3ZWCA 2O50A 1E77A 2DM6A 1R0LA 5A9SA 4AJOA 3OH8A 2VTDA 1OC2A 5BT9A 3KYDA 1JQBA 1T4DA 2GRAA 3PPIA 1NTOA 4XB1A 3W4IA 3QQPA 2JD1A 3WX0A 5G0VA 5CG2A 2ZB7A 3ROQA 1YKFA 4NDNE 5GY7A 4BO1A 3AUUA 4NK4A 5EMHA 2E6UX 4ND3A 3H7AA 3PXXA 4FSHA 3HE3A 4HX5A 2DTDA 4XZ3A 4CM4A 4YPOA 2Y05A 2GD1O 2PD4A 4MVJA 4NBTA 2X4GA 2ZYGA 4FJ1A 5IXSA 1JKIA 2JCXA 3INRA 1BXKA 1O8CA 4Y6SA 1LLCA 4ZQFA 3G17A 4BNVA 2Y68A 3B1JA 1XEAA 5GZ6A 2NVBA 7MDHA 1LI4A 2CD9A 2O23A 1HDOA 1PZFA 2VZ9A 4DYDA 1ZK2A 2PTGA 3BTSA 3E9NA 4AFNA 3H5RA 4L4SA 1QYDA 1NR7A 4E6PA 4CMIB 4J4HA 2VN8A 3I6IA 4YAGA 3CMCO 3MOGA 4GL4A 3ZDFA 4E31A 4LRTB 3NX4A 2Z5LA 3GMSA 3VDQA 2PNFA 1HLPA 2V6MA 3JYNA 4YJGA 1DO8A 1TLTA 1XIVA 2D1YA 1V35A 1H2HA 1R66A 2QYTA 4BS9A 4R3NA 4D41A 3WNVA 3RI3A 1GUYA 3G0OA 3JQGA 3KSZO 1XGKA 3HHPA 4RV9A 1QYWA 1ZK3A 3KTDA 4MO2A 5JDCA 2O4CA 2Z95A 1EQUA 1PJBA 2I99A 2O3UA 1ZEMA 2UAGA 3AJRA 1ONOA 2EJWA 4EI2A 3ASUA 4BO8A 4DPMA 1JVSA 1UP6A 4EJ6A 4QO7A 3AI3A 3G1UA 4FDAA 3IKTA 4K6CA 4WLUA 2CVOA 1E7QA 4JBIA 3GT0A 4H3VA 2J3KA 5IF3A 4J16A 1OFGA 3B70A 1NWCA 2P9EA 4D3SA 4WUVA 4YAJA 4FW8A 4WLEA 4NBVA 1E7RA 1LSUA 1D1SA 2GDZA 2NVWA 3E82A 2D5CA 3AWDA 3NT5A 4GMGA 1T4BA 1LQUA 5AVOA 4PLCA 1E1MA 2IZ0A 4J7UA 4PLPA 3WOHA 3GH3A 4WCFB 3ONDA 4I5DA 3P2YA 3QV1A 1NHWA 3DZIA 2FP4A 2IXBA 1Q7CA 3JQBC 3KV3O 2POQX 1GL3A 3DWFA 3C7CB 3PHLA 3OJEA 3KRTA 1DSSG 4WJZA 3UVEA 2C82A 4OHUA 1NYTA 1D3AA 2Y0DA 4EYEA 3DC2A 4B8WA 2FMUA 2QQ5A 4P8RA 3ZWVA 4JXKA 1GYRA 2VWHA 4PZDA 4Y9DA 1WDKA 4U0JA 1RM5A 4QEDA 3S2IA 3R3JA 1XWFA 1ISGA 2X9NA 4IQ0A 1AXGA 4UUNA 4Y98A 3EDMA 3L4SO 3PIIA 1GDHA 3ZNQA 1W4ZA 3SXPA 4RF4A 4JP2A 5JMPA 2VUUA 3GFGA 3W1VA 2QHXA 1D8AA 4CMHA 4K26A 1A4IA 1K2WA 4QFCA 1IPEA 3DB2A 3VZPA 4ZU3A 3W8FA 3ZU5A 2NU7A 4DMLA 2J5KA 4A5OA 3ZNPA 1EUZA 4Q9NA 1Y6JA 1ZNQO 4II2A 3MEQA 5G2OA 3RWBA 3M1AA 1E5QA 3HDHA 3QVXA 3RJ9A 4BKPA 1U28A 4QSMA 1PS8A 3HWRA 4WEOA 1C14A 4D3DA 1OC4A 1HZJA 2IEBA 2P4HX 1GTMA 4YWJA 1PX0A 3WGIA 1HLDA 1X13A 2FOIA 2YQ4A 4XQEA 3HADA 3KO8A 3RVDA 1OOEA 1LC0A 2VYNA 2OOSA 3SVTA 3AY3A 5CDSA 3JQBA 2DBVO 4YCAA 1XU9A 2VHYA 4R54A 3TZHA 4MP8A 1H0KA 3DBHA 2YJZA 2EW8A 1I3LA 1EFLA 1LX6A 1WLYA 4F6LA 5CEJA 3UUWA 5I7SA 2PA3A 4Q3DA 5TQVA 2PWZA 1W8DA 4OO3A 4EJMA 1ISFA 1U1IA 4YJHA 2B69A 1H9BA 4M87A 5TT1A 2RCYA 3SJ7A 4R9SA 3U4DA 1VSVA 3UH1A 4QXMA 5FWNA 2ZTLA 2X7HA 3HB5X 3TN7A 4J6FA 1DFHA 2QRLA 5T57A 3R6DA 3LF2A 9LDTA 4GWGA 1JWAB 1DJQA 1VJ1A 3FBGA 4MVJI 1PQWA 1T2CA 4D7AA 1YBAA 3H9GA 1DBVO 3IDSA 5F3RA 2D8AA 1U2GA 1WMAA 4WLNA 1IZ0A 3JD4A 3JQAA 4QT0A 5C7IO 1N8KA 3O38A 1SOVA 3M2TA 1KEUA 2G82A 2P9CA 5DCYA 3FNEA 1U3UA 3C3XA
chains in the Genus database with same CATH superfamily
4ZYYA 4QGAA 4QICA 1BJKA 1GADO 5SY9A 1C3EA 3W79A 3KQKA 4I8DA 5AXDA 1KJNA 1ZGHA 1Z6QA 1LUAA 3A1NA 3I5YA 3OLWA 3HACA 1TVEA 5IT9A 3MWYW 4I5FA 5KSPA 3KVVA 1ZNYA 5K8UA 1ZAYA 3E70C 1Q0PA 4NSNA 1J56A 4JOCA 4ENPA 5A1JA 4UVDA 1F2UB 2FMHA 4OYLA 4PHCA 5K3SA 2GF9A 3AUYA 1MO3A 1H93A 1U7TA 2HWXA 3ND7A 4UTZA 4F1JA 3T8YA 4X1YA 1WF6A 5LD2B 2WE8A 1DIHA 1PNVA 3NUQA 1QG2A 2FR0A 1KJWA 1DWOA 4IHAA 2A57A 3SYNA 3X1KA 1JWBB 2ZT8A 3IIIA 1RPAA 5SZIA 2PGJA 3D6MA 1Y9DA 1E2IA 2YS7A 2H92A 1UJ6A 2JFUA 2ZB2A 1JFVA 4TROA 3SJBA 1ICEA 1RC1A 1B26A 3FCYA 4M22A 2OQRA 3ASVA 3QPUA 1YUBA 1L5QA 4I4NA 4N1AA 4XASA 3SSNA 2DPHA 3QLVA 2PUBA 1PK7A 4IIVA 3F7OA 1YI1A 3PI6A 1GA1A 4LOIA 4O4LB 5KTPA 4BFLA 3OKCA 4AS2A 1ZVJA 2GD0A 3E27A 4JEHA 5M04A 5ES4B 2WWHA 1YTUA 5EHGA 5ICFA 1BS1A 3KAPA 4PC6A 3ZTWA 4B6GA 1XZCA 3QEAZ 5FWAA 4AUNA 2AN9A 1T0JB 4NCJA 2AS0A 2QTGA 4R9NA 2FN4A 1RQNA 1RAHA 1W0KD 4A1OA 1G21E 1CEXA 1NM5C 2W2PA 5TE9A 3ANTA 1L7AA 1QP8A 2JC3A 4K9SA 2Q46A 4QPPA 5LA6F 4BGIA 1SCKA 1YB5A 4JYBA 3DAFA 4W7SA 3L9XA 4BNXA 4PZLA 2OBXA 1EEHA 5CB8A 2D0DA 8ATCA 3F1LA 3Q98A 2PBZA 1QVWA 1PS9A 5DK6A 1Z8DA 2OCXA 3I05A 1KETA 2PM8A 1QORA 4QOJA 4ZCQA 1RI5A 3DDWA 2ZIXA 3E1SA 3H11B 1JG1A 4R31A 4AZWA 1PR2A 1UXOA 2H8KA 1MHTA 1DJLA 3LNCA 1R27A 3R3UA 3LH5A 4IXMA 4L4XA 4BNDB 2XECA 3LL7A 1D4FA 2ZR8A 2RGBA 3PGJA 5IAAA 3KYCA 1QIHA 2B0CA 2PT6A 4IOMA 1W4CA 3BFPA 5FV4A 4IF6A 4N9WA 2IW3A 4LHZA 3GRUA 3UMFA 5FBWB 5J2UF 5DK4A 4HZIA 4QOFA 3EC2A 4D8WA 1Z0UA 2HT6A 3RJ5A 5KJ1A 3E84A 4XJSA 3TD6A 2Q1YA 3C43A 5ICCA 1GO2A 1CDZA 1ADBA 1QRDA 4IEIA 2NSLA 2O6HA 1EK1A 2BFBB 4OUKX 1Y4AE 4EDHA 1AVTA 1WA5A 2BELA 4TLBA 5DHSA 1QQTA 4XQGA 1EGMB 1L5HA 1KFBB 1EVZA 3H5VA 4YV0A 2W2XA 5CDYA 1VI5A 3ML1A 3ABRB 5CDFA 3F7TA 3Q7QA 4QC2A 3AVTA 2WJWA 1TYCA 1Z5NA 3OIDA 1KU0A 1YOVA 2ZJ8A 4LHSA 2NX2A 3CJRA 2RK4A 5FPHA 4YGXB 5L3VA 2AGVA 2ZJ1A 5CVVA 2OCLA 4LCEA 5LZ9A 2ECFA 2ZYIA 4MS3B 2DVMA 3FJ1A 3S2UA 1JFFA 1H1LB 1LJLA 2HMYB 3L6OO 2VWGA 3IKVA 3THOA 4HGQA 1IQRA 1JIKA 1NHGA 4DRZA 1L5NA 4URWR 3OEHD 4Q1BA 5CIQA 2AQ8A 2DLNA 4P4SB 4GWLA 3O03A 2ZBFA 4NRDA 1J33A 4TTVA 4YCBA 2F43A 3TMKA 4Y6LA 3K35A 1IATA 4IV0A 2W2KB 2CMGA 3FWKA 4Q48A 1SGWA 4CKWB 1LQ2A 1GTG1 4RORA 1H5QA 4R7TA 2WF9A 3BGVA 1UDCA 3L2OB 2Y6UA 5B4VA 3ZD6A 2PSFA 1E64A 4ZTBA 1V1MB 1KC1A 3GI1A 2DKOA 3BWXA 3A1UA 1GLGA 1X1EA 2F3UA 2JJ8A 2P62A 1MVLA 3M6MD 2XLCA 4GRAA 3MINB 1OX6A 1RC0A 4L50A 4QBIA 5WRFA 3VHQA 4DREA 2RHBA 5KNBH 2B7LA 2IUYA 3QVTA 1N9ZA 3C1TA 4Y2GA 1OXMA 2GHRA 2I0FA 2VF5X 3DEKA 4U2FA 4NCXA 5D7BA 5IDVA 2QMUA 2ZTUA 3K5IA 4NYIR 4OGGA 1F8YA 4DJEC 4CPDA 2XQFA 1CDDA 1Z8NA 2GCPA 4ZDWA 2WF7A 5IDQA 4MDFA 4RJJA 1RVV1 2XVMA 1YOBA 3LOPA 1EDOA 4PLGA 4GLOA 2KBEA 4IDGA 4FSDA 5EJAA 4D46A 4ZOEA 1U0EA 4L6IA 4NYIQ 4WNAB 5JAOA 2CJYA 3F74A 4D57A 3TEFA 1FFEA 1LVUA 2G8LA 3D7MA 2B0JA 1KI6B 2E9SA 1OWLA 4XOUA 1GFIA 1V39A 3DHNA 2ONCA 1QWSA 4PBRA 4BMXA 2B5WA 4HDKB 2RIPA 2GKOA 4F2WA 2C7GA 2PRZA 3ZCUA 5E1OA 5KAPA 1JG4A 5C52B 3BK1A 2Y67A 4MVJD 4N65A 4QEKA 1Q3KA 3B6MA 3CA8A 3AEYA 1N9GB 1S2GA 2IWRA 2EJTA 5CCBA 4CV1A 3BIWA 4F1WA 4MS1A 4BNFA 3U7QA 3NQ41 2XMBA 4FMPA 1Q7RA 4DV3B 2HFJA 1KO1A 3VC7A 1RWMA 2ICAA 3JYLA 3LIIA 1QYRA 4LE2A 3GEHA 5CM9C 1R8SA 3GJ4A 4JJ4A 4JUBA 4CDNA 5JIBA 2INGX 3WFJA 5JCZA 1EJ0A 3MJVA 4ZAZA 4S24A 1UXIA 3BH6A 1Z35A 3BAZA 1GUFA 1E9CA 2WG0A 3UXHA 3ANXA 1RW4A 2IBSA 2I62A 4FEAA 5CH3A 3HA5A 4AO6A 3AMVA 4M1ZA 2QRZA 4Q4HB 1CUEA 4KAXA 1J2TA 5BN5A 4BVLA 2BM0A 1MG5A 4FMDF 2PEZA 3G7SA 4B45A 1MJFA 1PGNA 1V5FA 3UJ9A 5I3CA 4JLKA 1Q14A 3UPTA 4H1UA 1N1EA 3R3XA 4H0FA 5F3WB 3OE7D 5BRNA 4UMFA 3WIVA 3I6ZA 1BROA 2WINI 5JNRA 2YZ7A 2KM1A 3UT6A 3BRCA 3DZCA 4X9XA 2V6IA 5ICGA 5G1OA 3HJGA 621PA 1ST3A 1DEXA 1FE8A 5NULA 4LNUB 4MWTA 3RT1A 2QY9A 3R0VA 1E2FA 4GXTA 1KDTA 2IDKA 2XUIA 3K73O 1LDBA 4Y0VA 4KVFA 3D02A 3VR2D 1UQTA 3IYLW 4MAMA 4M1MA 2C59A 3ICVA 4F6CA 1RC8A 5G02A 3FI9A 4PO8A 1IN1A 3KQHA 4D56A 1YS4A 2B1JA 1DX9A 1E8DA 2Q3LA 1WUHS 2BJHA 3FGZA 4ZAGA 2ZJZA 3N2LA 3TRDA 1FL9A 2R86A 1L5WA 1MAUA 4I46A 4EGAA 2ODQA 4GX1A 4IILA 4PRZA 4AKGA 3LF1A 3MMSA 1P4SA 2WI8A 5K0ZA 2O7RA 2ZT5A 3BAFA 3DPSA 3PWZA 2B5OA 4AS1A 4L51A 1GUAA 1LH0A 3RVSA 4NYMR 1NJ8A 5AKYA 3KEMA 1Y82A 2ISCA 3S28A 1MLDA 4FCVA 3V33A 4EZBA 3ET5A 3W3ZB 4IHJB 3ICOA 3VH1A 4BCCA 4AJJA 4CQLB 1WTCA 3K3PA 3QLTA 3AR7A 3RLFA 2R60A 3VR5A 1XQ9A 2XBLA 2YYZA 1UEJA 3FXAA 4C2BA 2F64A 1E2LA 2FEOA 2I1QA 1CWUA 3B51X 3KQYA 5D1NA 1OVGA 4P7KA 2GCIA 4B4VA 4ZCIA 1Z56C 5DSTA 3DUFA 1KQFA 1X7YB 4KYVA 3EISA 1QAOA 4S1VA 4EH1A 1RBYA 4IIDA 5FADA 1RLJA 4TKUA 1MO4A 3OP4A 3ZUGA 1D7AA 4ZEVA 2REQB 5DW3A 3QKUA 3GA7A 1NSTA 2YV3A 1RQPA 3QPCA 3CUKA 2ZBDA 3DMPA 2FK8A 3RIYA 2C4VA 3SJZA 4Z53A 4JP8A 4PLZA 2DSNA 2JFFA 1KWKA 2JJQA 3UG7A 1AA9A 3P9YA 1FYFA 4L9WA 4ZMBA 1QBGA 3H17A 2B94A 3OZVA 3C1OA 3MT7A 2JLXA 3YASA 1NJ5A 2Y6VA 3QNWA 3ILYA 1ZI8A 3HL4A 3QVJA 1F20A 1L1RA 1II8A 3GFBA 2WJJA 1EVLA 4M0EA 1UL1X 1KK1A 2IDZA 4GX2A 5EQJB 5EFOA 2OKGA 2ACWA 3E5RA 1YA6A 1NBWB 1SKAA 3QU2A 2H57A 2WSMA 1QE3A 3LLCA 3QKIA 4JT2A 5CA0F 2JZNA 5THQA 2V6GA 3JZIA 4ENVA 4M0KA 2PXCA 4CM6A 2QGZA 2VT7A 3NVMB 4RTSA 1HTTA 2E4VA 1UM9B 3LKZA 2PCJA 3QENA 2J9XB 1CZNA 3DE2X 1GXSB 3HZRA 3L7AA 3PL1A 1EUCA 1I10A 4FK8A 4JFAA 1S2DA 1K7EB 2AEEA 1ZEJA 2PWPA 2F9MA 3PEWA 4JDPA 1QZ3A 3B3QA 6PFKA 5F51A 4BFZA 3NHRA 1BXRB 1MT0A 1CUJA 4UBKA 1R6BX 1IUNA 4P84A 4MGZR 3TUZC 1FFAA 3C14C 1U3CA 1V95A 3KXIA 4LJAA 3ZE1B 1ECCA 3GRPA 4QVGA 3KCQA 1XZPA 5C1BA 2FG7C 4DA4A 1CUBA 1KS9A 4CLHA 5JDIC 1AV6A 3ETDA 3RS3A 3SMQA 2UUAB 2X1MA 3F7MA 5EUQB 3LQ4A 3SQDA 1Y6RA 2PV0A 2XMSA 3FZGA 3OECA 3QY0A 4YJ2F 3SR0A 2HF7A 1T2VA 1I36A 4GVPA 4H3SA 5FA5A 4EYKA 1N2JA 4HNGA 4BNLA 4ZD6A 3V4ZA 2ZRHA 3ANNA 1HYGA 4DCOA 2F90A 1UMBA 2ARKA 2O07A 4IS3A 3TQQA 2J3LA 3GV0A 4D1YA 2UUBB 1U3TA 2BH2A 5KTTA 1SBTA 2WHPB 5HTKA 2BP7A 2QG4A 3SBEA 1E1CA 3E61A 1HUQA 2GUWA 1RHUA 4AURA 1GD1O 1MJGM 5EEGA 2GLUA 3JTEA 1T9DA 3MHTA 1LW6E 3C48A 2PL1A 5IKOA 4CHGA 3AF5A 2X41A 2ZE5A 4RACA 2HL6A 4XH9B 5JI2E 3N07A 1ISJA 4RNDB 1F12A 5C5CA 1OYWA 3KELA 2Q0QA 3PD1A 4TL9A 1ZZGA 2CJPA 1KJQA 3JQAD 4HVCA 3WLHA 3U09A 4EJSA 5P8WA 3NPAA 1F51E 3TW0A 3H1EA 3B1YA 1PTJC 1GTZA 2VZ8A 3UT5A 3D0QA 3ORQA 4HDSA 2WILA 4MB0A 5AM0A 1UAAA 4L08A 2B4QA 1CQZA 3A4MA 1IBCA 3M1IA 4X1KB 3NWEA 2EWWA 3DNFA 1QOQB 2QVXX 3AV0B 4P33A 4YQEA 2GK4A 4HB0A 4G4GA 1VZ2A 1KP9A 2NZJA 4BMCA 5F98A 1GNVA 2PU5A 1Z18A 3P9SA 4HLCA 1IXKA 4RULA 1ZICA 4IMRA 4XKJA 1WXEA 3E4CA 3GROA 3MNFA 3INYA 2D3WA 3NT4A 1CULC 2CHEA 4BASA 4RTMA 1TYDE 4MR8A 2FPOA 5BR8B 1Y3FE 1B42A 4ZI3A 5J23A 4B71A 3DDZX 4XW2A 2BMEA 3KZKA 1KTVA 4TT3A 2CB9A 3MCUA 3I1FA 2C04A 3ID6C 3OA0A 4RA6A 1SU4A 1H22A 1Q0LA 1IQPA 4FUQA 1P9OA 1CIJA 4JYCA 4WLOA 3LPLA 1VQ1A 2D1SA 4BWFB 3PNBA 1E3IA 2VAMA 3AQIA 2FK7A 3QMMA 1L4LA 1XROA 3E05A 3L4JA 4UBMA 4UMEA 4UNRA 2HA4A 3O4FA 5ITSA 1OIWA 1E69A 3NTXA 4O1MA 2H29A 5DYWA 3SKYA 3U7JA 4ZZ2A 3TF5A 4KJXA 4PBTA 4HF7A 1N34B 4ZCSA 5F78A 3PRHA 2WQZA 3O3CA 3X1DA 2CLDX 4HEJA 1GPH1 2CY0A 3JV7A 5FBZA 4QFMA 3I2YX 4MA4A 4IG9A 4EKYA 2G77B 5EOVA 1ZJJA 2P5SA 5K3BA 3WDMA 1AX9A 2C61A 2REOA 4Q39A 3SXJA 3TQSA 2I8LA 1EUDB 3BXFA 4H18A 3MT9A 2ZGVA 1Z4MA 2PZFA 3BX1A 1NRIA 2BMVA 2ESRA 4CM1A 4RS3A 4MA0A 2BD0A 4L76A 3NM6B 5JRDS 4H08A 3Q3VA 1O8BA 3G82C 4OH1A 3V00A 4XM1A 1XU4A 2FWNA 2FZGA 3QF4A 4YRCA 3VKVA 4QKQA 1QTQA 1MOZA 2Q5CA 3ZX4A 1YI0A 1FX0B 2CNWD 2PKQO 3JQCA 1A9SA 3EMKA 4TKLA 1I01A 4RFSB 4C5CA 5LCXA 3HKCA 1QPGA 3ENQA 3OAAD 3NP9A 2CLIB 2H0AA 3RSHA 2QW1A 3L1VA 4ZQGA 4UOEA 3K1TA 5BURA 4O4JB 1SBZA 3JAMA 3AM1A 3BWEA 5ALKA 2FZ5A 4HJXA 1WRBA 4PINA 1LNSA 1MHPA 1M2VA 4QECA 3VZDA 2YCLA 5A5EA 5K2OA 5ALHA 2FSVA 1A2OA 1TD9A 2CB0A 1C4KA 2VRCA 2PRKA 4FSXA 3WSWA 1WUIS 5A6SA 3LQRA 1FPQA 2V4UA 1U2DA 221PA 1WQ1R 1VPTA 1GP2A 3OLVA 1LK7A 4P7BA 2XMQA 3U17A 5IDXA 2QTLA 3WDSA 1L7XA 2WG2A 2YMMA 2DWUA 1B3RA 3PC2A 4JN6B 5FULA 1NRWA 2YVLA 2PS3A 5EA2A 3MJDA 4KXYA 5JD5A 5ER9A 1QKIA 1NJ1A 2X5NA 3OIFA 2QRKA 2NYVA 4U00A 2BC9A 3R20A 3R3ZA 3TKYA 4V1CA 2C5FA 1W9HA 3AEKB 4MGIR 1QUFA 3DA8A 3PHIA 1HH4A 2JLVA 1SOWA 1FNBA 1TVKA 3DR5A 3DV0B 5D3ZA 4V2UA 2WAYA 4B3SB 3UHPA 4QUKA 4UD2A 1SM4A 1U3VA 4PHHA 3KHUA 4EIWA 3MJSA 3WKDA 5ELLA 1MV5A 4HDCA 1FP4B 3OX1A 2HNAA 1G20B 3CW8X 5H80A 1FDRA 2J5RA 1NVWQ 2OGTA 1UXJA 2OO5A 2AG1A 1AK2A 4E5UA 3LT2A 1XZ8A 1JAHA 2QTNA 3EHDA 5ALYA 1T0HB 4LVNA 5AO9A 1I4DD 3A3YA 1EDZA 2D7DA 1UJMA 5JFOA 1H2WA 3SSOA 2JJMA 1UZNA 4H9GA 2YRXA 4HWKA 1QGAA 1ZO8A 4ZANA 1R10A 3DFZA 3FCAA 3PUYA 2JS7A 4NR0A 3HYRA 1QTIA 1EG2A 3KTFA 4G0OA 3DYIA 3G2IA 3N2GB 5JADA 5JNWA 5LXTB 3R5JA 1PT9A 1WU7A 2Y1GA 2AMJA 721PA 1NGSA 1KTIA 3KJHA 3GMDA 4ILKA 4O2AA 3C16C 4CM3A 1RWXA 1SIOA 5CGQB 4YP7A 1DARA 1ML3A 3HCNA 3TEMA 4JXXA 3UG6A 4ZAXA 1F6DA 5TB5A 4DTCA 3GEGA 2WJ3A 4EJ0A 1AQUA 5JTUA 3NH6A 2J0VA 2L42A 1BA2A 5DTJA 3IQXA 2OV8A 1RACA 3I9KA 5A9SB 5H82A 4Q1VA 3AC0A 3MCZA 4BDTA 1E9DA 4YV2A 3LYHA 3LA6A 2NYAA 4RKWA 5B3JC 4UVGA 1PU2A 1WUKS 2NNWB 4MW4A 1DIRA 1LLUA 2VF4X 3L1IA 1X39A 3LDAA 1V6SA 4FLEA 4RDIA 4V0KA 5EPOA 4WK2B 3U16A 4DR4B 3CMMA 1OT5A 1UDWA 2YVQA 4R3WA 1QR6A 5BVHA 3VPCA 4UKDA 1YACA 5K0CA 3ORYA 4NE7A 4PBSA 2VHEA 2Q5IA 5B6PA 3DLIA 1EP1B 5CD9A 2B98A 5CEFA 2PKWA 4S35A 3W1WA 5DHTA 3MWEA 5AMXA 1FK8A 2WWXA 3KQLA 4ILEA 3KTOA 3PKZA 1YBMA 1G9TA 2XQJA 3BGOS 5JZSA 1PG5A 1RMQA 3ICPA 2OGZA 3RHFA 2QQGA 3QM1A 1OXUA 1PUIA 1G5IA 3KZCA 5HZKA 6CHYA 1EYZA 4S2EA 2OXIA 2HLDA 4ZU6X 4D0RA 4EHHA 1UPBA 2W22A 5EWMA 1X7WA 4RZSA 5E8RA 2YUIA 4LXGA 1Q5PA 1DP4A 5E9JA 5IC5A 4RVDA 2WPDD 1C0PA 2Q28A 2R1TB 2YW9A 2HMVA 3RCBA 2H6EA 5MGNA 5U9CA 1P0IA 3ZD7A 4IJWA 4QNNA 2Z9CA 3ZWPA 1QQAA 5HIIA 2H31A 4B6RA 1DZIA 3FB1A 2DH5A 1EFCA 3A28A 3EG9B 3QY9A 1TQ8A 2XF8A 3GPBA 3UY4A 3UWOA 2J3MA 2VIIA 2X6TA 3DKVA 4POAA 3PFFA 5FHQA 4H1VA 4GU5A 3IOYA 4ONEA 1XDBA 1TRHA 4IF4A 4DLPA 4DGSA 4PYNA 4BEBA 2R5FA 2P2CA 2PX2A 4IXDA 1C1XB 3L46A 1RQLA 3OOEA 4YDHB 5DX0A 1SKQA 3H5WA 1JEQB 4PSCA 3GZNA 1UWLA 2JA1A 3G9UA 3PD0A 3WFZA 5BN1A 2PZEA 2XYPA 1YFJA 3AL0C 3V7FA 2ZZMA 4P4NA 4O4LF 1IXRC 2R8EA 4CI0B 4ZARA 4PTLA 4KN8A 2P7IA 3GLHE 1C30B 4NXMB 2IQIA 2XVAA 2O2SA 4JGGA 2IODA 3CF0A 2CMKA 4Q4LA 3DQQA 3EZ7A 3PE4A 4W7HA 4X5OA 4L02A 2ZKLA 5GTDA 5B1IA 1IN6A 1X8LA 1ZIYA 2I9PA 2NWQA 3AONB 4XX0A 3WYCA 4YLYA 1EP3B 2QXYA 1DKOA 4EY4A 1DG3A 5K6TA 3K20A 4AXBA 4ALIA 4C3OB 1GHTA 2AOTA 4IV5A 5E7JA 2IV3A 5KOHB 2W37A 4G9BA 2BWJA 1OVMA 1QV7A 3U7FB 3G8DA 2NNLD 4KIUA 3BJRA 1G5RA 4ZGWA 5IEJA 1LPMA 3ZGNA 3PUVA 1Q2UA 2H65A 2WY2D 2OENG 3VI4B 4X6XA 5KNLA 2H1LA 4RMHA 2I1VB 1C3JA 2QSJA 2YIVX 2H1CA 9LDBA 1JKMA 3CE6A 4PC3A 4LS3A 4X20A 1I24A 3FUWA 2W6ID 4EB0A 4UJ5A 4AY2A 3GC6A 4IBOA 1V71A 2BFFA 1IWBB 2OHJA 4IV8A 4ZI5A 1KAQA 1KZ1A 3LZDA 4G5SA 4KOAA 3UZUA 3ZS8A 4C9BA 5CBKA 3KU1A 3V2IA 4BU1A 4EX7A 2B20A 4LJRA 3EVTA 3WSVA 2I2FA 3WLFA 2E5LB 2JIQA 3EEOA 3QLUC 3DQZA 3EBOA 2VDWA 4K1XA 5TSDA 2IYYA 2YKGA 1ACJA 2EP5A 1S2NA 5HUQA 2JPDA 1NR5A 2RHTA 3V8MA 3ZGOA 5LP6B 3RNLA 2H0RA 4QLOA 3N74A 1AM4D 2CHUA 3GVHA 5K0JA 5FUBA 2Q6TA 3AIKA 4LF6B 1EA5A 1GPAA 2DUUA 2HX1A 3PNQA 1UKZA 2OG2A 4NOLA 5GM2A 2EQ5A 1JNYA 2QLNA 1SCQA 4MCAA 3N86A 4H4EA 4XUDA 3D43A 2JFXA 4BV2A 2XTMA 3TQTA 3UK7A 3I8XA 1OLSB 2EZ8A 2OC4A 4L3WA 3DGEC 2WLTA 4MYRA 4I4LA 3A11A 3HPQA 2I8CA 3CIOA 1M1YA 4ALMA 1X9HA 2XUQA 5L95A 2WTNA 5A4AA 2OZLB 1Z74A 2JBAB 1QNLA 5AHWA 1ADGA 1Z6YA 2D3TA 3MFQA 4I4TF 4U9IS 3WB1A 1E96A 2DFTA 4BNNA 2HJGA 1S0UA 2CZCA 2F67A 3TR6A 1LBEA 4MR9B 2GJKA 1JLKA 2OXEA 1GUDA 5K3DA 3BEDA 5SYMA 3ZE2B 1WSBA 2WDPA 3QJGA 3MXTA 2Q4TA 4X0EA 4JQZA 5KI6A 4MLPA 2HKIA 4YJ3B 2ORIA 1VG9B 1KFJB 3DXFA 3HYCA 2IXAA 1NBME 4HFRA 4RY2A 4OQPA 1DBPA 4GZMA 5AJUA 2EQBA 1DAPA 3G0DA 2E0IA 4Q02A 4UE6A 4XQCA 3AGQA 3W5SA 1HNWB 1OLOA 2OV4A 3THYB 1U90A 4HDOB 1IJKA 1X3LA 4OU4A 3BT7A 3UV7A 3ZD9A 13PKA 1RIIA 2R97A 4WT7A 1OMOA 4NNJA 3KL2A 2GKSA 3KZXA 3KM0A 1SJ9A 2C8LA 3A27A 3SVLA 4U7TB 5L53A 4G67A 3ER6A 1U2EA 4J9VA 1KARA 3W1EA 2FQQA 3UWPA 3GBPA 4GP9A 1W94A 5JSKA 2NTNA 2ZSKA 2NO6A 3G2JA 3WG9A 5KYTA 2ZBPA 4N3AA 5GINE 1SVWA 1V43A 3H5OA 1Q1GA 2F1IA 2YJ5A 3FVWA 4WBSA 5TNXA 3S55A 3WHLA 5KTMA 1SC1A 2GERA 2VHZA 2WD7B 4YO7A 2LUOA 3B7WA 2VUIB 5DXAA 4WMLA 2QBYA 5ARBA 1AUPA 1OZFA 1RRGA 2AKYA 2PE5A 4Y2SA 3NOOA 3TI9A 4CKCB 4H7IA 2OY0A 4LI3X 4E5MA 1QC5A 3HB9A 4N0DA 3IGFA 4EUEA 2ERXA 2P41A 3WAKA 2H2WA 1E62A 2JBHA 3GLRA 4XYGA 2OESA 3W78A 1YCDA 1YIDA 4BMPB 3ZK9A 3CWCA 4M60A 4BGDA 2AYZA 3GUCA 5LLTA 4J29A 2XOEA 2EERA 2PKQP 1M7HA 2BGLA 4C0AC 5F7XA 3T1OA 1WZEA 4B35A 1VE7A 4FBMA 4L6CA 4JYAB 4W5QA 3FSGA 1EFDN 4FYVA 1IY2A 3JD1A 4LDPA 2XYHA 4HN9A 5HM8A 3JVEA 1ZITA 3A9CA 4LHEA 1IXYA 4P31A 1YA8A 3WBBA 4ZZ3A 1OH8A 3ZYCA 3F90A 1FLAA 2V0GA 4JI2B 4ZODA 4PR0A 4N48A 1QCYA 1DOZA 4LYFA 2ZUBA 3ZWMA 4V0SA 1GAXA 1KZ4A 3WR5A 4AKIA 1ZG3A 5I7OA 3ER9A 1P0PA 1C8BA 4TYQA 4W82A 5HZGA 1ZD8A 2Q3FA 2QNIA 3DZFA 3HCBA 3HV2A 1FRNA 3UMCA 2ZB3A 2H5LA 3JYOA 4IFEA 3OC0A 5CU7A 5HF9A 4EPVA 4ER5A 5L4SA 2PUJA 4PO1A 5BYKA 1ZUNA 1LDEA 1VKOA 1R0YA 1Y3HA 2CFIA 3DEJA 2OYRA 4AJ1A 1IEVA 2V7TA 2IBMA 1L5RA 4O1IA 1FNSA 3MWJA 1R6XA 3NJ8A 1YAHA 4TQAA 1A3CA 1EHCA 3GAMA 4OQMA 1JG3A 4RM2A 3UCEA 4KU4A 1AUQA 2R8YA 4QT4A 1HLFA 3CVUA 2RH4A 1ECLA 1TPZA 3PX3A 1E3QA 1FSZA 1KEWA 4AX4A 2I91A 2UYQA 3IMGA 4HT3B 5J58A 1QVAA 2Y1WA 3DZBA 3AEQB 1RXUA 5DEOA 2R3SA 1PL8A 5JBQA 1FJGB 1C2YA 4LZJA 4P98A 2B1RA 3VZQA 4DE5A 1QH0A 2RHWA 1IOVA 1MTZA 3JASB 4K6MA 3RJZA 4DVJA 1O89A 2AKAB 1C9JA 3DE0X 1GRNA 3IEVA 1X2EA 2GXSA 3G9QA 3LLMA 5K4AA 2QLLA 4H16A 4ZYWA 4G2NA 4GS5A 4LOLA 2W4QA 1E3JA 2BMWA 4HVLA 3ECSA 3UUFA 3OO1A 5LKRA 2XVYA 1TMGE 5BN3A 1PWZA 1ABEA 1NBAA 4H0CA 1GPDG 2RSLA 3GGDA 2CK3A 3WLQA 2R66A 521PA 3UMBA 3ZJTA 2LXNA 1KZ7B 3GO4A 4U3JA 4LOKA 2DFDA 4RZQA 3COYA 2NXCA 4R1NA 4AJPA 3H3XA 2VG8A 1H2FA 2V6BA 1ESCA 1YCHA 3BRWD 3G2QA 3A58B 3TQCA 5C1OA 4JI7B 3ZHYA 3MUNA 1L5YA 1KH2A 4G1BA 4LISA 1H0SA 1V6AA 1H2YA 2X6QA 3PS9A 4ENSA 2BYTA 4FCTA 2BW0A 3AF4A 4DA9A 1M1XB 1M2OB 1RYBA 4ND8B 5DGCA 2AFVA 2EZUA 1J8FA 4KXQA 4OHXA 2QRMA 3L01A 5FBLB 4DNPA 3FROA 3K6SA 1RAFA 2Q45A 4E1VA 1LGYA 1CUHA 4IIFA 1F2TB 1ECJA 4X90A 5FBRB 4C0XA 1NQ5A 3EMDA 1U3WA 1N5DA 2BBOA 3H05A 3QWHA 3SLRA 1Y7IA 1SCBA 4CKZA 1YR9A 1NNLA 4V24A 4MUEA 2AJDA 2JJ2D 4Y3UA 5DM60 1YF3A 4GQAA 4REMA 4Y7DA 3SDBA 3FIJA 1VLQA 1LC3A 2I3AA 3IQDB 4E0BA 5KX5F 1KJ9A 1YJCA 4XPZA 4XCQA 4ZQEA 5K6AC 1ZHOA 1ECBA 1WCIA 2WMYA 2NU9A 1U9IC 1P72A 1GVHA 5DGDA 4FHEA 4CUKA 3DNMA 2A0XA 3H9QA 3IURA 1ZI9A 2OV3A 3K4HA 4DA8A 1G55A 1ZH4A 4IY1A 3RUHA 1KH1A 2JFGA 3EFOB 3ZHSA 3ZHBA 4BGEA 5ALZA 2QLTA 5EN4A 2IEGA 3ETHA 1P0QA 3PNPA 2XD9A 3HA7A 5BV1A 4UTNA 5JYDA 3B2EA 3FNHA 1C0IA 1PDWA 4QAQA 4YASA 2HAEA 2SICE 4HXFB 1E3DA 1U5AA 5AKEA 4TUYA 5AM3A 1YJ5A 5AVRA 1G4HA 1E6WA 3B2NA 2IS1A 4IJQA 4I9NA 1GGEA 3HKEB 3OEED 1X7ZB 1HE2A 4KUEA 5HM6A 3NNNA 4YREA 3GGOA 2BEVB 2VC2B 2WR8A 3HXLA 3QPVA 4LQDA 4JI5B 1P1RA 2NSYA 5HYVA 3WRYC 4RW0A 2B1QA 5LYJA 2ZI5A 1BTOA 2P4UA 3WMXA 1ZYUA 3K9CA 4DF3A 3E5HA 3AL3A 1KY2A 1LI5A 4UDNA 4W5JA 1NW4A 4X3PA 5I45A 3IA2A 3RAPR 5DGXA 3R8XA 2JK0A 3DVLA 1XI2A 3NEPX 4WZBB 4JLVA 4P3YA 2R5WA 2PSEA 1LDMA 4BMDA 4N54A 1AQIA 2C2YA 3GOHA 2HADA 2OC9A 5ALWA 4ZYLA 4Z1MD 4N7BA 1Q1QA 3K2QA 2G17A 5BWNA 2YBDA 4WN9B 5D3MA 4B6PA 3ZH2A 2H8GA 3NHSA 1CJBA 3ZV4A 5ITVA 1QHSA 3K0CA 4Z51A 1S4MA 4FOPA 5KKAA 3UCFA 4ZTZB 4BPBA 1YO6A 2Z2YA 1PG2A 3LOUA 4BE7B 3HS3A 4M4SA 1BX0A 3CINA 1DKUA 1TLFA 1GV0A 3A36A 4LQLA 1H2EA 4YEDA 2BR4A 3H3FA 1UP4A 3AZOA 2BVNA 2C1ZA 3TKAA 3B13B 3CB2A 3LKDA 4D79A 2Q3BA 3JALA 1RYDA 2GASA 4RESA 3OETA 1OJLA 2XGOA 2EBHX 2BLLA 1L8QA 2C07A 1GAEO 3G0GA 2P2YA 1YH3A 3LCJA 3KT3A 4NU8X 3RFCA 3NHJA 4HAZA 3TXYA 1XAGA 1L4UA 3ZQUA 4BFXA 2D1RA 4L9SA 5AD1A 1D9ZA 3I62A 1JL3A 1QGDA 5BV7A 3HYNA 3TAXA 5CW2A 3JQ8A 4BQIA 3Q8WA 1H2BA 1CX9B 5C5DA 2I9KA 2VQEB 1W88B 3K6RA 4UTOA 2GF0A 3B1FA 3DOUA 1HMYA 4GSLA 4R5HA 4UCFA 5G1PA 2V7BA 3CF2A 3LVQE 3S7ZA 3WL5A 4BJ1A 2W6OA 4EVIA 2HJRA 4KZPA 4R1MA 3CKYA 2CV2A 1ZOOA 3NHPA 5TMDA 3FWNA 5H5JA 4B3FX 3QVLA 4EKIA 2Q3DA 2P2ZA 3MIIA 4YUAA 5F2NA 5JHGB 1USVA 1OYOA 4N3NA 4PGMA 1X70A 4MICA 4B82A 4B87A 3VHLB 2R7KA 5CB4A 4N3CA 1JT9A 4QQNA 3SN6A 2IL1A 3H2JA 1JUDA 3BHMA 3Q3HA 4DM4A 3EXEB 1ZRNA 2I6FA 4Q9DA 1Z4OA 2LTAA 4MGKR 4BRZA 3R3YA 5HBRA 1N2CA 1L9XA 1HDZA 5CIWA 4LK3A 3N75A 2FVYA 2H1WA 3K9HA 4R8SA 3HZHA 5AK0A 3STUA 3WBFA 1RR6A 2JATA 3I9JA 1XNHA 4WKBA 5HK8A 2Y1FA 3W77A 3HXOA 1NQXA 4KREA 2VYVD 1QPZA 4M3NA 1Y7HA 3SC6A 4AP6A 1BYIA 3AW9A 3NORA 1IEQA 2OM2A 4XFKA 5BPHA 5JCOA 1KKLA 4OJKA 4X8HA 1Y5MA 4LRXA 4B3BA 4NCAA 2O2JA 3T7RA 3S68A 3BBLA 1GZHB 1UK8A 3WWPA 1I9GA 3WXBA 2A9VA 4NPHA 1XTJA 1TW2A 2PZJA 1RKVA 3G89A 3VAZA 3RFUA 4O29A 4GP6A 4PFJA 2OSBA 4EI9A 1WY7A 3WB0A 1A98A 2Q8QA 1DEKA 4XQ9A 5IEBA 3TPZA 3QUBA 1SCAA 3JAWA 4PR3A 5JDCC 4B4UA 4F3YA 2FEPA 4X8OA 4A8JA 2CKMA 1EXVA 3M70A 3WK5A 4BIMA 5GJWC 4JFRA 4C4OA 3BQ9A 2OV1A 3IUYA 2NUAB 4QUGA 3WGZA 1K8XB 1C7QA 3FDFA 1SZPA 2XKKA 3ADOA 5EPUA 4YDSA 3VZSA 3DL7A 1QKJA 2NSHA 2OD9A 3B1KA 1IQ0A 5CA1B 1XNRB 3UMGA 2PWYA 2V3WA 5JO0A 2M6SA 3WL3A 4G1CA 4Q0MA 4GE0A 5AXCA 3KUUA 4NH4A 2CF5A 3SD7A 4AC9A 4LFCB 1DQYA 4QOIA 1Y9EA 4KX3A 4DG8A 3IA7A 4WOPA 4DLSA 4KO1S 1HQDA 2JIBA 2CUKA 4B75A 3D5TA 2RHCA 4JXJA 3W2HA 3G85A 1BQ4A 1TRKA 4ZVPA 1P3JA 1VI2A 5M34A 3HCDA 2ZSUA 2P8SA 4FHCA 5EJEA 2PJZA 4TSRA 3BM5A 3IULA 3ZDDA 2XSZA 3L4EA 2NZYA 4GMFA 4O59O 1X1BA 4XR4A 2X3UA 3TJRA 3U6BA 1DMRA 3GAZA 1KMIY 1RPNA 2QDKA 2VPXA 3STWA 1E5LA 2JW5A 3PUXA 3CWQA 1YU6A 1BU5A 2NO4A 4L5BA 1Z2CA 3W3AA 4JBGA 3A1VA 2ZE8A 3FPGA 3RROA 3RODA 1UT6A 2B1IA 4WLFA 4UNQA 2WKSA 1JFLA 4DBLC 2V7GA 4OH7A 1HK7A 4R1PA 3LGSA 5F2KA 1REQB 1XZAA 1GQ2A 4JI0B 2CD7A 1OI4A 1QQ5A 1F2UA 1CETA 4GOKA 1DC7A 2M6KA 5GPBA 1OBVA 3PQ2A 3AO0B 3KVOA 1KRXA 1FJ2A 3IEIA 3FW1A 4LC1A 1U02A 5SY6A 1UXKA 3WS7A 3WYEA 1VIVA 1ZC4A 3NBUA 1UDXA 1Z38A 3ASZA 4WW0A 2X9VA 2FFRA 1IBKB 5LMNB 3GHYA 3GRRA 1IJEA 1G3MA 1HTWA 4TS9A 5LDGA 5AVZA 2GBLC 3BL8A 2B4YA 2A6PA 4JUAA 2IUFA 1K4YA 1I2CA 2W2OA 4C30A 2QPLA 1RWNA 3EN0A 2CL5A 3IPLA 1N1GA 4XQ0A 1YDFA 5B58C 4UC0A 5CEEA 4I2NA 1NVVQ 4ES6A 3GDGA 5JEEA 1RAGA 1JECA 1YJXA 3QX9A 4KQWA 3JATA 5KNDD 3P96A 1MA3A 4WLVA 4A27A 3WLMA 2P9BA 2D5LA 4IDBA 4J43A 1PV1A 1AGPA 3NJRA 4DABA 1V8DA 3OCCA 4QASA 3LC0A 4EITA 5D3QA 1YBHA 2GSDA 3FZYA 4BVFA 1AQ6A 1VFNA 3PLRA 2VTBA 3QVWA 4WKOA 3GGGA 1TZJA 5BSKA 2BGNA 1IHUA 1YL6A 4MKFA 3C24A 4RDHA 4XWAA 4ZOLB 3BUSA 2W4MA 1CYDA 3JU3A 3P71T 4X7MA 3H6GA 3CVJA 3X1JA 1A5AB 4BLRA 4O25A 3H2HA 3CO5A 4C0KA 3B5JA 2KX7A 2IE0A 1XF9A 1YT5A 3I2JA 1N92A 4HWPA 4Y6GB 3U1TA 3F9CA 3LZ6A 3JD2A 1EQAA 1TCAA 4GXRA 1T8SA 2CCGA 2X22A 5EGNA 1TT7A 1ZVKA 5IPFA 3DMFA 3L0YA 4RZIA 4XTCS 1DXHA 3AY0A 1IK4A 1D4OA 3I83A 4OYYA 2WFLA 4G9EA 1IOZA 4PICA 1I2MA 4UHHA 1H8EA 4DG9A 3V48A 1Y3IA 3ZCXA 2GD2A 2DJ5A 1FDTA 4NXNB 4Q3AA 1ZL0A 1QU3A 1S3GA 3OHMA 1CQXA 1J8DA 3NBYC 1O03A 3EOZA 3SNKA 4KDRA 3F9RA 2JL1A 4C06A 4DILA 3FDJA 3NDIA 3QEOA 1KPIA 3ODGA 3OQJA 3DDNA 1KAMA 2FWIA 2WFMA 3F4KA 1IJBA 3ZCSA 4X41A 1U94A 4YO8A 3RU7A 1QSGA 4O4HF 4Y6OA 3ZJVA 3OQNA 1JLRA 3FPLA 5K8JB 2EZ9A 2W0MA 3AG6A 3EHEA 3L7BA 1DDOA 4D4JA 4AZTA 1KAHA 2XCIA 3KR2A 5TVKA 2PUFA 3TZ6A 4DDMA 4CLEA 1ODIA 5FYQA 1QTRA 3MZ0A 1KBZA 2H2HA 1AQLA 4KQJA 3RC3A 2G7ZA 1IYZA 2W6NA 1EA7A 4QPJC 4RVOA 5LPNA 4OFBA 4EMSA 3CNHA 1KJYA 3L4BA 2OILA 1AURA 1JJAA 1SU7A 2MSLA 4JENA 1S3IA 2WPNA 2Q2NA 2DR3A 2YXNA 1HTBA 2QYOA 3H1TA 2OV2A 3KYDB 3P0EA 4GM4A 4B6JA 1JKFA 1Q3HA 3ROZA 3ZE8A 3U3XA 4N47A 4MS3A 2AFRA 3IH5A 3JQ9C 3QVSA 4UM9D 3RC8A 1P91A 1BN6A 2QVCA 3QU9A 1ONPA 2FKAA 2LW7A 3IP3A 1JDUA 1PWEA 1IY0A 1YVEI 2ZUVA 3L05A 4FR5A