2PTGA

Crystal structure of eimeria tenella enoyl reductase
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
307
structure length
224
Chain Sequence
PLPVDLRGKTAFVAGVADSNGYGWAICKLLRAAGARVLVGTWPPVYSIFKKVFDKIYPLDAVFDTPQDVPPEVSSNYAGVGGFTISEVAEAVRADVGQIDILVHSLANGPEVTKPLLQTSRKGYLAAVSSSSYSFVSLLQHFLPLMKEGGSALALSYIALESDCRTLAFEAGRARAVRVNCISAGPLKELESDDVGRAALFLLSPLARAVTGATLYVDNGLHAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Type I and type II fatty acid biosynthesis in Eimeria tenella: Enoyl reductase activity and structure
pubmed doi rcsb
source organism Eimeria tenella
molecule tags Oxidoreductase
molecule keywords Enoyl-acyl carrier reductase
total genus 68
structure length 224
sequence length 307
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ptgA01
4TVOA 3GEMA 2IEBA 5KVVA 1NPYA 3C1AA 4M1QA 1VLLA 2DFDA 2OL4A 4IM7A 4YT5A 3U62A 4DUPA 5IZCA 5JC8A 4UEJA 3FTPA 3AUTA 1BXZA 4UUMA 1RPNA 3H4VA 4LVCA 3KBOA 2W8ZA 4Y6PA 3KO8A 2QYTA 1BGVA 2BI7A 3GZ4A 3HB4X 3D3EA 2Y1OA 3R0IA 4E3ZA 3GVHA 3VZSA 2VHXA 2GNAA 3KV3O 2YQ5A 2Q46A 1B3RA 2YDYA 4EJ0A 3HHPA 1Y9AA 1XEAA 2FOIA 4MVJE 1EVYA 4ZGWA 1ENOA 4M86A 3UCXA 2DUWA 3ON5A 4YR9A 1M6WA 1PEDA 1LTHR 4FR5A 3SC4A 3V1YA 2NM0A 1G0NA 4E0BA 4JQCA 4IDFA 4LCJA 2JAPA 4M55A 3AU8A 3LT2A 4XYBA 2VT2A 4J9UE 4J43A 3C7CB 3WGQA 2C0CA 5IF3A 3LC7O 5IJZA 3SXPA 1QLHA 4CJXA 3GEDA 1O94A 2AQHA 3WNQA 3ICCA 4UUOA 4LRTB 4R1SA 1HLDA 2Q2WA 3K92A 2GR9A 3GDFA 2EIHA 3E9QA 4BNNA 1H6CA 3DZIA 4D44A 3KXDA 4RLSA 4PN3A 5B12A 4E4YA 2PK3A 3DHEA 4YJHB 3VPXA 1UUFA 4KTTE 5B4UA 3E9NA 3T4XA 5BNTA 5G0SA 1N2SA 4BNWA 2UUPA 1T4DA 2QX7A 1Y9EA 1U5CA 3VKUA 1HWYA 1ISMA 2DTDA 5A05A 3TN7A 1U7TA 4CMEA 4ALKA 3D4PA 2RH8A 5K0ZA 2X4GA 3OH8A 4IQGA 5L53A 1YOVA 2VTDA 1YDWA 2X22A 5JDCA 5F5NA 1F0YA 3HNPA 3ZWBA 1F12A 4DLLA 3S8MA 3BMNA 3I9JA 4ZRNA 5KVCA 1HTBA 3RROA 2ZJ0A 4BO3A 1K5HA 3GC6A 5U4QA 1P31A 2C2YA 1PJBA 3HN2A 3EY4A 3LC1O 1O6ZA 5KIAA 4CLOB 4U8GA 3BMQA 4R69A 1B15A 1P74A 3I1JA 3KYCA 4NFHA 1E3SA 5F3RA 5HRUA 4MVJM 4A03A 2VT3A 3L4BC 3F5SA 4G65A 5K6AC 1GEEA 3BMCB 4ITUA 1DC3A 4IUYA 3HDJA 4D46A 3QLJA 4XGKA 5F1KA 1GDHA 2EWMA 4DMLA 2I66A 1NBOA 4OH1A 2WD8A 1NPTO 3JQ8B 3BTOA 1ZK4A 4BNTA 3WQRA 3EDMA 1U5AA 3D4OA 4XYGA 5AXCA 1GPJA 1I01A 2X0RA 5CAEA 1SZJG 2P9EA 1HT0A 5JCJD 4TKLA 4FGWA 4R3WA 1CIVA 2NTNA 4CMGA 3LF2A 4N5LA 4HFMA 2FSVA 3QY9A 1HDRA 3OICA 4RO0A 5JDIC 1LJ8A 4RDHA 4OSPA 3RC1A 3VH1A 1P1JA 4BNMA 4Y6SA 1S6YA 1W73A 3HJAA 3CMCO 1YL6A 2ZTVA 3CMMA 1VJ0A 2J3KA 4GL4A 3CIFA 4QQRA 4TMFA 4WCFA 4IIUA 2BF7A 4TVBA 1ISGA 1TA4A 2Q4EA 1PGQA 2WSBA 3FTNA 4TRRA 4AJEA 1YB5A 3PWSA 4BNHA 2GF2A 2G5CA 2FR1A 3GK3A 3PQFA 4DQXA 3ROPA 1DRWA 3IIEA 3AY3A 4CMIA 4J0FA 3LF1A 2CUKA 4ALIA 4E6PA 4L0QA 4I08A 2X9GA 4DWVA 5IZCC 2NQTA 1X0XA 1SAYA 3WGHA 3Q11A 5BR7A 2BRUA 3DO5A 4CUJA 1P0CA 2QW8A 3HDQA 1ULSA 1MG0A 3PVZA 3FPLA 1C1XA 1CQIA 1X1TA 3ROMA 3DZHA 1ZNQO 3FNGA 4I5EA 3ULKA 1YBVA 4BNGA 1OAAA 1P1KA 1ZXBA 4FJ2A 1OMOA 3JD2A 1VE9A 4C4OA 2BKAA 4FSHA 1DHTA 4R1UA 3QV1A 4L4RA 5KVSA 1E3EA 1DFHA 4PIVA 4Y8VA 3UH1A 5F21A 2Y1DA 2VRCA 4OKNA 1F8FA 1I3LA 2NUAA 2C5AA 1KC3A 3KSDO 4CM9D 7ADHA 2ZK7A 1D1SA 2QHXA 4L9RA 4HY3A 1R12A 5A04A 1NQOA 1PIWA 3V1UA 5A1TA 3W4IA 5ITWA 3KOUA 3R3SA 2Z1NA 4FFMA 4ND1A 5U9CA 2NVUB 1V6AA 1W6UA 1HXHA 1M6HA 2VOEA 4F46A 4OO3A 2BH9A 4XB1A 2ZB3A 3WMXA 1ZK3A 3KLMX 3DWFA 1N7HA 1UXJA 4WPGA 5CDTA 3I83A 4P8RA 1LDMA 3DZBA 4TSKA 1EQ2A 1XHLA 3GNQA 2O2SA 4BKUA 2NU9A 4BNFA 2FZEA 1JKFA 1C1DA 5AOVA 4K26A 3HUDA 1QRRA 2V6MA 1PJQA 4KQWA 4Z6KA 3S2EA 3KHUA 3PIDA 1CWUA 1XR3A 1YB4A 4EI2A 1UZNA 5AVOA 3GHHA 3DR3A 1N7GA 2PNFA 3PXXA 5HS6A 3D0OA 4AJNA 2BELA 3PI7A 1NX6A 1KEUA 5CDSA 1QR6A 4YQZA 4CM8B 5L9AA 4GX0A 3GMDA 2YFQA 1ADCA 1HE4A 4UEOA 3M1LA 4HV4A 3INGA 1BRMA 4U6SA 3GZNB 4MINA 5FF9A 3WNVA 4CQMD 2B4RO 4E5PA 2NQ8A 5LC1A 1IUKA 1AXEA 4UEKA 1HZJA 4NQZA 3GRPA 4B3IA 3PHJA 1ARZA 1XLTA 4NBWA 1X14A 4YJGA 4AJHA 3RUAA 2VHYA 3RBXA 4A26A 4WNCA 5TNXA 3MTJA 1XQ1A 3CZRA 3SLGA 3F1LA 1K2WA 4QO8A 4CM8A 4JJGA 1LI4A 4OXNA 1ZH8A 2B69A 1E7QA 1MA0A 3K8ZA 4YVFA 4K9DA 4BKRA 3V2UA 2Y1GA 4BV9A 4CMAA 3M6IA 3U5TA 1LSSA 1I2CA 3FF4A 4W6ZA 5A06A 2D0IA 4BO4A 2QIOA 1BTOA 5TS3A 2I6TA 2D3TA 3OJLA 5MDHA 2H5LA 4DMMA 4F6LA 1FK8A 5DNAA 1NVGA 3TDKA 4OIMA 4S1VA 1EFKA 2Y0DA 4E13A 3GN2A 2G17A 2R6JA 3ZW9A 1KVUA 4H7PA 2JL1A 4RF5A 4YRDA 2PTGA 4Z0TA 4RDIA 3EZLA 3NTRA 4J2OA 4YT4A 3IMFA 5JCJA 3WS7A 4EDFA 4TZKA 4TZTA 4K6CA 4DTIA 1G0OA 3ZWXA 2A94A 1I10A 1QLJA 3HADA 3QW2A 1UDBA 4YB8A 1K6JA 1PJTA 3AOEC 4O5OA 1N1GA 1VKOA 4P38A 4UUPA 5DCUA 1K6IA 2HUNA 2YQ4A 4DYVA 1Y8RB 1X13A 4DVJA 1T1SA 2HLPA 4EW6A 2VHWA 3PFFA 4NFSA 1PQWA 1EE2A 2RHCA 1LRJA 1Q2XA 3GT0A 1U4OA 2XXBA 3JQ8A 3GNTA 4M49A 2GPTA 3MWEB 3DHNA 1DLIA 3DBHA 5HA5A 1WWKA 4ZQGA 4WE3A 4WUVA 3C8MA 4IQ8A 3KVOA 1PS9A 3E03A 1L7DA 1UJMA 4I1IA 1P33A 4CQMA 2X58A 3P7MA 4ZRMA 1R15A 4KUEA 3RI3A 3PDJA 3KEOA 1OI7A 1N1EA 1R4MA 4FC7A 4I8XA 3UW3A 1NM5A 2O3SA 4QX6A 9LDTA 2JD1A 3E1KA 1WLYA 1GYQA 2BI8A 4ZHSA 1SB8A 2PLAA 3INRA 2UYYA 1UP6A 2X0JA 4OKIA 1RKXA 4DBVO 4A2CA 1DC5A 4JXKA 2PWZA 4BIIA 3AOEA 1H6AA 1PWXA 3OP4A 2P9GA 1F17A 2DQ4A 3I23A 4FFRA 5BT9A 1U1IA 2GUGA 2VUSA 3RFXA 3PK0A 3WJ7A 3BYZA 3UHAA 2BMAA 4R3NA 1UXHA 3JQAA 1JA9A 2ZKLA 1SEVA 3MJ4A 5L7YA 4ZQEA 1KIFA 3RUEA 3VC7A 3MJEA 2BFMA 5ITVA 5CDUA 4RVHA 5TQVA 2PKQO 1MUUA 1TI7A 1YBMA 3RC9A 5EJ2A 4BQPA 4CR6A 1P3DA 4XRRA 4R16A 1BW9A 1B8UA 1BXGA 4MVJF 1VPDA 3H9JA 4KQXA 5ENDA 4P4LA 2NADA 1WZEA 2JAHA 5TJHA 4A5OA 2ET6A 5LDHA 3FRJA 1C0LA 1I3NA 2B0JA 3M2TA 3K31A 2P2SA 3UXYA 2I3AA 1U2DA 3I4CA 4BNVA 1LEHA 2O4CA 4R68A 1EDZA 2NTVA 4G81A 4F45A 1QP8A 2DPHA 1U3TA 2C7GA 2EKLA 4UVIA 5G0VA 1GU7A 3DHYA 1ZK2A 4UAGA 5G0WA 1UP7A 4I5GA 5KKCA 2GERA 3QQPA 1LLCA 4YPOA 2VWHA 2IEDA 3KB6A 4GMGA 3JQ9A 1ZFNA 3RC2A 4DIOA 2D5CA 2G1UA 2GN6A 4OHUA 1E92A 4C7JA 5A9SB 4ND3A 1RM0A 3FD8A 3LC2O 5KNLA 2PKQP 5TF4A 1CQJA 2ZTLA 5IDWA 3O9ZA 1C0IA 3DC2A 4W99A 3I9KA 5A03A 3LT0A 2B36A 5DDIP 3BHIA 3F46A 5C7LO 5B37A 5JW6A 3DONA 1VL8A 1P0FA 3IP3A 4NK4A 4E2XA 4B7UA 3TZCA 5JE8A 2FMUA 3KYDB 3OIDA 4ZVVA 1GZ3A 3HG7A 1C3VA 4PRLA 2EJVA 1FDWA 2AG5A 3FWNA 3DZKA 4NNJA 4A10A 1ADBA 1DIAA 2HAEA 4YDRA 5JO0A 1DB3A 2HO5A 4FFNA 4BNYA 4D43A 2HMUA 1O0SA 3JD0A 2Z95A 4OQYA 3LYLA 3OJOA 4CR8A 1EFLA 4NBVA 4TWRA 2W2KA 1BWSA 5DN9A 4QUKA 4PG5A 1HDGO 2EXXA 3P5SA 4TRNA 1OZAA 4XJTA 4WLVA 4QEDA 2BFPA 1E3JA 3ZWAA 3PLRA 2DC1A 4GX5A 1IULA 1HZZA 4XWYA 1ENYA 5B4TA 5C5IA 4LCEA 2DKNA 4QFDA 3DAPA 4ONEA 4CLEA 3SJ7A 2WYVA 4E33A 3ZGYA 4F3YA 1DSSG 3GEGA 3QVOA 3W4JA 2PGLA 3B6ZA 2A92A 2I67A 1C0PA 2WMDA 5C7OO 1IL0A 1MFZA 3AJRA 1ISIA 2JFHA 4YRAA 2DM6A 4R5MA 1R16A 3I6IA 4J7UA 3BA1A 4CL8A 1A72A 1ISJA 1QMGA 1B8VA 1PGPA 1LNQA 4YEDA 3DTTA 3QVTA 4J3FA 3DZGA 5A5EA 2WYWA 2P5YA 2P4QA 5GY7A 4OGWA 1P45A 2AHRA 2BFAA 1DRVA 2YHUA 4D3FA 2XOXA 3NKLA 3KSUA 4KWHA 2WTBA 3D3WA 4JCOA 3H2ZA 3P19A 4NFYA 1S7CA 5T64A 5C3MA 3WICA 1YONA 2AMFA 4NZ9A 1X1EA 3X2FA 5DF1A 3A4VA 3BIOA 4CL3A 1Z7BA 4BNLA 4BB5A 3P2YA 3RUHA 1ZKMA 1NVTA 5JLAA 1IZ9A 1WVGA 1CRWG 1SB9A 2EV9A 3DOOA 3WQSB 1PS0A 3G0OA 4PLYA 1YBAA 1RM5A 2BGMA 1PQUA 2DBZA 1NQ5A 4PVDA 4KTVE 1X7DA 3H9EO 2VHZA 1NQTA 3PQDA 4XD2A 4XQEA 1BW9B 3EUWA 2AE2A 2V6GA 4J7XA 3TL3A 5T5QA 1B7GO 3V2HA 4G5HA 2ZQZA 5A9SA 4DC1A 3PJFA 4FGSA 1NR1A 2EGGA 4J2HA 3C3XA 3U9LA 1IY8A 4J4BA 1A4UA 4R9SA 3I6QA 3E18A 1FDTA 1E3IA 1NHGA 1WXDA 2V65A 1H5QA 3ASVA 4LGVA 3STHA 2G0TA 4M89A 1TB4A 1MXHA 3H5NA 1HYHA 1H2HA 3S2FA 5I7VA 3NT2A 3EZYA 3IJRA 2GGSA 4N7RA 1R66A 4PLVA 1ZSNA 3G1TA 3RWBA 5I7FA 1H9BA 3I5MA 4DPMA 2AEJA 2GLXA 1BXGB 5C37A 4DA9A 1DO8A 3LLVA 4YBZA 4KDEA 4KUGA 1U2GA 4BOYA 2PZJA 3OIFA 2Q1WA 5U1PA 4E32A 3FNHA 3OM9A 1OBFO 2SCUA 1BDBA 4FFPA 5T57A 1Q7GA 1HLPA 1PJCA 3ZV3A 4GVLA 3LT1A 2OBNA 5BSFA 1K89A 5ER6A 1DFGA 1E7MA 2RCYA 5CDYA 1R4NA 1LC3A 3GAFA 5JFOA 2V6BA 3UGKA 3MJTA 5KJ1A 1E1NA 3AI1A 1LLDA 1GTMA 3CPSA 3MEQA 1WDKA 2AEFA 4FBGA 3DBLA 2X23A 1ONOA 4XJSA 2OGUA 4FFOA 1IPFA 2E6UX 1I32A 3VVCA 2Y99A 3PGXA 1HRDA 4D0RA 3Q1LA 1UDAA 1K0UA 3HDHA 4BQRA 2AQKA 4R1TA 4PLWA 3JYLA 5GZ1A 3ZCXA 3GH3A 3VH4A 3WYCA 1KVSA 3ADPA 3HB5X 5KKAA 1YQXA 1LBEA 1X15A 4BNJA 4AG3A 3I9MA 3RKUA 4CV3A 5JBIA 4FJ0A 2HJRA 2X8LA 3EAGA 2EW2A 3B1JA 3CEAA 2OXIA 4M8SA 1DIBA 4IS2A 1R37A 4DQUA 4BMNA 3GVCA 4UVEA 4JP3A 3WGYA 1Y8RA 4BO0A 1T25A 1E7SA 1U8XX 1I0ZA 4W4TA 4XB2A 1CERA 3JQEA 5EINA 1DLJA 3PPIA 5EERA 3JCZA 4W82A 3N7UA 1BXKA 5KJFA 2QRKA 3GGPA 3MJSA 2OP1A 3PZBA 4ND4A 1CDOA 1RJWA 4WLNA 3PYMA 4CV2A 2DBQA 1JW9B 3MZ0A 2O4UX 4RVUA 1ENPA 1EUZA 4BKOA 2OP0A 4KZPA 5LDGA 4BGIA 3RUDA 1ISFA 4XRGA 4GLLA 1VJTA 3K6JA 3OQ1A 1UZMA 3WFIA 3GFGA 4H16A 2OBYA 4E31A 2RBEA 1NWCA 3WB9A 2R00C 1GZ4A 3O03A 5TSDA 4BGVA 4LW8A 1O9BA 1UAYA 4M54A 4DC0A 5IDXA 1A71A 2H6EA 4FIZA 4R41A 1DPGA 2CVQA 5TGDA 4B8WA 1BSVA 4BB6A 1H93A 4UREA 5IN5A 2Q1UA 2CFCA 1FDVA 5JDCC 1IYZA 2GSDA 2ZYDA 3GVIA 3GG9A 2EF1A 3WOHA 2Q99A 3BTUA 3IOYA 1H94A 3ORFA 2Q49A 4OM8A 4JN6B 4MVJI 3RFTA 5CFZA 2O3RA 2VUTA 3GMSA 4NG5A 3UAGA 4B4WA 4IGFA 3DOJA 5A02A 4DYDA 3D4NA 4RLHA 2QYSA 5CPBA 3OETA 4B3HA 1YJ8A 4WOKA 3KZVA 3WTBA 4QECA 2PFGA 1DIHA 2YV3A 3HZZA 3GF4A 4RJTA 1DFIA 1ZIDA 5HBRA 4EEXA 1GV1A 1YXMA 4TQGA 4BKPA 3F47A 1UZLA 4JLWA 1T2EA 1U9JA 2J5QA 5H83A 1WZIA 2CZCA 4UVDA 4FFLA 1H2BA 1XU7A 3X2EA 5JS6A 5K9ZA 4BNUA 3KYDA 2YZ7A 3VZRA 1E1LA 1KEVA 2GZ3A 3S2GA 1HYGA 1PJSA 4WLEA 1DIRA 3VPGA 2VZ8A 1DDOA 4NI5A 1H6BA 3R6DA 4ALNA 2OFPA 3ETEA 3W8EA 4BNIA 1VJ1A 5KJEA 2FP4A 3ADOA 4YT8A 4Z9XA 1Y6JA 1PX0A 1D3AA 4UULA 4MIEA 4E2ZA 1WW8A 1CJCA 5TIIA 5T67A 2NVUA 1PGJA 1PL8A 2HRBA 3E6AA 1NFFA 3NTQA 4WOJA 3L4SO 3H9GA 1Z45A 3MOIA 5A4DA 2AA3A 3OSUA 3UUWA 4B4OA 4R01A 1G1AA 1SNYA 3D5TA 1GY8A 5L3ZA 2CD9A 3GVPA 3WSVA 1YVEI 2VQ3A 3AU9A 3GA0A 3PJGA 3L77A 5AXBA 4MVJP 4DGSA 2PZLA 1SOWA 2B37A 4BGEA 3ZNOA 3GAZA 2Y0EA 1UXGA 3TZHA 4GMFA 2NU8A 5AXAA 3GUCA 4AJIA 3WR5A 2YDXA 2CMDA 4RQUA 1M76A 1RM4A 5GMOA 5H81A 1X7GA 1XG5A 4GGOA 2AG8A 4G2NA 4RF2A 3H9QA 4LMRA 3U4DA 4CLRA 2EEZA 2P91A 3GLQA 3I52A 4IGEA 2VOJA 4WCFC 4WEQA 1E77A 3TZQA 2EKPA 2GN9A 3AOGA 4NK5A 1U8FO 4Q3EA 3KETA 5JMWA 4BKQA 4B8ZA 2IXAA 1LDNA 2P9CA 3KTDA 3Q0EA 2HMWA 5FYDA 3CZMA 3ST7A 3S2IA 3L4BA 4XA8A 4IDDA 2JFFA 1MXFA 2Q1TA 4RQTA 4FPXA 1ADGA 3JQFA 1N9GB 1E3WB 5JDIA 1SCUA 4MO2A 1PJLA 4NJMA 1ZBQA 2PZMA 4AFNA 1A9YA 1V3TA 1GYRA 4W9NC 4PLHA 2AEMA 5CHEA 1XGKA 3VPSA 3PJDA 1PZGA 3F3SA 3UCEA 4RGBA 1ZK0A 1F14A 3W8DA 3ZU5A 5G4KB 3F9IA 3IC5A 2E4AA 1A7KA 4YJDA 3RU9A 4CMKA 3Q9UA 3GZNA 1KEWA 2PA3A 2YV1A 4HP8A 4I9NA 4N5MA 3I9OA 2FPGA 1H9AA 1C0KA 3N74A 4L74A 5L45A 5ER9A 1YL7A 2D59A 4WLOA 4QT0A 2YHIA 3W1VA 3TF5A 1E7YA 4U6QA 1PWZA 2O23A 3KEQA 4WLFA 5CEEA 4IJKA 1TXGA 4OJNA 3FWZA 1C1DB 1I30A 4J91A 3QWIA 4AICA 3PYXA 2I99A 2W2LA 4ALMA 4R51A 2FPIA 1GUYA 2B4TO 3EC7A 4RL6A 2C20A 2Y05A 5ES3A 2Y93A 3PHHA 5AQ1A 5JXWA 3BTSA 1JVBA 4FN4A 4D3SA 1HE3A 3AI3A 3E8XA 1NVMB 3RQSA 2I5PO 2CF6A 1EVJA 2VNSA 1HDZA 3ZWMA 4IDGA 1SPXA 1QORA 1JKJA 4PFJA 1T26A 4Y9DA 1LSJA 4BGUA 4B3JA 2H1SA 1N9GA 1VSUA 3TFQA 3V5NA 2ZQYA 5A3JA 2W2KB 3QWAA 5CPFA 3ZN2A 1GCUA 5TT0A 1PQPA 1MP0A 1P44A 4WEOA 1GQ2A 1DEHA 2OO5A 3HQ4O 2WWRA 3A9WA 3ITKA 4Z9YA 5BQFA 3EGOA 5TRTA 2NNLD 4CM9A 1DJNA 2UV8A 4CQLA 3WWZA 2ZYGA 3SJUA 3SVTA 4XR9A 2VRCD 4YJFB 4XYLA 2HSDA 1YDEA 4PZEA 1IPEA 3ABIA 1D1TA 2J3IA 5COAA 5HM8A 3BMOA 2ZCVA 4E2YA 2I9PA 3AM4A 4XDYA 4I9UA 5DZSA 1RYDA 5L7WA 1ZK1A 3B1FA 4WCDA 1QV7A 2DLDA 3NAQA 4CUKA 3DFZA 4XX0A 3V8BA 1O89A 1O95A 1TT7A 1MV8A 1YE3A 2DFVA 4WNIA 1AN9A 3NDJA 4TROA 4CM7A 1Y5MA 3RJ5A 5EMHA 1B3BA 4Q9NA 3BHJA 4E2WA 3TWOA 2WDZA 2NLOA 3HFSA 2JD2A 1QYCA 3WGGA 4ND5A 4PG6A 4B4UA 2JHGA 4YACA 2NU7A 3OHSX 4FCCA 3VOSA 3IQDB 2IE0A 4MP8A 4ZU3A 1H0KA 1ISHA 3LDHA 3ANLA 4GGPA 4HADA 1GD1O 3NT5A 1IE3A 1U3WA 3WIEA 3WYBA 4TKMA 4MKZA 1T2DA 3PYLA 4NR0A 1I33A 1IOLA 3QP9A 2HQ1A 2DTEA 5JC1A 2J5KA 1KETA 1LDEA 1LU9A 1Q7BA 3AUSA 4XZ3A 5IDQA 4XR4A 1Z74A 4QFCA 1EBFA 4MVJH 3ZDFA 1W0CA 2NVWA 2X1HA 2IZ1A 1E5QA 2BFOA 3OA0A 4MVJG 4GI2A 1JAYA 3MJCA 1LUAA 3VAZA 2HU2A 3DEYX 3NYWA 2CY0A 1ADFA 1T2CA 3KUXA 3TSCA 3LQFA 1AHIA 4OOEA 4OOFA 1U28A 3FHLA 4OQZA 3GPIA 4Z3KA 5JAZA 1PL7A 2Q45A 1LA2A 2CSUA 2IXBA 2WE7A 4A7PA 1ZSVA 3HWRA 1Q7CA 2JCYA 1ONNA 5G4LA 1I36A 2C29D 4BHTA 3ICPA 4IJVA 4U7WA 4EYEA 1VSVA 4HKTA 3A28A 4YRBA 3OBBA 4FJ1A 3JQAD 1XU9A 1EVIA 2EG9A 3W6UA 3DMYA 2CDCA 1RM3A 5DOVA 3UFXA 3OMLA 2HMSA 3WYEA 1MC4A 2C82A 3DBRB 4W7HA 3AFNA 4LSMA 3HFGA 1WDMA 4J1SA 2C2XA 2E82A 5KOIA 5I9MA 1GAEO 3RASA 1HDOA 4W9NA 3V1TC 2JCXA 3ZHXA 5FWNA 5IG2A 4GSLA 3DXFA 3NT4A 4AJLA 2PH3A 1XCBA 3T4EA 2O3UA 2X6TA 4AVYA 5IXYA 2DTXA 5FI3A 3VDQA 4R9RA 4WCFB 1PGNA 4E5NA 1I2BA 5KCZA 3I4FA 4N18A 2Y67A 3UF0A 5CG2A 4MP3A 4O1MA 3GRKA 2HCTA 1I2ZA 5I7SA 2RHRA 3JQ7B 1ML3A 3KSZO 3TZ6A 4YTEA 3MOGA 1UR5A 2PGJA 4F6CA 1SO8A 4Y6RA 1P1HA 1E6UA 1LXCA 1NHWA 2DPGA 2UDPA 3NX4A 4IINA 3COSA 4Q3BA 4RF4A 3SC6A 3VHRA 4P4NA 2D8AA 3GHYA 2G82A 1BVUA 5JPIA 2LDXA 2ZCUA 2EP5A 3PTZA 5I7EA 4BS9A 4IPTA 1J0XO 1EK6A 2WD7A 2EW8A 4U0JA 1GCOA 2X9NA 5L4SA 5FFFA 4DIBA 1GFSA 4JBHA 1MC5A 2O3QA 4BO7A 5A9TA 1GR0A 2WM3A 4HXYA 2W4QA 3TNLA 3U0BA 3GGGA 3QSGA 4II3A 3JQ7A 4ZQFA 1X0VA 3NTOA 2Q2QA 1ZW1A 2IYPA 3U4CA 2B4QA 3E5MA 1DRUA 4BO5A 2HDHA 3H2SA 4Q3DA 4HX5A 4XQGA 4J4HA 3FR7A 4XGIA 5CG1A 4XCVA 3TOZA 3AW9A 1A9ZA 3F6YA 4PLGA 1J5PA 3RC7A 3DMTA 3IKTA 4JBIA 3GR6A 4U0KA 1HF3A 3H3JA 2AE1A 2NWQA 5IXSA 3JYQA 2VHVA 9LDBA 1PU2A 4FS3A 4EGFA 3RSHA 2GYYA 3NDIA 3KM0A 3H9UA 4HBGA 5I9NA 5JNLA 5T6BA 5EN4A 4DBZA 4RCVA 1NASA 5CP8A 3PLNA 3JYOA 1HDYA 3CXRA 5AYVA 3WBFA 4MDHA 2PKRA 4FDAA 5KWEA 2ILTA 3H65A 1WAMA 1F06A 3TJRA 1Z7EA 1E3LA 1XKQA 1J4AA 4CM4B 1LSOA 2BD0A 1YO6A 1QSGA 1JVSA 1GZ6A 2YUTA 5DBIA 4CLOA 4MIYA 2PD6A 4YAGA 3RAJA 1R0LA 3WSWA 2FR8A 1PR3A 1YB1A 2I76A 2X0NA 3I9LA 5KVQA 1YGYA 1JLLA 1V0JA 5F1PA 3VH3A 3T7CA 2UUOA 1LDBA 2VZ9A 4AJ4A 1J6UA 2W90A 4YA6A 3W4KA 4DQVA 3HE3A 3QVSA 3IUSA 2AQ8A 1M67A 1P9LA 4BL5A 4RPLA 4E21A 3O26A 4E5YA 4R54A 4DIFA 2GD1O 4P4GA 4R1NA 2AXQA 4Z0PA 3LVFO 4FOSA 4OYRA 4ID9A 4CMJA 4BMSA 4CMHA 3D64A 2FY8A 1NFQA 1LDGA 4NH4A 1KEPA 2WYUA 1FF9A 2E37A 3I9NA 3UN1A 1NXQA 1NAIA 3B70A 3DTYA 4AJOA 1R6DA 3WQQA 4J16A 4B4VA 1Y81A 1BVRA 3U49A 3OECA 3WMWA 3BXXA 2Y68A 3QHAA 1Y1PA 2ZB4A 4BV8A 5L4LA 2UVDA 4PLZA 3IP1A 3Q9NA 1JN0A 3VZQA 4BO1A 1T1RA 1ZSYA 3B1KA 5GZ3A 3LT4A 3UOGA 2P5UA 2BGLA 2ZYAA 3LZ6A 4ZA2A 4C7KA 8LDHA 4Y98A 3JD4A 4PZCA 3TFOA 1TLTA 2O3TA 3W6ZA 4K1LA 2FSSA 4H15A 2CDAA 4QTZA 2ZATA 3CH6A 3PGJA 4RVGA 1SBYA 1VI2A 3DAGA 1U7HA 2F00A 1YQDA 3Q3CA 5JAMA 1U3UA 2F1KA 1E6WA 3K30A 2I65A 2B83A 3ETGA 4RVSA 4ROSA 3WGIA 3WGZA 4AJ2A 1XIVA 1HSZA 1HKUA 2TMGA 2YJZA 1LQUA 4RPGA 5JMPA 3NDRA 1GADO 4LSWA 4D79A 3PWZA 4PG8A 1AE1A 3AI2A 2X86A 2P4HX 1GV0A 1GQQA 3G49A 2O48X 1PJ4A 4O63O 2Q1SA 4K28A 4MIOA 4NIMA 3ZI0A 4LK3A 3ZNPA 5TJ9A 4YYZA 4RVDA 3ROKA 4ALJA 2EKQA 2Y1CA 4NJOA 4IXWA 3AUAA 2X0IA 5EIOA 3QWBA 2EERA 2ZJ1A 3MJVA 3OEWA 4QO7A 3LU1A 5COBA 4YAIA 1VL0A 4BVAA 5ILGA 4GKVA 4NU5A 3ZHBA 2J8ZA 3DAFA 3OF2A 4PRKA 3D5QA 4RV9A 1EQUA 2OORA 1PJ3A 3VZPA 4BNZA 3QVXA 3RBZA 3PRJA 4J1TA 4YQYA 2AW5A 2QZ9A 4YAEA 5TLSA 1A4IA 3RD5A 4JGBA 1E5LA 2IZ0A 3C7DB 2DVMA 2FN7A 4HFJA 3VVBA 5MGBA 2PV7A 4UVHA 1GUFA 1MX3A 3MWDB 1N5DA 5ICSA 2Z5LA 3K9QO 3WIDA 1P1IA 1ENZA 1RYEA 3D1LA 2DBRA 1QXSA 3V2GA 4EUFA 4FQ8A 1B2LA 1F8GA 1WDLA 1EMDA 1EUCA 4PG7A 3DZFA 1KC1A 1Y8QB 1MGOA 3JQGA 1TEHA 3UKOA 1LRKA 3A1NA 4EBFA 2VRBA 5F1OA 7MDHA 4WKGA 3KRTA 3JD3A 2Y0CA 3VTZA 1EBUA 1EUDA 1Q1NA 4URFA 3JYNA 6ADHA 3WXBA 4HNGA 1GUZA 1XDWA 3FCOA 2GZ2A 4IMRA 4I5FA 4L75A 4WLUA 4II2A 2HK7A 4CM4A 2A9FA 3PJEA 3OEYA 4XKJA 4CLXA 4NPCA 1VM6A 2NTJA 3C1TA 3WGTA 3AM5A 4CM1A 2IYOA 1IZ0A 2LDBA 3GNSA 3S55A 3OJEA 5JYDA 1B8PA 3ZHZA 5KJ6A 1ZMOA 3ZZNA 2H9IA 3GQVA 4PLCA 3JQBC 1MB4A 1ZUD1 2X7HA 2J5RA 1YWGO 3ANMA 3P2OA 4EJ6A 3BMNB 4DLBA 1QG6A 4WK6A 4YCAA 4IDEA 4CM6A 5F5LA 1WMBA 3PIIA 1IHXA 4J4TA 3SBOA 3ITDA 3NGXA 1ZJYA 3A06A 5BSHA 3JQCA 3SLKA 2YFHA 4GSKA 3ZV5A 2CVOA 1PL6A 3ZU2A 2TMDA 3ZV4A 2AQIA 4CMEC 1WNTA 4NMHA 2C59A 3RUFA 1QKIA 2ZTUA 2HRZA 3HDYA 1W8DA 1ZJZA 1NFRA 2XPCA 3EVNA 3K73O 1LRLA 5GZ6A 1I8TA 3JQ6A 3VPHA 1YRLA 3ZNNA 4DL9A 5JYEA 1ULUA 1BG6A 1P77A 3RVDA 4CMIB 4IJWA 3VPFA 1ONPA 2X5KO 2GRAA 1DJQA 3JTMA 3FBTA 1GQYA 3BAZA 3UVEA 4KDFA 4ZD6A 2CF5A 3BZUA 2IZZA 3GFBA 3QJ5A 2JFGA 2PY6A 2PR2A 4IS3A 4GBJA 4ZN6A 3IUPA 4HFNA 1EDOA 1LLUA 3DOCA 4IXTA 3F4LA 3DZJA 4E12A 4JJFA 4P22A 5I8WA 5KTKA 2Q50A 4YJHA 3OQ6A 4Z3DA 2WJPA 1XYGA 3OIGA 1LX6A 1ZXLA 4RPHA 1M66A 2GN4A 1UXIA 3O8QB 5A3VA 1E7RA 4JIGA 1JU9A 3G17A 3IDSA 1L1FA 4XYMA 5DP2A 2HKIA 4IMPA 1UXKA 2VTEA 1V3VA 2ZB8A 1EK5A 2NVBA 4BO8A 5BNIA 2DUUA 3DB2A 3M2PA 4D41A 2D2IA 2DT5A 1UAGA 2FHSA 1QV6A 3AUUA 4JBGA 4TRJA 1HL3A 2P68A 1RWBA 3H5RA 2DBVO 4IZIA 1YS4A 4D0SA 1I3MA 3G3EA 5G4KA 1YJQA 4OAQA 3VH2A 4WGGA 1R4MB 4DREA 4FB5A 1Y7TA 1O5IA 3RJ9A 2VWGA 3NGLA 1YKFA 3ENKA 3ZV6A 4GAEA 4BUCA 1D8AA 2XXJA 3A14A 2V6FA 5HTOA 1ZVMA 4XQ9A 2B5VA 2C07A 3FNFA 3WLEA 1DC6A 1Z75A 3OFSA 2J6IA 1G6KA 1T24A 2O2YA 3LLSA 1JWAB 2X5OA 1I24A 1PR9A 2YYYA 3PHGA 3D3WB 1QYDA 2VCYA 5T8KA 5B1YA 4J6FA 3TRIA 4J9VA 4AJPA 3CSDA 3QE3A 2R2GA 2D5AA 4RORA 2FWMX 1NNUA 3ZNQA 3GY0A 3UICA 2V7PA 4MOWA 3U4IA 1T2AA 3JQDA 1Y8QA 1C14A 3RBVA 3BTVA 1YOVB 3IJPA 1W4ZA 1MG5A 1O8CA 1YQGA 3W8FA 4D42A 3FN4A 5EESA 3AFMA 4B7CA 3WX0A 4H3VA 3OJ0A 4B79A 3RKRA 2VUUA 4O59O 1DIGA 4RPJA 1NQAO 3NEPX 1JKIA 2X9VA 4KUHA 3H5AA 1IHYA 4E30A 2EP7A 4NBRA 1KOLA 2PD4A 3LSYA 1FXSA 5IN4A 4AJKA 2Q4BA 1JAXA 1KY4A 3GGOA 3CKYA 4JNKA 4PG4A 4J7CA 2PGDA 1B0AA 3EK2A 5JSFA 4DPLA 1VC2A 3E82A 2UAGA 4GWKA 4LN1A 5L95A 1SC6A 3VTFA 1IB6A 3G1UA 3AY6A 4D7AA 1BHSA 4K6FA 2XAAA 3E48A 1EVZA 2RAFA 5FI5A 4MKXA 3VDRA 3PDUA 3CUKA 3ANNA 2ZB7A 5IZ4A 1KY5A 3BMQB 3EW7A 3WLFA 1QYWA 1ZEJA 5L51A 5DULA 4D45A 1D4FA 2CVZA 4D3DA 2J3HA 4O0LA 4B7XA 3ROQA 4BNKA 4Y67A 5IAAA 4LISA 4HUJA 2W2LD 4OL9A 8ADHA 1HETA 3DBRA 4UUNA 4EITA 2NU6A 2W98A 4ALLA 4A0SA 3JYPA 3L9WA 2BLLA 2H63A 4CLHA 5JY6A 1K6XA 4MP6A 1JWBB 1Z82A 2QQ5A 1YH3A 5HS4A 3K5PA 2RIRA 5EQFA 3WFJA 3NJ4A 1DXYA 4YXFA 1I5RA 2ZTMA 2POQX 1UDCA 3WBBA 3WWYA 2VNAA 1DHRA 5I8ZA 3GN1A 4DPKA 2VWQA 4MJLA 2NV6A 2GO1A 2Y1EA 4CQMB 5DOZA 1JTVA 1SEPA 4CV1A 4CPDA 2A35A 3RU7A 1R0SA 1XSEA 4AL4A 5COQA 3KYBA 3QIVA 2VN8A 1JQBA 2VWPA 3MCVA 3O8QA 5THQA 4L73A 5JCXA 4GWGA 3S1LA 5ICMA 4YWJA 3H6KA 1GPDG 2E49A 5TX7A 4PVCA 1L7EA 5JY1A 1KVQA 2Q2VA 2VYVA 1E7WA 1NP3A 1P1RA 1JDJA 4GX1A 4CUZA 1FJHA 4GX2A 5KJCA 1ZO8A 1YL5A 4JP2A 4J90A 4BO2A 3ZWOA 2PZKA 4PZDA 2VYVD 3AY7A 3H8VA 3F5QA 4CMCA 1HDXA 2NACA 4EUEA 4L76A 4ILKA 5CEFA 2XF8A 4U5QA 1UP4A 2BHLA 2Y1FA 1I3KA 4QSMA 3RCBA 1CEQA 1PGOA 1R0KA 3DFUA 3JD1A 4EEZA 1NTOA 3NJ8A 3WTCA 3QRWA 3RUCA 3U09A 3CINA 1OOEA 2QG4A 2FR0A 4AJ1A 2GASA 4RF3A 3T7EA 6LDHA 5EQDA 3FI9A 3FNEA 1PZEA 5I9LA 2CNBA 4JK3A 3L07A 3ZWCA 4GLOA 1OC2A 2JKVA 3M1AA 1E6EA 3E9MA 4MPDA 3B20A 3L6OO 1TT5A 2PH5A 4YAKA 3U4HA 3D7LA 3RIHA 5H82A 4NHEA 3MTGA 4OXKA 1KVTA 4CLRB 1VRWA 4E5MA 5BSEA 3PEFA 1DBVO 4FC6A 2G76A 4IDAA 1D7OA 3RFVA 1TVEA 4R4JA 4R5HA 3TL2A 1ZCJA 2Y66A 2YHIB 4LMPA 3F1KA 2IDZA 3GDOA 4ND2A 5LCXA 4ZICA 3GPDG 3RUIA 3BMCA 3PHIA 3Q2IA 4JJIA 4YJFA 3H3FA 1SOVA 4IDCA 2YY7A 5AXDA 1A5ZA 1LQTA 3GOHA 4I5DA 5G0TA 3SEFA 4BMVA 1KS9A 3DBHB 4IJUA 4IBOA 2J3JA 4PLFA 1V3UA 1NWHA 3ZWPA 3OQBA 3IAHA 2EHDA 4M87A 1DC4A 3R3JA 2Z1MA 3JQGB 1Z6ZA 1MLDA 2QZZA 3PP8A 4XEHA 1EE9A 4CV0A 2WD7B 1N8KA 4J1QA 3ZW8A 2JJYA 3ETDA 1AXGA 4IZHA 1VL6A 5THKA 4YJGB 3AK4A 3K2EA 1EEHA 4YT2A 1WMAA 5ENVA 3ZWYA 1V35A 4FOOA 4MKRA 4PCVA 2E48A 3L6EA 4RZIA 4MVJD 5L7TA 4QXMA 3G79A 2YV2A 4IQ0A 1DAPA 4N5NA 4A73A 4Q3NA 1Q0LA 3PQEA 3L6DA 3TQHA 1B26A 3AWDA 1FMCA 4DLAA 2VYNA 3R1IA 4EZBA 1AGNA 4BNXA 4CR7A 4XYEA 2O3JA 1KBZA 1Y5RA 2Q3EA 3N58A 4GH5A 5DBGA 4Q39A 5ADHA 3KLPX 2WEKA 4ZQHA 4BO9A 4W7IA 4IY1A 2JD0A 1XWFA 4CQLB 3L0DA 5B4VA 1U3VA 2GZ1A 1OFGA 4XIYA 2GCGA 4WECA 4J49A 1XELA 3EMKA 4EJMA 3C24A 4FD3A 4RPKA 1PJ2A 1FDSA 4I9HA 4L8VA 5BNFA 3DBVO 2QRLA 3L9XA 1PTJA 1AHHA 3QVWA 1LDYA 4BO6A 2D4AA 4ZQBA 5IDYA 2VZ0A 3ZU3A 1HE2A 4CM5A 1GL3A 3ZWVA 1DOHA 4FW8A 1B14A 5ILOA 3HN7A 3ZWWA 5BSGA 2JCVA 5JAQA 1DAOA 4JROA 3PZRA 1E3WA 1SMKA 1CETA 2OOSA 3I3OA 3K2BA 4PLPA 5L40A 3LK7A 1E1KA 1ID1A 1PZHA 2HK8A 2VYND 1K3TA 4NBTA 4J0EA 1MFPA 3ASUA 3FR8A 3JQBA 4KWIA 2IRWA 1A27A 4IIVA 1QYXA 5JO9A 3ZHYA 4A27A 4CMBA 3K96A 4NBUA 5DCWA 3IKVA 4GKBA 1LLQA 1NAHA 1HSOA 3WGOA 3PFWO 4XQCA 1Q0HA 5DBFA 1GEGA 1N92A 3DQPA 3ZH2A 5T8KC 1HEUA 1XQ6A 2JHFA 2HMTA 4YAJA 5CDGA 4EUHA 5HWSA 1NPDA 4OXYA 4KOAA 2IODA 4CM3A 2NSDA 4LRSB 4HFRA 4HWKA 5DCYA 1BMDA 2C5EA 3ONDA 1WPQA 3EVTA 3VKVA 5C7IO 5TC4A 4Z9FA 1WP4A 4J1NA 3ENNA 3OA2A 2ZIZA 1PSDA 1GYPA 3FBGA 4Q3CA 4NJMB 1XA0A 1T2FA 2O50A 2OHXA 3ONFA 3JQFC 1KYQA 1BDMA 5L4NA 3E5RA 4INAA 4S3MA 1J49A 3TOXA 4TRMA 4N54A 2EGHA 1T4BA 2OMEA 5TT1A 1X7HA 1LC0A 5CEJA 2B35A 4Q3AA 2C54A 4PLTA 1A7AA 2HMVA 4XGNA 4DXHA 1PZFA 2RH4A 1VKNA 4GPD1 3H7AA 3GVXA 4GQAA 3BMOB 5JAIA 4KMSA 1C1XB 3OJFA 4IDBA 4CLDA 1E1MA 3F4BA 3O4RA 5G2OA 2O7QA 2O7SA 2FZWA 1OC4A 1KVRA 4GVXA 4KP7A 3UCFA 1B16A 1V9LA 1LSUA 3WG9A 5IFLA 4NDNE 1FDUA 4CODB 3O38A 3DDNA 1AUPA 1Q0QA 3EHEA 4XIJA 3QA9A 2GDZA 4ESOA 4HNHA 2A4KA 3CTMA 3GDGA 3GUYA 1PS8A 4O6VA 4XDZA 2BGKA 1HE5A 1E0DA 3PHLA 2DU8A 3QWHA 4RVFA 3EYWA 4RZHA 1TT5B 3Q2KA 2FRDA 1U4SA 3ONEA 4OSOA 2FPPA 1M75A 5DP1A 4ZJUA 4L4XA 2QRJA 5K6AA 3Q6IA 2WE8A 1CYDA 4PGFA 2D1YA 1CF2O 3JQ9C 3DL2A 4L4SA 4X54A 2DAPA 2X5JO 5EL0A 1R4NB 4WJZA 5A5FA 5EPOA 3INTA 3JV7A 2HJSA 3JSAA 1UH5A 1HDCA 3GG2A 5G0UA 1NYTA 3TPCA 4NU6A 2OUIA 2EJWA 1M2WA 1QYVA 2OZPA 5FEUA 3AM3A 3DBLB 1P1FA 3IS3A 3QWFA 3SX2A 3U3XA 2HK9A 5J23A 1ORRA 1ZEMA 1NR7A 1ZZEA 4MVJA 2YW9A 3HSKA 3WJAA 3ZWNA 3NUGA 1Z73A 1ZMTA 1EZ4A 4LVUA 3CE6A 3NRCA 1KERA 2I3GA 3C1OA 3WDSA 4UVGA 1H6DA 3C7AA 2B5WA 3DMTC 3TZKA 4OMUA 2C7VA 2PD3A 3FSRA 4JX8A 4Z0HO 3FPCA 4AJJA 3PWKA 5DT9A 5A9RA 3C85A 4E5KA 2R00A 3KYCB 4WASA 3BHMA 3IL2A 2CDBA 1V8BA 3NV9A 3ZU4A 3JQAB 4DRYA 1HYEA 2GN8A
chains in the Genus database with same CATH superfamily
1WW3A 2HEGA 3KZXA 4KQGA 1MTOA 3B53X 3BIXA 1DV2A 5TXGA 1P4SA 3AH8A 2PH1A 4XWOA 2C7RA 5IZCA 3FYUA 5L8VA 4UEJA 3FTPA 4UUMA 1RPNA 2YJ4A 3WA6A 2V7UA 3KBOA 3ADCA 3K70B 1BH6A 2PO5A 1P2FA 1YI0A 1JG4A 2ECFA 2JIMA 1N6NA 1YZFA 2QYTA 3KO8A 1N3LA 1Q50A 2EL7A 4X20B 3U26A 5AM3A 1NF3A 3AEUB 1FNCA 1SVMA 5AVQA 3IPAA 3GVHA 1W85B 1WW2A 4FVTA 2VHXA 5KTPA 2GNAA 2XIQA 3GXOA 3L7CA 2YQ5A 2RGGA 3C3BA 4KSBA 3WADA 2P11A 1XEAA 4RTKA 2QLLA 3DGFC 4M8KA 1SKQA 4M86A 4XWAA 3UCXA 1B6TA 4JEUA 1SHLA 2O14A 4JGGA 3P9SA 4D9KA 4TLEA 5K0JA 4FR5A 3SC4A 3PA6A 1W85A 1YR8A 3FB4A 3LPNA 1GVNB 1XZKA 4CIYA 5T4BA 3RW9A 3ELWA 4M55A 4S2EA 4O3FA 1QQAA 1GKKA 4URHA 4YCBA 1XLVA 3DT6A 4HGRA 1H2FA 3EBPA 3WGQA 2C5HA 4AXXA 2QL7A 4M7PA 1UBTS 3LFUA 1MU0A 4TXNA 3EZNA 5HJ2A 3KVRA 1QLHA 3FLEA 1S2DA 2FQYA 5KPDA 3ZQUA 2Q41A 4UUOA 4R1SA 1HI9A 2JHCA 1I2MA 4NEHB 4D44A 1G19A 3OZDA 3CEPB 1M73E 4RLSA 4BMDA 2WHRA 2OHVA 4BLQA 1ZONA 1FP2A 3WP0A 4KTTE 1WEKA 4RD0A 4W8OA 1M1ZA 4QASA 1DC7A 2AD1A 5EHIA 3TZBA 4C4SA 4B3BA 1SIBE 1T4DA 2A7XA 2WM9B 4GYYA 3QUTA 4P5DA 2Y71A 3P9QA 5F2KA 3RVQA 4HHEA 4ZHQA 5LP6F 5M29A 2BFCB 1U5CA 4CG0A 3HCOA 2PUBA 3KHTA 4YV0A 3UT6A 2DTDA 3TN7A 5LYJF 2ASEA 4NE7A 4QGGA 4ETIA 1YTLA 1P9OA 2X4GA 1QGOA 3DWIA 4X92A 5GJWC 5JV5A 5L53A 4OJMX 3R3VA 3VR5A 2VTDA 4Q19A 2X22A 4Q21A 2CBZA 5DVZA 4CF5A 1F0YA 5TVKA 1H3NA 3ZWBA 2RGCA 4DLLA 3S8MA 4EHNA 2FB9A 2Y6UA 1PG0A 5EVJA 4IKPA 5ESDA 1K7YA 3RROA 4MULA 1P29A 3KXKA 1DWUA 4BO3A 1K5HA 3TMYA 3GC6A 4LHZA 3ZJ5A 5J3JA 4UZSA 1YDGA 3HN2A 3GJ4A 3I09A 2FOLA 3A26A 1SUEA 1RAIA 2WB4A 4G97A 5A4MS 3IQEA 3HJNA 3A2NA 1HV8A 2CLKB 4YLEA 1MABB 1B15A 1P74A 4R69A 4FFVA 3VPBA 1Y7PA 1E3SA 3IEPA 5F3RA 3ECSA 1VLHA 3IAEA 1ZYUA 4A03A 1ZNZA 1OAOC 2GD0A 2IYQA 1PI3A 4IIHA 4O4LF 2I87A 2IV2X 3EW9A 2HI0A 1L8XA 3KB1A 1Z28A 1SFRA 1G3IA 3HDJA 3FDFA 5F1KA 2NZ8A 1NU8A 1CIPA 3M3HA 2IYYA 3OOYA 1W96A 4OH1A 1RYBA 1ZUIA 4JKYA 5LUBA 5LXTB 2ICAA 2WD8A 3ELYA 4G84A 4MYCA 1YZVA 1KEEB 1ZK4A 4IV0A 4Z2YA 5GIPE 3IT1A 4BNTA 3IPRA 2VSOA 2BEWB 3FYUC 4FUQA 5T4FA 1H65A 2WT8A 4JL6A 3D4OA 1NUPA 4QJIA 1W46A 5AXCA 3OKFA 4HAOA 3WO1A 4ZGBA 1ORHA 3QKSA 4E7OA 1SZJG 3K8OE 3JWJA 5JCJD 1ABFA 1VYTA 1VXOA 4TKLA 4NARA 3UJCA 1D4ZA 3ZXYA 5LL6P 1UMBA 3Q5EA 2I6QA 2NTNA 3PDIB 4Q24A 4U5XA 5ETJA 4LHWA 2IYUA 1KZ9A 3WGJA 2CUNA 1T1JA 4RO0A 1Q3KA 4P54A 4EFDA 2UUCB 1QRTA 1U9CA 3VRHA 3CG0A 5HMMA 3CNNA 4AZSA 3HGTA 3W77A 4OSPA 4EQ6A 1C9NA 4NVRA 3SDSA 1Q14A 2NN3C 4I1SA 5J4YA 3VYSB 2BYTA 5LQUA 4UHJA 3F90A 3HJAA 3I2YX 4I55A 4G4JA 1VPWA 1CDDA 3JWGA 2ZTVA 4WESB 3K70C 3LXMA 3FUWA 3C3KA 2YTZA 3QPBA 2QT1A 1ST3A 5DNYB 2XVXA 3UJAA 3DM5A 4F6RB 1CUVA 4BE9A 2AC7A 3ZIAA 1TA4A 1GFWA 3CZQA 2XGGA 1HG0A 1DDIA 2WSBA 1M5TA 4BNHA 5A71A 4LZOA 5JANA 2FR1A 4R2IA 3C7TA 3ROPA 2OHHA 2CGEA 1LQ2A 4LJKA 4ARBA 4FYJA 1BJRE 3LF1A 3LW8A 4MLZA 4WAUA 4ALIA 4E11A 5K8VA 1THZA 4L0QA 4PM4A 5EFZA 2NQTA 4UE3S 3VOBA 5C53B 3A27A 4HLNA 1LJUA 2FRVA 5INTA 2TYSB 3Q11A 3RDPA 2BRUA 3DO5A 3HXQA 2EQ5A 1RLOA 1P0CA 2E4YA 3H42B 4LKOA 4RGVA 5LB4A 2ISQA 1PG2A 2QG6A 1F4PA 4KQCA 4IFTA 2OA0A 1YBVA 4BNGA 3P0RA 3WHIA 4ZCSA 2YRFA 2J9FA 4G1VA 2OXCA 4F3RA 1SULA 4DY6A 2I8LA 2WF7A 4S04A 4QDKA 3SFTA 3U9TA 2BGUA 3N0WA 2V58A 4YONB 4BATA 1M8KA 1UPUA 2NSYA 1QHIA 3QV1A 1PT8A 4L4RA 4R1UA 4PIVA 1N6OA 3E2IA 4WIAA 1Z4NA 4HDKA 4DCVA 4UCQA 4CKEA 5E9AA 2WTEA 5FPHA 5CNMA 4ERNA 1G5RA 5TQ0A 1KC3A 2QP4A 2FV8A 2XE7A 5FJJA 1RC1A 2ZK7A 1D1SA 1EINA 1F5SA 1VB5A 2I2XB 1WXGA 5A1TA 4N82A 3PUWA 2BKEA 1GZDA 2WF5A 3D54D 1YFKA 2XTJA 3IDZA 3KOUA 4D6YA 4J0KA 3K0FA 5F9MA 4IJQA 1FFCA 1M6HA 4LOJA 2Q62A 3OI7A 4KBGA 3TYXA 5IBPA 5WRFA 2MCFA 3CLSC 2ZB3A 3NFYA 4GPZA 1UOPA 3WL5A 3KLMX 3WMXA 3DWFA 4W5TA 1EK0A 3I83A 4I50B 4P8RA 3ZUGA 2JAXA 3QE9Y 4HS4A 2EFHB 1IIBA 1ZUNB 1FP4B 2O2SA 2XVMA 3MK31 4BNFA 2JI4A 3KFVA 3IOCA 3NOVA 1OAOA 1GARA 2OPBA 3Q87B 1Y9JA 4JP1A 5AOVA 1MT3A 1R5BA 4CG1A 4MKGA 2FEAA 3HUDA 4ZDWA 5B1HA 4Z6KA 3S2EA 2J1LA 2WJ3A 2Z9CA 1L8QA 3KHUA 3NBKA 5FPYA 4DA0A 5KOJA 2QGZA 5CVEA 5F78A 2JLZA 3U1VA 3PEYA 3GHHA 2F43A 5EP4A 3O9VA 3DTVA 2BELA 2E4XA 3H04A 1X1SA 1NX6A 3I39X 5AJZA 1EI9A 4YQZA 5A7FA 4P93A 1T8RA 4GX0A 2QL5A 1IC6A 2YFQA 4LQDA 2PRIA 1HE4A 2X6RA 3DMNA 3QUCA 2VK2A 2BMWA 1VQ1A 4UEOA 3REGA 5FOSA 3ZDBA 1KE2A 4S05A 1BRMA 5FF9A 4MINA 3WNVA 3U7EB 2O2EA 3PT9A 2OG2A 3RB8A 2GPNA 4FGKA 1IUKA 3FTQA 5EWLA 4NQZA 3OKAA 3PHJA 4ZU1X 2PL9A 3IAFA 4JB3A 1Y1KE 2BLNA 2I6GA 4Y1RA 2WZCA 5DGTA 2VH2A 5JMTA 5JRZA 3VKFA 3RUAA 5AUPB 5B6IA 2VHYA 4YUZA 1QC5A 4WNCA 5K01A 3AVWA 4N0DA 4QYIA 2QR2A 3MTJA 4L9AA 3T5GA 3D0KA 3FVQA 4JLOA 5DM70 1PNTA 3CIOA 3FLAA 4D25A 2FPRA 2K7FA 1K2WA 3H2KA 5AKKA 4JJGA 1LI4A 3WLHA 1XZJA 2GBLC 1Q16A 4MGIR 3RIYA 3DEIA 3K8ZA 2FPKA 5KYUB 2G70A 3M34A 4K9DA 2Y1GA 2UZ1B 3BA6A 1IXKA 1N7IA 2YYAA 3U5TA 1L4NA 1LSSA 2AK3A 3AKYA 4ISBA 3N5KA 4J0QA 3BWVA 1VI5A 3DNFA 4HYTA 3MQFA 3CR7A 3OPYA 4MWZA 1O03A 1S2NA 3L0OA 3HV0A 4RWZA 1OBOA 3HCWA 4W6ZA 4MIKA 5KWVA 2QIOA 2WJJA 2J3EA 2JHPA 4EB6B 4K1XA 1CY2A 2H5LA 4BBAA 5JSUA 5CIYA 5JH7A 3NASA 4ZVRA 2NVOA 3SYNA 3ZHTA 1EFKA 2Y0DA 2A59A 1CUCA 2R6JA 3P2EA 3P9RA 1KVUA 4PFSA 2FZ4A 2IQIA 4YQEA 1Y0BA 3ZW9A 3DTNA 3CLHA 4MROA 1OI3A 3GD5A 3DBIA 3NANA 2PTGA 4FXOA 3NO4A 5FCDA 4RDIA 3ZVNA 2ZE7A 3EZLA 3RSOA 3M6XA 1YFJA 4YT4A 3CA8A 2CNLA 5JCJA 2O57A 2X7JA 3RIEA 2QTBA 3BCUA 3F9CA 3QKIA 4FDLA 4LGYA 4F21A 2HLNA 3ZWXA 2OZLB 1E2JA 1EVKA 1JIIA 2X15A 1PJTA 1VHTA 4M0CA 4OP1A 4OB7A 1VKOA 1TZJA 1NVAA 1E9BA 1K6IA 1J0CA 1HOTA 3D43A 4R3UC 2VXOA 1MO3A 4EHFA 1Y8RB 5JI2E 3HYNA 2EATA 3SS7X 4GXNA 1QWSA 2HLPA 4MNTA 5IWCA 4EW6A 4C6HA 3PFFA 3W5UA 4KGDA 5JARA 1EE2A 4WKBA 5JASA 4MYTA 5EWLB 1GN9A 3ZE1B 3CPJB 5KEIA 4D5GA 2P0YA 1A76A 3U4QB 4Z7JA 1DRJA 3HA7A 3KPYA 4TMVA 2IYAA 3WQHA 4CIAA 3I5UA 2CNKA 3JQ8A 1B6SA 2W0MA 4B0OA 4BTLA 2GPTA 1N2XA 4DLPA 4YMUA 4UFNA 1S01A 2DUNA 2IPAB 3JATB 3PWTA 3AGQA 3W5JA 5ALEA 3OLYA 3WK8A 1WQ3A 1OASA 1UMDB 1IATA 2OVFA 2PYZA 4ZI5A 2KSQA 5FDFA 4W1RA 1CRQA 4IQ8A 3KVOA 1RIFA 2AOTB 4O4IF 4DIUA 2IU4A 2IXDA 3E03A 1L7DA 1ECLA 2ZBUA 4GPTA 3NTXA 5CT5A 5I4IA 2B78A 5H8WA 1E63A 4CQMA 1Z47A 1UJBA 4HJRA 3VA7A 3O90A 2VA9A 2WNSA 4KUEA 4ZOQI 2R8ZA 4RE5A 3PDJA 3WMRA 2FUG6 1OI7A 3OBIA 4I8XA 2X0KA 4RGQA 1NC1A 2M6RA 2P0EA 3OLZA 3UW3A 1HEIA 1AZWA 2HCJB 4HB3A 2C0PA 2JD1A 4K8OA 4QX6A 4W9RA 2LBPA 1MHPA 1L5GB 2FX2A 1ACLA 1VIDA 2PLAA 1HMPA 2ZIGA 3OOHA 3ZDQA 1HQKA 3QKWA 4CHGA 4V39A 1ZR4A 4DBVO 4YUAA 2BE7A 3OPXA 2P90A 4Y1RB 5C5DA 3U3RA 1NMXA 1TGVA 2HRDA 2W7TA 2WFLA 3HVJA 2C0QA 2XRYA 4G24A 1H6AA 4DMUB 5ISMA 1A9PA 1ILWA 2P9GA 1F17A 4ZDIA 1DIOB 3I23A 5DHTA 1NP6A 1W0KD 1V95A 5BT9A 1LW7A 3PK0A 3NDBB 1Z6XA 3E53A 3BYZA 3G2NA 3UHAA 3SY8A 1JA9A 2BUBA 4DJDC 1KIFA 5EHGA 3L7YA 4G9GA 4M7OA 1Z38A 3FRHA 1GL6A 4QXOA 2PT6A 1RI4A 1GPAA 4RVHA 5TQVA 1MVNA 1N1MA 2A0YA 3SHVA 2F9MA 3MELA 1MUUA 4DJAA 4E5SA 3RC9A 3ZWKA 4CKBA 2GBFA 4XRRA 1X1BA 1BW9A 3V8EA 2JA2A 5K3AA 5AP9A 2NXNA 2WWHA 5ENDA 2NADA 4EA8A 1VGQA 1ITZA 1A9SA 1SHKA 4P5PA 4BJ1A 3EASA 2FUCA 1EWVA 3LGAA 2ET6A 3D6UA 1DP4A 1OX4B 1I3NA 1TRHA 3Q1KA 3FPEA 3FOCA 2ZZKA 3FUXA 4JUFA 2P2SA 1NDUA 4PPFA 1U2DA 2WAOA 1RADA 4GHWA 2JARA 4KODA 1CZUA 3H5TA 2C9DA 3HEBA 3I8SA 1HFKA 2YHBA 4HPWA 2C8KA 2XCIA 3FDZB 4L0CA 3RVJA 3TRKA 1U3TA 4ECAA 1JLRA 4TXMA 2ZU6A 4HWPA 4LAFA 4M36A 4UAGA 3RT1A 1YTUA 1OLSA 2P2ZA 1UMCB 1JKJB 1VJGA 2IU6A 3DEZA 3I6MA 3NHPA 3VU8A 2AG1A 1M1YE 1U9IC 3GP5A 2GERA 4C76A 5KKCA 1MHTA 4X7RA 1CQJB 1H1TA 1N5JA 2AFHE 2IEDA 4FFBB 4MWDA 4AP9A 4ENPA 5JCPA 2P1ZA 5J2TA 4LF5B 4WINA 3RC2A 1RYFA 5E7JA 3UC9A 2IYLD 2G1UA 3CLVA 5H59A 5IKOA 9ABPA 3G23A 3DE3X 4C7JA 3SSAA 3K6SB 3LQQA 3ZK9A 1EAYA 2I6FA 4HNVA 1C4OA 3W7BA 2OHFA 3E4CA 5TF4A 1XJ5A 4M46A 3S44A 5LMZA 4C7OB 4B5KA 4HDOB 4B83A 1XMPA 4KIGA 3CVVA 3IQHX 3O95A 4LXHA 3F46A 5BYBA 1Y1RA 2ONJA 3EEOA 1XTTA 4JBXA 1T0HB 3PCTA 3HN6A 3M9XA 3TZCA 3D3NA 5FOTA 3KYDB 3GW8A 4NCJA 4IYRA 4BB9A 4O2AF 4M1KA 4DJFC 2L42A 2Z2ZA 3I28A 1E64A 1P0PA 2EJVA 3L7MA 2C1EA 4LA4A 4NJEB 1QDEA 4BEWA 5JO0A 1ADBA 3C5HA 5TPZA 3TDMA 1JIJA 1STOA 1BHO1 1PHRA 4YPVA 1VSTA 1BN7A 1R0ZA 3D6FA 1QB8A 3IUQA 4M3NA 1I6MA 2ACEA 4EO4A 3LYLA 4LI0A 1E8DA 2NTEA 3EXHB 3QXJA 1KO1A 3EZ6A 3LRPA 1SHTX 4GMHA 5KHLB 4P3XA 2VQ6A 4QUKA 4Y2RA 1GCAA 1RRKA 4TRNA 4A1OA 4ZVUA 1EVLA 1QDUA 3AFGA 1RE1A 2IK8A 2BFPA 3R7FA 5B2EA 5JVDA 1ZG3A 1KJJA 3PLRA 3ZWAA 1R9NA 2JGMA 4GDMA 4PCAA 4ZJYA 1DKRA 2FX5A 2P1RA 5BR4A 5B4TA 3AEUA 4KXLA 4LCEA 5CA0A 4B8YA 2YOHA 3PUJA 1GG2A 3F78A 3R7WA 3GT3A 4DB4A 1NI4B 4E33A 4LXQA 4F3YA 1VBMA 4OLFA 1DSSG 3GLHA 2WUVA 2IGBA 3B6ZA 4EVSA 1WO8A 5EGNA 2VZEA 3F74A 5SZIA 1ABEA 4EPYA 2JI9A 3H5OA 1G41A 4D4MA 1VMDA 3RRZA 4FGLA 5CVCA 1YMUA 1OXUA 4BP8A 5FLEX 4AP5A 4DA8A 2ZIVB 2DM6A 2OV6A 3I6IA 4YRAA 3FDXA 4J7UA 2P0AA 2RHBA 3BA1A 4XGQA 1R9JA 1QV9A 3KKQA 4RELA 4QSHA 3TMAA 3UAYA 2V7BA 6CHYA 2G6BA 3PU6A 2O06A 3TL6A 4LJ5A 3NKVA 3QNMA 1LNQA 1BGWA 1S0UA 3DZGA 1Y63A 2WYWA 3FSGD 2P5YA 1CUXA 1HPLA 3DP9A 3IRUA 4M22A 1P45A 1ZRMA 3QNWA 1ZH0A 3V33A 2NP7A 2QVYX 5IYZA 3CVWA 4QJ5A 3LLMA 3UYKA 4L6IA 3E3OA 4KWHA 4DSAA 5FLKA 2FWAA 3H2ZA 3HMQA 3P19A 2JJ1A 3FWPA 1NONA 5CB0A 2X5NA 1NE7A 3ZLTA 2QPOA 3WICA 1GILA 1PJRA 4NOLA 2HYIC 1NJGA 2O19A 1DZIA 2A5GA 5DF1A 3A4VA 4KJZA 4CL3A 4LJRA 5K09A 5UKDA 1Z7BA 3MT8A 2O8BB 3I6ZA 3R6WA 3D6AA 4GPIB 5KYNA 3RUHA 1DJPA 4PIPA 1I3CA 1MVLA 2XCRB 3DXYA 1OV6A 3HXOA 4NS4A 3WQSB 2QMZA 5IKEA 5AVWA 3G0OA 1HY3A 1XD2B 3I8OA 3NBZC 3S6JA 3WK4A 3WK7A 5DMXA 1GKLA 1IZZA 1PQUA 2AJTA 2DBZA 2Y1LA 4BZWA 4PVDA 3TIFA 3WJ1A 2W83A 3O3CA 5DYNA 1N3IA 3RABA 1D1QA 4X3PA 2YNMA 3FZYA 1TADA 3O93A 4B81A 5C4IA 2BBSA 2RH9B 2ORYA 3ZGZA 2HL6A 1B7GO 4LWPA 1A1SA 3V2HA 1KK2A 3Q7PA 5LQJA 4II7A 3D6MA 3EDCA 3VR3A 2XD9A 3WMGA 2BFCA 3UG6A 4TS4A 5LZ4A 4ZVKA 3DGEC 3DEFA 3ZHUA 3H7IA 3C3XA 1JAHA 1O94D 3PUXA 4J4BA 1XEFA 1ZKDA 1V1JA 1FUUA 1BOOA 1TMKA 2ATXA 3I6QA 4FWBA 1GRNA 1KO4A 2PXAA 2VDWB 3Q0TA 4HDSB 5HGJA 5AVXA 1NHGA 1B76A 1DAIA 1EHYA 1T36A 3KKKA 3MAAC 4GRAA 3ASVA 4LGVA 3UKJA 4DDHA 2QW1A 3G0BA 4B47A 4DVGA 2MJLA 3M5DA 3HEMA 1TB4A 2OHOA 1MIOA 1X1QA 3MLBA 4AMVA 1EP9A 3IPYA 2CJXA 4U2DA 5E7QA 1H2HA 1SD5A 3FTDA 2QMUA 3NBYC 1TMOA 1LW6E 3PI6A 3S2FA 4KR3A 2IW1A 2CXPA 3DDOA 3TD6A 3IJRA 3RHZA 4NLLA 3SNKA 4JP5A 5KYXB 1DX6A 1NLUA 2XUFA 3DVQX 3G1TA 5DN6D 3E9ZA 1K06A 1N2OA 4KGZA 4CI0B 2XMQA 1DKLA 3JALB 4F0JA 3P2MA 3PDHA 1L5LA 4EEKA 1YB2A 2ZR9A 1ZUHA 2QEQA 1J39A 3NR2A 4NZZA 3VJKA 4G8DA 1RXEA 3KT8A 5HYVA 3FY4A 2QTAA 5U1PA 4E32A 3IT2A 3ZV3A 3A4TA 4FFPA 1PJCA 2ONZA 1K89A 1U99A 1WU8A 1E7MA 2F3QA 2RCYA 1NW7A 5CDYA 5KQSA 1GOTA 1R4NA 2FCAA 1NYRA 1CFJA 1CJUC 1T91A 1TMGE 3BEOA 3HSYA 5JFOA 1DCMA 2EVWX 1E1NA 2OKGA 4DJ5X 3DV0B 3KWFA 1LLDA 3E81A 3GP8A 2HJWA 4MUFA 1RQLA 3CCBA 1U7UA 4Q6WA 3D4BA 2AEFA 3B2EA 3ZE7A 4WJKB 1Z3IX 4QYWA 2X23A 4F5ZA 3C3DA 1ONOA 1AV7A 3MS2A 3Q0IA 4XJSA 1AKMA 4XVRA 3CRMA 2GHIA 3GFOA 4RKYA 3WMEA 4AS3A 4PTLA 3VVCA 3T15A 1EK2A 4QZVA 1M3SA 2IIQA 1ZD9A 3CF4A 4F9GA 2PX2A 1XALA 1HA3A 3LA6A 4XDGA 3TOVA 3OT5A 4XFJA 4NZPA 4TV9B 3RHSA 2HHAA 2CVHA 2AQKA 3FOEC 1TEVA 2UVPB 4HG2A 2ZLBA 4QWWA 2QORA 1AK1A 4JI8B 4UMDA 1IJFA 3DNPA 4PLWA 4YRFA 3JYLA 3T41A 2P2DA 2X2OA 2BFDA 3ZCXA 1FMTA 2QTMA 1AG9A 3NH9A 3S7TA 1ZPDA 5FLXA 2PSSA 1JV2B 1LBEA 1EFTA 1X15A 3KR9A 4V0ME 4M53A 3E0QA 5AW3A 2IHBA 5KNBD 1KYIA 1Y1QA 2IWRA 1RACA 1Q1BA 2X8LA 3EAGA 3EFOB 3DZCA 3TEJA 4D3XA 2XYPA 5AW0A 5TQJA 4BVKA 4M8SA 1DPFA 5AUNB 1DIBA 3PITA 1Q92A 4G8JA 5CHYA 4TT3D 5LKRA 1Y8RA 5E95A 4JI3B 5K45A 4JVOA 3G9TA 3EULA 5K3OA 1H4SA 5I7HA 1JXAA 5FHRA 5JCOA 3JQEA 4P0PB 1PYDA 1T9GS 1YNOA 3PPIA 5EERA 3JCZA 2WJHA 4W82A 2X19A 1BXKA 4YUVA 2QRKA 4AG5A 4Z7OB 3LS2A 4CDNA 3WYDA 1TEXA 4MR8A 4ND4A 5FUVA 1RJWA 1SVWA 3FDJA 4Z1MA 1MZVA 3QEMB 3MZ0A 4KPYA 4CIXA 2W42A 4EB3A 4NENA 4C0KA 2O2GA 1EUZA 3KWMA 4BKOA 5EZYB 2OP0A 2XGJA 1ANKA 1NJSA 2ZI9A 3MTAA 4MQFA 4DR1B 3BB3A 2Q4DA 2OHJA 1G8GA 2HLHA 3HA5A 3OQ1A 2QW0X 2ROQA 3DFMA 5BWLA 4WN9A 1RKUA 2Q6VA 1NWCA 2RBEA 1XROA 5EWJA 3B82A 4HAVA 1CUWA 1T8YA 3GFSA 4JDPA 1PUXA 2Q28A 2ZUVA 4K9KA 3DXXA 3WB9A 3WRVA 3O03A 2IS4A 1OH5A 4WXMA 2A5DA 4X95A 1O9BA 1KDZA 3MC1A 2DFLA 1VG9B 3QU5A 3F5FA 1MOZA 3HVHA 1A71A 4R41A 3PR1A 2CVQA 5GV8A 1PFGA 1N5IA 3O94A 4UREA 1AQJA 2IY9A 4WK0B 4BVJA 1GT6A 2V74B 2OYSA 4YUWA 4KNYA 2CFCA 2RHDA 3LECA 1FDVA 5EJFA 3LCRA 2JBAB 3AUKA 3MWLA 2FXIA 3ZDZB 1TQ2A 2Q99A 3LOPA 3IOYA 2WYOA 2XMGA 1RCTE 4HN2A 4B6QA 4OM8A 4JN6B 4MVJI 3GMSA 3OE7D 1U1GA 3X1YA 4NG5A 3UAGA 4AM8A 3DOJA 2XADA 5ECWA 1PUIA 1YVRA 4RLHA 4B2LA 2WWXA 1SXPA 1KYXA 1LWOA 4QODA 4IIEA 2OCLA 3OQOA 3ZGLA 4QECA 2BDEA 1DG9A 1DIHA 4OFXA 5I5EA 3WYGA 1GV1A 3N3BC 4DWJA 4BZPA 4IO0A 2Q3DA 4R05A 3V8NA 4ATNA 4BKPA 3TAUA 3R75A 2OV8A 1UZLA 1Z2OX 2J07A 2CL0X 3HBFA 3UB2A 1A4XA 4YV7A 1KQFA 3TW8B 4PAGA 1WZIA 3LPLA 3PPWA 1GXSB 4YLGA 4OBWA 2IPXA 2IBTA 2C03A 3AX6A 2PTHA 3O8CA 4F12A 4FFLA 2Z08A 1XU7A 2RI6A 3X2EA 3RIGA 4R0VA 5K9ZA 3U7HB 3C97A 1U3FA 2B8EA 2KS6A 1EE1A 1NNEA 1RS0A 4Z7QB 3GJTA 1PJSA 4WLEA 1CUHA 2IHVA 2XZPA 4OK3A 3R6DA 4OHBA 4BQOA 3ETEA 3GLIE 3GEIA 1FQOA 4U7FA 3R8XA 1TTPB 3BH7A 1GAQA 3CNEA 5DYTA 3CX7A 4G4SO 4XLZA 3RLIA 3TEMA 2HW8A 1TJYA 4KYUA 4B74A 2AL7A 1QHSA 1P7PA 1US8B 1Y6JA 3FSEA 2PQMA 3ZQ6A 3ZLVA 1M1NB 5JVDF 2X76A 1KEZA 1RPJA 1WW8A 4J0IA 4TKVB 3EXIB 3JWIA 4YP7A 4AZWA 2P35A 3PQ6A 1PL8A 1M0EA 3L4SO 3H9GA 1Z12A 3DE4X 3HVIA 3MOIA 4WKOA 5A4DA 1IDN1 3GH1A 1U5BA 2YZMA 4JB8A 1DG1G 1T9ZA 1TM4E 1GFIA 2GVDC 2WG2A 3GLUA 3I0ZA 3PE3A 3S2ZA 2R9VA 3FZGA 4HUTA 3LHDA 1NUHA 5LA6B 5KVSA 1CS4C 3F71A 4CEHA 1KQOA 1NW8A 3L1VA 4DGSA 3PX7A 3FYDA 1UINA 2B37A 4H7HA 4GS5A 3PFIA 1U2TA 4GMFA 2ODTX 5FL3A 2PVCA 4YJKA 4ZVNA 3RYHB 3PL5A 1X87A 2PJZA 2PGOA 1Q74A 1X7GA 1XG5A 3EIFA 3MF4A 4QU5A 3GGDA 5F51A 1EIWA 2ZI6A 5G40A 1GKUB 1UZUA 3H9QA 5J58A 2H17A 2YYZA 3P4XA 3GP3A 3U4DA 1T34A 4RXMA 3VV2A 1R0BA 3BSWA 4O8CA 3I52A 4HTFB 4IGEA 4P84A 2WWVD 4G5FA 4UBMA 3QLVA 3HM9A 3H5LA 4A8JB 3TZQA 2EKPA 4ZDJA 4EB6A 2PSEA 1R0WA 1U8FO 4Q3EA 3KETA 1XHFA 2P9CA 1F3LA 1OU0A 3KTDA 1M7HA 4HMOA 3RU3A 2D6FA 2PSDA 3S2IA 3A70A 2DPMA 3UXMA 3ZD7A 2W2PA 5CXQA 2CV2A 2B4AA 1IVNA 3DKRA 2IPOA 3BORA 2P5TB 4N1AA 3IJ5A 1L9XA 1HNZB 3FGOA 2HLDD 1WU7A 3LBIA 1V16B 3OIVA 3QPDA 1PJLA 4NJMA 5ITZA 5FXMA 3ZGOA 2AT1A 1K4MA 2DP4E 2ZRAA 5IHXA 1F5NA 3M6FA 4ZXFA 2GBPA 3AETB 1UJNA 4OG2A 1T9KA 2Y0BA 2AEMA 3VPSA 1F3OA 1HL7A 3PD0A 4IWYA 2V7QD 3V32A 4B3XA 1DXOA 5FULA 3K16A 3EEFA 1I13A 1NVVR 1PF7E 4GEGA 1YK1A 5HIJA 3RG2A 5IWAB 3AL0C 2Q5LA 3KKEA 1RI2A 4UDOA 4MWSA 2DH5A 2P4EA 3K0HA 3CPHA 1EFVA 3I5AA 2WSSD 4R1PA 5E8JA 3LBYA 1IG0A 3DLCA 3FYCA 3RU9A 4EA7A 5B7PA 3S99A 1N33B 1GNTA 1PNRA 2QP9X 4I9NA 1P7CA 2BEKA 3QIAA 2GUWA 2DGDA 2OHIA 2X9LA 4NSNA 1KZHA 4YIHA 1UPTA 3STXA 5L45A 1C0KA 3EGEA 3N74A 3TFWA 2ES4A 4M1EA 1YL7A 2ONYA 4NZOA 3UANA 3F0TA 2WSSA 4UOZA 1E5XA 2PRYA 2BM0A 4AT1A 4ASUD 1E7YA 1ZMBA 1L0BA 1ZGJA 3EDYA 1PWZA 3W5VA 3DQQA 3I12A 4HTAA 2OB1A 3IA7A 3E9EA 3KEQA 2FUEA 2J7PD 3RT9A 1YFLA 3X44A 1YBFA 4F8JA 3DULA 5FWYA 1W36C 4FFWA 1E2BA 2ZRMA 4IJKA 4YDQA 4Q15A 3CZAA 5DWQA 3WK5A 1PRYA 3KXPA 4LTMA 3PYXA 4D4HA 3IAXA 3VU9B 4OP3A 1HT2E 1EXWA 3UXEA 2QMEA 5KSOA 4MEBA 2CLIB 4DLNA 2BGRA 3CJRA 4U2EA 4G0OA 1IONA 2WAAA 2C8LA 2R1ZA 1JH9A 2CFIA 4RL6A 2BFEB 4XB6B 1U04A 4P83A 3SZGA 2XMSA 3PFGA 2C4NA 4X1KA 3TJMA 4E08A 1BDIA 2YWBA 3H13A 3IKJA 2EZ9A 3O8LA 3PR3A 2P2LA 4FN4A 4D3SA 2G9VA 2I5PO 1J5XA 2X77A 2GHQA 4GR5A 4I9FA 4QNMA 1XEWX 3QBVA 4TXJA 1KOFA 4O4IA 4D2IA 2CE7A 3ZIUA 2NXJA 3CN7A 1YI8A 1OSNA 3ZC3A 1QORA 4P7JA 2R8BA 5AJUA 3PC8C 1T26A 3NH6A 5C1BA 5LD2B 1XP5A 1LSJA 4HUQB 2KBFA 3A6ZA 4N3CA 3ZLBA 4CEHB 4OQLA 3TFQA 5IT4A 2DWCA 3BJZA 3P0JA 4OVKA 1V3QE 3KQHA 2VJMA 1DOAA 2YVQA 2ZQYA 1XXLA 2GXQA 1JR3D 1WSWA 1DI0A 2W2KB 4AWXA 3QWAA 3AI7A 4GLJA 3R8FA 2WABA 4KLCA 1GCUA 1KPIA 3VR3D 1XNGA 1V5WA 2ERXA 2JFQA 3IILA 4PQRA 3WNBA 4HR7A 1P44A 2CXTA 1JSZA 2EYQA 2ZJ5A 5AUOB 4JASB 1MAUA 1VECA 1G7TA 2IPLA 3A9WA 3A1DA 3HQ4O 1EQAA 4HN4B 5E4FA 4MKIA 1TOAA 1KFKB 2PS0A 1V4VA 3EGOA 3X1XA 4DCOA 4H7IA 4LFCB 5TMPA 3IESA 2NNLD 3CGGA 2PKWA 3ET5A 4QPZA 2JIZA 3H86A 4IX1A 3T1TA 2VF2A 2WA2A 5CYPA 2VRCD 1FZQA 2VHTA 3KZCA 4F3CA 3BFKA 1OT3A 1KZGB 1YDEA 2HSDA 1IPEA 2IUEA 4H08A 4TZ0A 1D1TA 1SXGA 2IUTA 3LX8A 2H92A 2D0OB 2H1VA 3DDHA 3I64A 2I4NA 1RYDA 2V8OA 4C4YA 1NIPA 3B1FA 4L08A 2YOFA 2WSLA 5DYIA 3EZFA 1BEEA 4LKRA 3ANSA 3P8ZA 1J00A 2DSNA 4DSZA 3NDJA 4J0JA 4URUR 4RJIA 3E23A 1B3BA 3CLKA 3M82A 1PG5A 3N1UA 4XPIA 2HGZA 1TLLA 3HFSA 3TWOA 1AQNA 1QYCA 2VQSA 4C0WA 3FSGA 2JHGA 4FCCA 4ZU3A 1E0JA 121PA 1EFUA 1H0KA 3ANTA 2X3UA 3CU5A 4UEQA 1M5UA 3LDHA 2JFUA 1G42A 4NE2A 5D1NA 5ALPA 1U3WA 3K2QA 4TKMA 4NCKA 3JAKB 1F0KA 1NE2A 1T2DA 1ZRSA 3PYLA 3AUXA 5CLFA 3MXTA 2ZAMA 1IOLA 2B20A 3QP9A 4G5OA 4YJ3A 5JC1A 3EIOA 1Z6GA 1KETA 5KNCA 1US8A 3U7GA 5HQJA 3DEKA 1FU4A 4IH1A 2G72A 2WFAA 4XR4A 1AOXA 3OLQA 3NWPA 1ZH4A 2C5GA 1GKYA 3EZ2A 3N0VA 1YS9A 4QFCA 4WNAB 3ZDFA 3J81k 3ESRA 2CYBA 4UJ3A 2YS7A 3O8DA 3ZVKA 2IZ1A 3OA0A 4NYJR 2ZRCA 2FFRA 4ZV9A 3AHDA 2JI7A 3KUUA 1C7ZA 3ZVLA 4OQMA 2Q3MA 4TLBA 4AO6A 5EUQB 1UQRA 5SYAA 2ZUFA 2O52A 5B1SA 2GK7A 1ML4A 1IM5A 1DX4A 2IOFK 1V1MA 1V5EA 3KUXA 2ZJ3A 5SZHB 3RS3A 3UXHA 2YWFA 3LQFA 4HD8A 4OOEA 1F1JA 4DV1B 3JARB 1UKAA 5C51B 4OOFA 1G9SA 3F6PA 3HU5A 4OQZA 4RGYA 2CHVA 3N7TA 4G5YA 1W36B 2N9UA 1DBQA 4Z3KA 2IXBA 4Q03A 2XQIA 3LPCA 1M7BA 1LI7A 3L8DA 2WE7A 4I6EA 3ETNA 5LQAA 3A9TA 4A7PA 2EFEB 2QIPA 1Q7CA 3A25A 5DI3B 5B3JC 4UPEA 4CTMA 1VPVA 1XV5A 1K5GA 2VK4A 3UAXA 3QUBA 3V1NA 3BGIA 1SWVA 4I1PA 2WD9A 3A28A 3FYTA 3LX6A 4PYQA 4LJYA 2HJ9A 2VLIA 3TK1A 3VYTB 3F2VA 4FJ1A 1J9GA 1KO7A 3LWDA 2EL9A 8GPBA 4B3SB 1R6UA 3QE2A 1RM3A 1DDGA 1XRLA 5D00A 1KJ9A 3OMLA 2HMSA 3REFA 3WYEA 1MC4A 3DBRB 2VCEA 3EVGA 3AFNA 3QX3A 3ER9A 3NC4A 2FFJA 1M2HA 1FTNA 5CT9A 4WZAB 3ZQKA 5KOIA 3TBHA 4WBNA 2Y92A 1UBEA 1V2HE 1GAEO 1Z8FA 2Q3JA 3OZEA 5AI4A 3V1TC 2HT1A 3FVTA 4BDSA 1P3Y1 1XDGA 2YV4A 3AW8A 3W2GA 1FJ2A 2BGNA 2AG6A 2OBBA 4YAUA 3VSEA 2DRIA 2I6UA 2KHZA 2ZR8A 5CFRA 4X1IB 5A0FA 3OTOB 4B45A 3J7AC 4DQLA 2VFAA 4ZAYA 2AVDA 4YV2A 4NNOA 1BDHA 3EF1A 3R41A 2CB0A 4FEEA 2CKMA 1JAZA 1H8ED 4D6PA 2H31A 3OZIA 4L85A 4WH0A 4AYTA 4DT1B 4YBRA 1ZESA 3TINA 4TT3A 1JB1A 1ESDA 3C8UA 4JC0A 1ML3A 4AKEA 4NENB 3MOGA 4QARA 1QF9A 1P1HA 1XA4A 1ZVJA 1CZNA 1LXCA 4IHJF 5G1OA 1KYZA 4P80A 4A82A 1LPMA 4L5YA 3CISA 4YRJA 5K03A 3R3UA 1M34B 1BJTA 2G82A 5J5CA 4YRPA 1Z0UA 4P98A 3PTZA 3GELA 1DC8A 4MYRA 1KMIY 4TYQA 1JDNA 2BE9A 4ACBA 4IPTA 1J0XO 1EK6A 1AZLA 3C6XA 2ZJAA 4U0JA 1WTCA 4TM8A 1WTAA 4G1UC 1KWGA 1G3MA 1KFEB 5FFFA 3C7KA 5JSKA 3TQSA 2PUHA 1SXJE 4LTNA 1U0SY 1GR0A 2WM3A 3QOYA 2AYZA 5G1PA 1JEYB 2V0NA 3GGGA 1OLSB 4JQZA 4M37A 3KIPA 4RMHA 4JUBA 1MBZA 4S1OA 1JZQA 3RVBA 2ZOSA 3WS7A 2Y3IA 2RB5A 3EFOA 2HDHA 1ESCA 3FR7A 3LCJA 1B8OA 5CG1A 4FHDA 1A9ZA 1KZ7B 4AECA 3ZVRA 5CLIA 3DMTA 3VC2A 3VDMA 3VSDA 4ZZIA 5K0CA 4U0KA 5IXSA 3HCAA 2AE1A 4F2GA 5HIAA 2VDRB 2C57A 2YWHA 4PWZA 2GXUA 2GYYA 4FNOA 1NXOA 3VU3A 4KL8S 1OROA 2PSFA 2KE5A 3U3OA 4FB4A 2ENUA 5ALIA 3T52A 3OTGA 4P7GA 3DFKA 3JXEA 1DZ3A 2W5UA 4TOIA 1ZBDA 5EN4A 4ZYUA 3C98A 1NASA 3BFPA 3PLNA 2PXHA 1UM9B 2XUDA 1LK7A 3UTCA 4MGHA 3T3GA 1JG7A 2ZUSA 4DCMA 1F06A 4H6WA 1G4UR 1RYYA 3PDWA 1XKQA 4NMWA 5CW1A 5FA6A 2AX4A 1YO6A 3PXUA 2UUAB 2YUTA 1MJHA 4CLOA 4MIYA 1WHTA 2KPOA 3RAJA 1QDLB 1R0LA 4YMLA 2I76A 2X0NA 1OB2A 5FBQB 2OGZA 1V6CA 1W94A 2G40A 2WTNA 3V4FA 2XWPA 2YV5A 1IM2A 5K0TA 3VH3A 4FBMA 2ZCJA 4J16C 1SIUA 2ZRIA 1J6UA 2VHJA 2NT3A 1F0PA 1PT6A 3QMPA 4P32A 4B6PA 5KB3A 4MRPA 1RQXA 1DG3A 4Y30A 3RIMA 4KNWA 2W2MA 2CFTA 2J87A 2F1RA 4E5YA 1Y1LA 2LPMA 2I4RA 2QTRA 1TM5E