2PTGA

Crystal structure of eimeria tenella enoyl reductase
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
307
structure length
224
Chain Sequence
b'PLPVDLRGKTAFVAGVADSNGYGWAICKLLRAAGARVLVGTWPPVYSIFKKVFDKIYPLDAVFDTPQDVPPEVSSNYAGVGGFTISEVAEAVRADVGQIDILVHSLANGPEVTKPLLQTSRKGYLAAVSSSSYSFVSLLQHFLPLMKEGGSALALSYIALESDCRTLAFEAGRARAVRVNCISAGPLKELESDDVGRAALFLLSPLARAVTGATLYVDNGLHAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-acyl carrier reductase
publication title Type I and type II fatty acid biosynthesis in Eimeria tenella: Enoyl reductase activity and structure
pubmed doi rcsb
source organism Eimeria tenella
molecule tags Oxidoreductase
total genus 68
structure length 224
sequence length 307
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ptgA01
4CLOB 4E13A 5T6BA 2ZYDA 3QJ5A 1GZ6A 4XYMA 1D7OA 4XGNA 2Q99A 5IZ4A 4UULA 4E6PA 3A4VA 4ZRMA 4J1SA 4PLZA 4NBUA 4U7WA 1HKUA 1UDBA 4XGIA 1D1TA 1FDWA 4AJJA 1ZNQO 3ZZNA 4ZN6A 4XEHA 2OZPA 2EGGA 3PHLA 1H9BA 4GX5A 2IZ1A 3MJCA 1WXDA 3FN4A 3OBBA 4P8RA 4WGGA 1BVUA 4H7PA 1TA4A 2VNSA 2HMWA 4IS3A 3D64A 4YT2A 2PH5A 1T2DA 2O7QA 3MOIA 2O2YA 1YKFA 2RH4A 2NLOA 4P38A 1HYEA 3I9OA 3P2YA 1RJWA 1LDGA 4N54A 3RI3A 1E1KA 1NXQA 4XB1A 4B7CA 5K6AC 1E3EA 1NNUA 4CMBA 1HF3A 1WMAA 3NT4A 1ZBQA 1M75A 1VL8A 3UCXA 4R54A 1KETA 2RBEA 2X22A 3DBRA 4OSPA 3HB5X 3BTOA 4J4BA 1IOLA 2DFDA 9LDBA 5CDSA 4IIVA 4R4JA 3E18A 2WE8A 5G0WA 2EXXA 2NVBA 4UREA 3WGGA 4YQZA 3ZWAA 1DIGA 3U4HA 4D0SA 4W6ZA 4CUJA 3EUWA 2HDHA 3KO8A 1MLDA 4RLSA 3GNTA 5JAIA 3F1LA 3BZUA 3I9MA 3IMFA 4CODB 1NQOA 3LT0A 4FN4A 1SBYA 4QX6A 4E5PA 2BI8A 5CDYA 3U62A 3WYEA 3H8VA 4NBVA 4FFMA 1U5AA 2AHRA 4LISA 1ZMTA 2W2KA 1DFGA 4D43A 3JD1A 5EERA 4TMFA 5H83A 1HL3A 2WEKA 3IUSA 4P4NA 5KCZA 1ZK0A 1TT7A 5JC1A 1JA9A 4BMNA 2VTEA 4CPDA 5HM8A 3C7DB 4BNNA 1R4MA 1DSSG 4YVFA 1I0ZA 3FTNA 3HADA 3VH4A 1F12A 3U9LA 3ZHBA 4WJZA 1K5HA 2HQ1A 3GC6A 4XX0A 4F45A 3ENKA 1HDZA 2H9IA 1DIBA 1HYHA 3WNVA 1I3KA 3GMSA 3L77A 3Q1LA 4I8XA 3L4BA 4LRTB 2EP7A 3F4LA 3LC2O 3TRIA 4BUCA 3U4IA 5HRUA 4J3FA 4HV4A 4QFDA 3V2GA 1YE3A 3WLEA 4BKOA 4EJ6A 1L7EA 5HWSA 1PX0A 2DC1A 3AOEA 4ZJUA 4R9RA 1Z75A 3U4DA 3W4IA 4YJGB 1N1EA 3EMKA 3K2EA 4IM7A 4BNYA 1H6AA 4R41A 3RIHA 5U1PA 5JCJD 3SVTA 1U3UA 2B5VA 1Q7BA 3JD4A 5L7WA 1WWKA 1ML3A 2IE0A 2FP4A 4CM6A 1LLQA 3HZZA 4Y8VA 4HWKA 4KQXA 3Q3CA 4IQ0A 1ZK4A 2VT3A 2B35A 4HY3A 4MIEA 4OMUA 3WX0A 1JU9A 1Y9AA 6LDHA 2NV6A 4IJWA 1ENPA 4WECA 4EJMA 2UV8A 1AHHA 5IDQA 2AEJA 3W1VA 4H3VA 5JS6A 3JQCA 4XD2A 5L4LA 3WNQA 1A7AA 3IOYA 2P68A 2EGHA 1V8BA 4CLRB 4Q39A 4JNKA 3DZJA 2IEDA 1TVEA 2GSDA 4Y98A 1KBZA 1E1NA 2WD8A 4C4OA 2AEMA 4BKQA 3NUGA 4XKJA 3LQFA 2EW2A 4INAA 2CDBA 1NBOA 4CMHA 5GMOA 1E7SA 2VYNA 3D3WA 1FDUA 4WLEA 4AJLA 3IKVA 3ZWXA 3AK4A 2G82A 3UH1A 4J7CA 2HK7A 1QP8A 1PJ4A 5ER9A 4W82A 3JD0A 1ENYA 1I36A 1MP0A 1GR0A 4ALKA 2JCXA 2YDXA 1H6BA 2C29D 2P91A 5LC1A 2PNFA 3OSUA 2J5RA 1JVSA 2AXQA 3PLNA 3WJAA 3ZU3A 1BW9A 4PG6A 4AG3A 2EJWA 1WDMA 3OHSX 1Q7GA 2P5UA 3RBVA 1PL8A 4PLVA 3HDJA 3UXYA 3QVSA 4NBTA 2J3JA 1V6AA 3OJOA 4U6QA 4D3DA 3TZ6A 2YZ7A 1E3JA 3VKUA 1R37A 1DIHA 2DAPA 3PWKA 4B79A 2I66A 5IG2A 3A9WA 3ZCXA 1A9YA 4JROA 2VTDA 4CQLB 3MCVA 5I8ZA 1Y9EA 4CL8A 4BNUA 5CPFA 4U5QA 3OJLA 1HDXA 3GDGA 1E3SA 4M86A 1DPGA 1CERA 4YT5A 1GQQA 4QXMA 4BV8A 2EERA 5A04A 5BNIA 5JYEA 3VZRA 1XR3A 3DQPA 3QWIA 1GQ2A 1AXEA 4E5KA 4EGFA 2RHCA 2QX7A 2QZ9A 4FDAA 4RF4A 2DPGA 2AQIA 3UGKA 2FOIA 2PH3A 4QUKA 2FSVA 3GMDA 5ILGA 5F21A 4MKZA 4NJMB 3C8MA 1PS9A 2E82A 4BNVA 2A35A 4B4OA 1X7HA 2FPPA 5T64A 1UP6A 1UXIA 2NUAA 3NTOA 5IZCC 4RL6A 3RAJA 3QE3A 1B8PA 1RWBA 2XF8A 3ROKA 4GSLA 5IN5A 1B16A 1S6YA 2QIOA 3KZVA 3PJFA 4XR4A 5L45A 1LEHA 4I1IA 3RUAA 2H5LA 3L9WA 4DIOA 4Z3DA 4RJTA 4ND5A 3HQ4O 4B8WA 4CR6A 3G0OA 4HFMA 1RM0A 2FR1A 1ADFA 4WE3A 3PGXA 3TZCA 3DMTC 3UAGA 2D5CA 4IDGA 5CEEA 3VPXA 1X1EA 5L95A 2V65A 2BRUA 2I65A 2IEBA 5JMWA 4L8VA 3GGOA 3CXRA 1DOHA 3K73O 2POQX 4RF2A 2R00C 4I9NA 1V3TA 4J9VA 4PLGA 4RO0A 1VL0A 2HMVA 3HFGA 3P5SA 3U5TA 3GN1A 3HFSA 5JAQA 3ZHYA 3PHIA 2C5EA 1NVTA 4BNFA 2JFHA 3GVCA 3E5RA 2E49A 4BIIA 3GEGA 4C7KA 3I9NA 4BNXA 3BMNA 4LSMA 4UVIA 1K0UA 1QKIA 2X86A 2I67A 1MX3A 4E31A 3RUDA 1GYRA 3PFWO 4CQMD 2UUOA 1Z7BA 3LT4A 5I7SA 2XAAA 3DAPA 4NNJA 4NFHA 4PVCA 4FR5A 1PJCA 4U0KA 1EE9A 1CQIA 4WLFA 5DBIA 4K6CA 5DOZA 4CLHA 1NAIA 2X9NA 2I3AA 4CL3A 3I5MA 5TJHA 1J49A 1Q0LA 3DZGA 1Y5MA 3MJSA 3RC7A 2O48X 4R16A 4YPOA 4W7IA 3EAGA 4WLVA 1JKFA 2EW8A 1DIAA 4XIJA 3H5NA 1UXGA 1H2BA 4YR9A 4LW8A 3OH8A 3DTTA 1IE3A 1QRRA 2W2LD 3PHGA 4FOOA 3BAZA 2VRCD 3INRA 2GERA 1E0DA 2W90A 4FFLA 1CDOA 2HK9A 3DZFA 3VZPA 3S2IA 5CDUA 3Q2IA 3VOSA 1BDBA 3WMXA 4TQGA 1KVUA 3LDHA 1VL6A 4PLTA 1C1DA 3CE6A 3GRKA 2WWRA 3IQDB 5BSEA 3JQBA 1CETA 2DTDA 3WGIA 3LF1A 1I2CA 1GCOA 1AHIA 3TSCA 3JQEA 4YACA 1CWUA 4P4LA 4O0LA 3RBXA 1ADCA 1A9ZA 4DXHA 1DFHA 2O3SA 3MJEA 1K6JA 3OICA 5A1TA 2EEZA 2Y1OA 1ULUA 3UOGA 3I3OA 4FIZA 3PI7A 4O5OA 4GX0A 2Y99A 4RPKA 1Z73A 5TC4A 2ZB4A 5KJ6A 2AQHA 3H9QA 5CG1A 2ZQZA 4D45A 4BNLA 1HETA 1HLPA 3U4CA 2PZKA 5KWEA 3LLSA 4N7RA 4OIMA 1MG5A 3WIEA 2Q4EA 5DF1A 2QZZA 5ADHA 3JYOA 5B12A 1GUZA 1S7CA 2JFGA 5JDIA 3CMCO 2EV9A 4KUGA 1RYDA 4CLDA 5TLSA 2ET6A 1BXGB 1ZSYA 3RUIA 2GN6A 5EINA 1VSUA 3GGPA 3G3EA 1R66A 1XU9A 3IAHA 3D1LA 2HU2A 4ZQEA 1YQGA 2HSDA 4RPGA 3U0BA 4BL5A 4UUNA 1LU9A 4M89A 2UAGA 1MGOA 2J3IA 5AVOA 2CVOA 3LF2A 2FR0A 1FDVA 1LSSA 2IXBA 3EW7A 2VHWA 1DHTA 3JQFC 4TVBA 1WP4A 2GO1A 4J4TA 1PJLA 1D1SA 2V6GA 4RZHA 4IJUA 4CMJA 3D3WB 3TZQA 5JXWA 1NWHA 3MJ4A 1HRDA 5IZCA 4BO1A 4GGPA 4XYGA 4DTIA 2Z1NA 1M76A 1SNYA 4DWVA 1PGOA 3FTPA 5TIIA 5BNFA 3KVOA 1NPTO 4Q3DA 1YVEI 3WQQA 4EEXA 2D5AA 2NWQA 1FK8A 4Z0PA 1BW9B 3ZWYA 5DT9A 5T67A 4YRDA 1BHSA 4IPTA 3HE3A 1Z6ZA 1HXHA 3GHHA 2Q2VA 3QWBA 4Y67A 1ISGA 4CM8A 4DUPA 3FSRA 1DHRA 4TSKA 3JD2A 3LSYA 2D4AA 4QFCA 1LRJA 3X2FA 5JY6A 4U0JA 1J5PA 2NSDA 4J7UA 4WPGA 3H2ZA 1BDMA 2AA3A 3SC6A 4J7XA 4YAGA 3OQ1A 4IDFA 5DBGA 3TF5A 1ZK1A 3DBHA 1ZUD1 4BO2A 2DBZA 1ZXLA 2UDPA 1FXSA 1PWZA 3LK7A 3LT2A 4GWGA 1TT5A 4WLOA 3WSVA 3QVTA 4FB5A 4XR9A 5JO0A 3F5SA 2C82A 1WPQA 4K26A 5JW6A 2B5WA 4MPDA 1U7TA 5IAAA 3KLMX 3SXPA 3QWFA 1U2DA 1H94A 1TEHA 3RJ9A 3BIOA 2RHRA 1E7YA 1KEVA 1ENOA 1GPDG 1H6CA 1A4UA 4XB2A 1YXMA 1VJ1A 2BFAA 2E6UX 3Q0EA 2FMUA 3BTUA 4S3MA 5IF3A 2IDZA 3HB4X 3WGHA 2BELA 3ADPA 4IJKA 2HJRA 4BS9A 1JAXA 3ANNA 5I7EA 3S2GA 2BF7A 3AU8A 3W4KA 1DLIA 1O8CA 1V3VA 3PIIA 3PLRA 5H81A 4GI2A 1T2CA 1WMBA 4RGBA 4X54A 1GADO 4ESOA 1HDGO 3ZV3A 1U4OA 3B6ZA 4J91A 1P9LA 3IUPA 2A4KA 2GZ3A 3NGLA 4J6FA 3WQRA 1PGJA 1U5CA 3GH3A 1BG6A 3PIDA 5BT9A 4KTTE 1EUDA 1GUFA 2OHXA 4R3WA 3H4VA 1IUKA 2J3KA 5I9NA 3ICCA 4DC1A 3BMQB 1B3BA 1XQ6A 3E8XA 5JDCA 4U8GA 3Q9UA 4JJFA 2Q49A 1HTBA 1DIRA 1MV8A 5A02A 1PS8A 5C37A 1YWGO 2NU8A 1ZMOA 2G1UA 3V1YA 2R2GA 1HZJA 3R3JA 3JTMA 1LDNA 3BMNB 1UR5A 5I7VA 4CLRA 2ZKLA 3STHA 4BVAA 3MOGA 4A7PA 3WICA 1PZFA 5H82A 3GZNB 1XHLA 4BKRA 2TMGA 1PSDA 3DEYX 4GVXA 1OC4A 1FJHA 2V6BA 3WIDA 4AL4A 4Y6SA 4EJ0A 3I83A 4EUFA 4RVUA 2GGSA 4CM3A 1H5QA 2OORA 3JQAA 1TI7A 5A5EA 3H5RA 4G81A 4II3A 2Y68A 3ITDA 3SLGA 2OUIA 1BWSA 3EDMA 1HZZA 3HSKA 3I4FA 5EESA 2BHLA 2HMSA 4R3NA 4UVHA 5FYDA 2ZIZA 2J5QA 5FI5A 4CM9A 1OBFO 4E5NA 3H65A 2ZTMA 1EDOA 4DLAA 2F00A 3LC7O 4O6VA 4GQAA 3FNFA 2GCGA 3AI1A 4K1LA 3JQ9C 2OMEA 1HE3A 3ZWVA 4BO4A 3QW2A 1EVIA 1VKOA 1IHYA 5CDTA 1C1DB 4M55A 2QHXA 3UICA 2D0IA 3ZNQA 2Y1DA 2X9GA 1EE2A 2EWMA 2YDYA 3G79A 2YQ4A 5DP2A 2D2IA 1X0XA 4PLFA 1GFSA 3K8ZA 3DZBA 5I8WA 2ZK7A 1X7DA 4J2HA 3D4OA 1HDRA 4P22A 1ID1A 3CZRA 3W8EA 3ONDA 3RQSA 4NFYA 4FBGA 3KSZO 1PGPA 4CMEA 2IXAA 1DJQA 3ETGA 5AOVA 4IDDA 1ZSVA 1EK5A 3NDRA 4I9HA 4CM4A 4RVFA 2B4TO 3NJ8A 4HX5A 4XDYA 5EQFA 3WQSB 2AQKA 1DB3A 1YBMA 1Z7EA 1R0LA 5ICSA 2VT2A 3I6IA 3FWNA 5EIOA 4I08A 1B7GO 4MP3A 1ISFA 4HFNA 3ROPA 3VC7A 5TX7A 1T1SA 1QYVA 2VHVA 3PZBA 4NJMA 2VZ8A 1N2SA 3IL2A 3FPLA 3QV1A 4DMLA 3ZV6A 4NPCA 4Q3AA 4MKXA 4L74A 4EDFA 3F47A 4CUZA 1LSUA 1PU2A 3PGJA 1DC6A 2CF6A 2EKLA 1VC2A 5IXYA 1KERA 3PPIA 2Z95A 3IP3A 1XIVA 5DP1A 1YBVA 4IXWA 1OAAA 5GY7A 2FY8A 2NU7A 3NT2A 1YL7A 4BO3A 4DL9A 1XEAA 1CIVA 5CDGA 2XPCA 2PTGA 1LC3A 4YT8A 5AQ1A 1DO8A 1GUYA 1GYQA 3K2BA 3KYDB 1E3LA 4OL9A 3MZ0A 2PD3A 1ZIDA 3GOHA 4BGVA 1XKQA 3KBOA 2YJZA 5BR7A 4XYBA 4E4YA 1KC1A 2GF2A 4CV0A 5MGBA 2A9FA 3WDSA 4GL4A 5DCUA 5JPIA 4E2YA 2ZCUA 2HCTA 2VWGA 1KEPA 3V1TC 3FNHA 4S1VA 4YEDA 4XQ9A 5KKAA 1M67A 3WOHA 4IQGA 4M8SA 3NEPX 3MWDB 3ZV4A 4CM8B 1JAYA 4LVCA 4WLUA 4DYVA 1JKIA 5CAEA 3GNQA 1E5QA 5AXBA 2OGUA 1KEUA 4XZ3A 1LDBA 2AMFA 2IYPA 4W4TA 1N92A 3VPSA 1LA2A 4PRKA 3GLQA 3TZHA 1N1GA 3DBHB 3HWRA 3ZWBA 5JCJA 4EEZA 1GAEO 1ZKMA 2VWPA 1J0XO 1QMGA 3BMOA 4HBGA 1TT5B 4KWIA 4RV9A 3K9QO 3WJ7A 4JCOA 4BNJA 1GYPA 1PGNA 2Q1UA 3ORFA 2DKNA 2O50A 3I52A 3RC9A 1HE4A 4O1MA 4E33A 4GKBA 3ZU5A 2YUTA 3OQBA 3PWZA 2YHUA 4ZICA 3PYXA 4FC7A 3SX2A 1T26A 2WE7A 3OJ0A 4G65A 1W0CA 3ULKA 1YS4A 5AXDA 4ROSA 1CRWG 4YAIA 1BGVA 4I9UA 4PGFA 1UXKA 2RIRA 1P1KA 3V8BA 4OHUA 5TF4A 3PP8A 5KVCA 1C14A 2NTVA 3GAZA 4IUYA 3S8MA 3WR5A 4E5MA 1F0YA 3BA1A 2VHZA 4LMPA 1ZFNA 4CLEA 2Y66A 4E2XA 1TB4A 2WYUA 2E48A 2JHFA 1IPFA 2DTEA 1KEWA 4PLPA 3KTDA 2OBNA 4CM7A 1ZW1A 4AJ1A 4W9NC 3GY0A 5JMPA 1I3LA 4AVYA 4JXKA 3R1IA 4B4UA 5GZ3A 4YRBA 4WEQA 3PJGA 2CFCA 1EVZA 2UUPA 5THKA 2C2YA 1LDEA 3PYLA 4D7AA 2X23A 1A71A 2O23A 4J0EA 1DXYA 1U8FO 4UUOA 1BXGA 2X0JA 3V1UA 4BKPA 1P33A 2PZMA 4D79A 4YRAA 4PLWA 3RU7A 1EQ2A 3ZWWA 5B4VA 4O63O 3WGZA 4MVJE 1ARZA 5TQVA 4BNIA 4R69A 4GSKA 5COQA 1NASA 2BGLA 4AJEA 1PJBA 3HN2A 4DLBA 4M1QA 3I9KA 2DBQA 4R01A 1IZ9A 1U1IA 4WCFC 4LMRA 3ZNNA 4FFRA 2X0NA 4GWKA 3KEQA 3OA0A 4HADA 4Z9XA 4B3JA 1LBEA 1NAHA 1GCUA 5C7LO 3JQAB 1JQBA 4P4GA 5ENVA 2P4HX 5JSFA 3K92A 4J2OA 4PRLA 2HUNA 2P9EA 2PKRA 3WWYA 3ZU2A 2HK8A 2ZB3A 5A05A 3CIFA 3QVOA 7ADHA 3H3FA 5A9RA 1G0OA 2CVQA 5ENDA 3GN2A 1X7GA 3N74A 4KMSA 5ITWA 3ASUA 3RROA 4I5GA 4ND3A 1H0KA 2BFOA 2GZ2A 1BXZA 2I5PO 3OM9A 2H1SA 1LNQA 1LX6A 3RSHA 3VDQA 4I5FA 5K6AA 3DOCA 3ONEA 3OEWA 1AUPA 1ZVMA 3AFNA 3INTA 5L7YA 1Z74A 1SOWA 3VH1A 1F14A 1LQTA 4WASA 1VKNA 4XQGA 2ZJ0A 1NVMB 5EL0A 3DMYA 3F4BA 4R51A 4XWYA 4TKLA 3PRJA 2B4QA 1F17A 3R0IA 5BSGA 2JHGA 2PD6A 3VHRA 3OETA 1HYGA 3COSA 3PXXA 5L51A 1BSVA 4OSOA 1GV0A 1HSZA 4CM4B 5HTOA 5TNXA 3ZU4A 2AE2A 2X5KO 3F5QA 1AE1A 1IZ0A 2G17A 2ZJ1A 3ABIA 5A03A 4MVJI 2Y0CA 4CR8A 3FCOA 5EJ2A 2DQ4A 1EEHA 4L76A 1LXCA 4WCDA 4YQYA 1NPYA 1N8KA 3GNSA 3RKUA 2J6IA 5ER6A 3RJ5A 1FF9A 5G4LA 2BKAA 2VN8A 5L53A 3Q9NA 2CDCA 1UUFA 4MKRA 3UN1A 3E1KA 5JE8A 4DIFA 4CMGA 3WTCA 1NTOA 7MDHA 4MVJG 4FFPA 3V2HA 3I4CA 1V0JA 3UHAA 4MIOA 3E9NA 4YAJA 3O03A 3DAFA 4TRJA 4FPXA 4ID9A 3B1JA 3FNGA 3MTJA 5IDYA 5LDGA 4QT0A 4QQRA 3ZWOA 1NFQA 2WJPA 3WWZA 1EUZA 4Q3BA 1DC4A 3OFSA 1P0CA 2FZEA 4YYZA 3BMQA 1ORRA 4L73A 3A06A 5FWNA 4YB8A 1VE9A 4MINA 2ZB8A 2OFPA 2WD7B 3HJAA 3DDNA 5KJEA 2VUTA 1YRLA 4DMMA 2VRCA 2G5CA 2JKVA 3M2TA 3D4NA 3C3XA 1HT0A 2IYOA 4YJFA 2W98A 1EMDA 1DRUA 5F1OA 1HSOA 4PG4A 3M1LA 3JQDA 3BTSA 4IDAA 4LRSB 1YH3A 4BQRA 5IDWA 4IDCA 3AI3A 1P74A 1ULSA 1LRLA 1XA0A 3GZNA 2Q2QA 2V6MA 1KIFA 1EVYA 4Z9YA 4BO0A 5A4DA 2ILTA 4GPD1 5TS3A 3FD8A 2PK3A 4RVDA 4PN3A 1O6ZA 5JLAA 5T5QA 3R6DA 3DOJA 3WB9A 5L4SA 4A0SA 3TZKA 3MWEB 5IFLA 1P1RA 2H6EA 3QSGA 5B4TA 4DC0A 3BMOB 2D3TA 2I99A 5EPOA 3ICPA 4JBIA 4GX2A 4PVDA 1HWYA 3PYMA 4WK6A 4OGWA 3BHIA 3K6JA 5C7IO 1NFFA 1EQUA 1QORA 2YV2A 2ZQYA 1MG0A 4E32A 4EW6A 1PJ3A 4YAKA 3AU9A 2Q3EA 1KOLA 4Y9DA 1ZEJA 1ZZEA 1I30A 4MVJA 2GPTA 3JYQA 3H7AA 3NYWA 1V35A 3PHJA 4IBOA 4JX8A 1CYDA 3M1AA 5JC8A 2NVWA 4W99A 4XJTA 2GDZA 2Y1EA 4WNCA 1X14A 1U28A 3AY3A 3FBTA 3GVIA 1GEGA 3EVTA 5G2OA 1E1LA 1Y8RA 3WMWA 3OIGA 1FDSA 2B36A 2DUWA 2BFPA 3D4PA 4B3IA 4CV3A 4JQCA 1B3RA 5G0SA 1Q0HA 4AFNA 3QP9A 2B37A 3F3SA 3HUDA 1ISIA 1SAYA 1ZXBA 2FN7A 2FPGA 1SB8A 1CF2O 2GR9A 3KUXA 3JYLA 4OJNA 2Z1MA 5AXAA 5TT1A 2D1YA 3GVPA 2EKQA 3O9ZA 4Q3CA 3G17A 1W4ZA 5C3MA 1G0NA 4XRRA 4E12A 1BXKA 4D44A 3ZHZA 2GLXA 1T25A 3FRJA 3NDJA 4OOFA 4UVDA 1O0SA 4UUPA 2X9VA 3BMCB 1KC3A 1XDWA 4FS3A 1NWCA 1P1IA 4A26A 1G6KA 1U3VA 2PGLA 3GQVA 3DFZA 4NHEA 3CPSA 4ND1A 4OXNA 3DC2A 3P7MA 3C1OA 4C7JA 1P31A 4QECA 4E2ZA 3GDFA 1DBVO 1XU7A 3INGA 3H9UA 3NTQA 3CZMA 5HBRA 3CMMA 4YJHA 3W6UA 2YY7A 3DR3A 4YDRA 5CG2A 4DPLA 2IRWA 2C07A 3DZKA 3KYDA 2UVDA 1GU7A 5HS4A 4FD3A 2UYYA 3ADOA 5KVVA 1XYGA 4YJDA 3CINA 2IODA 1B26A 3WGOA 1YQXA 4TWRA 4CMIA 2ZTUA 4BKUA 1EZ4A 2GZ1A 3ANMA 1F06A 2Q45A 3DMTA 3AFMA 3WGYA 2FSSA 4IINA 4F3YA 1I01A 1JKJA 3FHLA 1TLTA 2W8ZA 2JD0A 2V7PA 1LLCA 2R00A 3HNPA 1I24A 2J5KA 4B3HA 5L9AA 3CKYA 4N18A 4AJOA 2VYVD 5A3VA 2Y1GA 3GT0A 4JBHA 4OO3A 4BO9A 1ISJA 1T2EA 1O95A 3OA2A 1L7DA 3JQ8B 2ZB7A 2VUSA 5U4QA 4IMRA 5TSDA 4LVUA 5EMHA 5F1KA 5F5LA 5L3ZA 4E21A 4FJ1A 1ZJYA 2Y0DA 1EFLA 5GZ1A 2WDZA 3KSDO 4OQYA 1P1JA 4TZTA 4RQTA 1SMKA 1ZK3A 4KZPA 1NYTA 4GVLA 5K0ZA 2Y0EA 4R9SA 4RF3A 4KDFA 2LDXA 3NKLA 4RCVA 3GAFA 4RF5A 2DLDA 1Y81A 1ZEMA 4FC6A 4NZ9A 5ITVA 4WNIA 4HXYA 4XQCA 4A2CA 2LDBA 3D3EA 4RORA 4GGOA 1R4NA 3UUWA 3CH6A 3DHEA 4ILKA 1SZJG 2V6FA 4JLWA 4JGBA 1N9GB 3VVCA 3OJEA 4IY1A 4FFNA 5GZ6A 4ALJA 4R5HA 3TOXA 4CQMB 4D41A 1QG6A 3UCFA 4LCEA 3LT1A 5BSHA 3RFTA 1E1MA 3AWDA 1DRVA 3C24A 1E7QA 4KTVE 1Z45A 4WOJA 1FMCA 3DO5A 3LU1A 2ZTLA 4GMFA 3PHHA 1M66A 4NBRA 3AUAA 4CJXA 3EGOA 4BHTA 3EYWA 4DQXA 1X15A 1V9LA 4FW8A 1PZEA 1KVTA 2JCYA 2PFGA 2X5JO 1UXHA 4L4RA 4TROA 3X2EA 4ND2A 4JP3A 2O3JA 3W6ZA 4YT4A 3FI9A 4L0QA 3JCZA 4YJFB 1CQJA 2H63A 3BXXA 3DZHA 2GUGA 4OXYA 4ZQGA 5A9TA 1VJ0A 4BMSA 1C0KA 2CMDA 3TL3A 1IHXA 3W8FA 2YHIA 1QLHA 1GEEA 1NR1A 3EHEA 2FR8A 4RVSA 5DNAA 3A1NA 4W7HA 1ZK2A 2P2SA 4QEDA 4AJKA 3S1LA 1SEPA 1TXGA 1YB5A 4JJGA 3AI2A 5U9CA 4B7XA 4MOWA 1PQPA 3H2SA 2YV1A 4RQUA 1WW8A 1H9AA 2Q1TA 2WSBA 3ZNOA 5CHEA 2ZYAA 1JWAB 1NQTA 2CZCA 1E3WA 4NR0A 4XCVA 5KJFA 4B7UA 3D0OA 5KVSA 2E4AA 3KSUA 3ZW9A 2EJVA 4Y6PA 1J4AA 4AJ4A 1Y7TA 4DLLA 5G4KA 4E2WA 3CUKA 4NI5A 1NPDA 3DWFA 2RH8A 1GZ4A 1NVGA 2Y1CA 3U3XA 2NADA 1ONPA 3RD5A 3WBBA 1O89A 2QQ5A 1LLUA 5ES3A 3DBLA 2OOSA 3JQFA 3CSDA 3Q6IA 1L1FA 4HP8A 4WCFB 3VTZA 4AJIA 3SBOA 3LZ6A 3OP4A 5IXSA 3L4BC 3KHUA 4MDHA 4RVGA 1GTMA 1K6XA 2DTXA 3GVXA 2EHDA 1K6IA 1U9JA 1I33A 2DUUA 4TRNA 1Q2XA 2DU8A 4ZHSA 3TL2A 1XQ1A 3AOEC 2NTJA 4H16A 4J43A 1B15A 3DHYA 1PJTA 2NNLD 4JP2A 4PG7A 3VPFA 2X1HA 1BMDA 1YDEA 5IJZA 2PV7A 1Y8RB 1IB6A 1LDMA 5FI3A 5B37A 1PWXA 1VLLA 3VH2A 3GZ4A 3IKTA 5JAZA 3FPCA 4BNMA 2X6TA 2WYWA 4DRYA 4YTEA 1ZSNA 2QYSA 2ZCVA 2QW8A 3GG9A 3C7AA 4PZDA 1EVJA 4BO7A 3H9EO 3NDIA 3PTZA 1QLJA 3TJRA 3V2UA 4QTZA 4ALLA 1E3IA 4IMPA 5C5IA 4J9UE 4OXKA 3P19A 3JQAD 2YYYA 1WAMA 2Q46A 1RM5A 1G1AA 3ENNA 3TN7A 3LVFO 4EUHA 3PQDA 1YGYA 5AXCA 4LCJA 4A27A 4E0BA 4UEKA 3KEOA 4F6CA 2G0TA 2C2XA 1ENZA 2GN9A 3GFBA 3TDKA 4FCCA 2D8AA 3E9QA 3E03A 4WOKA 3DONA 2CF5A 3CTMA 3EY4A 2P9CA 3A14A 3GPDG 3ROMA 3WG9A 3GGGA 4I5DA 3IC5A 4DVJA 4XYEA 5JBIA 3EZLA 2RAFA 4YJHB 5DCYA 3O38A 3ZI0A 2BFMA 1GV1A 3PZRA 3BHJA 3FNEA 1M6WA 4NDNE 3PQFA 1OZAA 1RKXA 2WD7A 2A94A 4BOYA 2OBYA 4OQZA 1IYZA 2VUUA 3VDRA 4CMIB 4OAQA 3Q2KA 1LC0A 3C1AA 2BGKA 1XGKA 4K6FA 1LDYA 1F8GA 1R0SA 3L0DA 5G0TA 1AGNA 1T2FA 1C1XA 1PQWA 1WNTA 4BGIA 3MJTA 4G2NA 2Z5LA 5FFFA 3WGTA 2NU6A 3OECA 1I2ZA 3HG7A 1HEUA 4CV1A 4GAEA 3F46A 5KOIA 1H2HA 2X5OA 1AXGA 3LLVA 3ZWNA 3GVHA 1E7RA 1GY8A 2C5AA 4K28A 1QYCA 3KOUA 4OYRA 2PD4A 3S55A 1KY5A 1U7HA 2O2SA 1LTHR 4B8ZA 1NP3A 3EK2A 4BO5A 4KWHA 4PLHA 4D42A 1K89A 4E5YA 3GFGA 3GRPA 2AE1A 3O8QA 3RASA 2X4GA 2P4QA 5LCXA 3WS7A 3RC2A 2I3GA 3V5NA 3IJPA 5AYVA 3NJ4A 3UFXA 4R68A 4DGSA 3DOOA 1ONNA 1VI2A 4MVJF 4N5LA 4NMHA 5DN9A 3O4RA 1RPNA 4L9RA 1ADBA 1O94A 3WLFA 4YA6A 3QIVA 4J1TA 5COBA 3AJRA 1M2WA 1LUAA 3R3SA 4IDBA 2BMAA 4RLHA 3ZN2A 4DA9A 1R4NB 1H93A 4Z9FA 4ZA2A 4J0FA 4DIBA 4MP8A 4DYDA 3G1UA 3T4XA 2JAPA 1I32A 3Q11A 3G1TA 1EBFA 3OF2A 5DULA 4NFSA 3M6IA 1LQUA 1UZLA 1YL5A 1GD1O 4CUKA 2HRZA 4XDZA 4PG5A 3FBGA 4MVJM 4ALIA 4MVJP 3JQ9A 4NK5A 4DBZA 3B70A 3F6YA 2YFQA 3D7LA 4G5HA 2Y93A 4XIYA 3UW3A 2CD9A 4XRGA 1QYWA 1SPXA 2AQ8A 2X0IA 2PGDA 2OO5A 3EVNA 1UDAA 1KVQA 4J1NA 3SC4A 3I6QA 3ZHXA 2G76A 1LSJA 3C1TA 9LDTA 4OKNA 2SCUA 4FOSA 5KKCA 2GYYA 2NQ8A 3I9LA 2D59A 5B4UA 4ONEA 1YONA 3ZGYA 3PWSA 4F46A 4J16A 1Y8QA 2OP0A 4RDIA 2C7GA 3BMCA 2B0JA 5DBFA 2CUKA 3QY9A 1SOVA 1U3WA 4BNWA 1O5IA 3QVXA 1I10A 4LSWA 4CMCA 1T2AA 2QYTA 4ZQFA 3UF0A 1Y1PA 1SO8A 1ZO8A 5IDXA 4O59O 2YHIB 1UXJA 4D0RA 4EITA 1NHWA 3L4SO 1P77A 4UVGA 3L6EA 4KOAA 4XA8A 1LJ8A 3NRCA 4A5OA 6ADHA 1DLJA 3KYCA 5LDHA 1OC2A 4UVEA 4EUEA 4NH4A 3IS3A 2QRLA 1LI4A 4RPLA 2XXBA 3PDUA 3T4EA 3UKOA 1E3WB 1Y5RA 4WUVA 3GG2A 4R1TA 2PZJA 4QSMA 5G4KB 2PA3A 1A27A 4PLCA 4QO7A 1MC5A 1Q0QA 4KQWA 1R12A 3H3JA 4RDHA 2X58A 2I6TA 4XGKA 4OM8A 1HE5A 3E82A 3JYNA 2ZATA 1PEDA 1YO6A 3DBLB 3PJEA 3AUSA 2AEFA 1PJSA 4UUMA 5CPBA 5DOVA 1BVRA 3ANLA 3RWBA 1XCBA 1EBUA 3WTBA 4CMKA 1NX6A 4Z0TA 2JJYA 3OQ6A 4MP6A 3C7CB 3JQBC 1YQDA 2C0CA 5CP8A 1EDZA 3I9JA 4M49A 2DVMA 3VH3A 4A73A 3B1FA 1WVGA 2PR2A 4WEOA 3JQ8A 4OOEA 3OEYA 4L75A 3WGQA 2A92A 1P44A 1GQYA 3JQGB 5I9MA 2B4RO 2X7HA 1SCUA 4J4HA 3SJUA 3QWAA 1B8UA 1P45A 1EUCA 4FQ8A 1H6DA 3LC1O 3L6DA 5DZSA 3RFXA 3TWOA 4HNGA 3OIDA 3AY6A 2B83A 3L6OO 3DB2A 5A06A 5HA5A 2VWQA 3VZQA 4UAGA 1YOVA 3AM5A 2CY0A 1JW9B 3EZYA 2VYND 4FSHA 2Q1WA 5I9LA 4AJPA 3UVEA 5JDIC 3TQHA 4RPJA 2QG4A 2Q50A 4B4VA 1R16A 1PTJA 3GK3A 4TZKA 2BD0A 2J3HA 4MIYA 1N9GA 5KJ1A 1MXHA 2AG5A 4IXTA 1ZJZA 4MO2A 4NK4A 4K9DA 4EBFA 4NIMA 3ZWCA 4CQMA 2YQ5A 2FRDA 3KB6A 3H9JA 5IN4A 1T24A 3DHNA 4FGWA 4D3SA 3RC1A 5T8KC 3L9XA 3D5TA 1YBAA 2QRJA 2Q2WA 1DJNA 3VKVA 1XLTA 4KUEA 3FF4A 3AM4A 4ND4A 4HFRA 3ZW8A 4GKVA 2X8LA 1JLLA 2QRKA 3DTYA 3F1KA 4XQEA 3PEFA 2HMUA 1YDWA 1YB1A 2PWZA 2HLPA 2O7SA 2W2LA 4TRMA 3WFIA 5TT0A 1JTVA 5HS6A 3WFJA 2C7VA 1B8VA 4RPHA 1YJ8A 1K2WA 1YL6A 5TRTA 3QA9A 1C1XB 1MFPA 3AW9A 1W73A 2O4CA 1IULA 3RCBA 1Z82A 1UZMA 1T4BA 3FWZA 2HAEA 4W9NA 3VPHA 4EZBA 2YV3A 1U2GA 1B2LA 1YJQA 2YFHA 3MEQA 5ICMA 1Q7CA 5BQFA 3UCEA 4EI2A 1FDTA 4BQPA 1F8FA 4ZU3A 2JL1A 1P1FA 1WZEA 3HN7A 2HO5A 3NGXA 3DBVO 1B0AA 1J6UA 1E6EA 2O3UA 5JCXA 4BNHA 3JSAA 2HKIA 4HUJA 1P1HA 3DBRB 2PLAA 1QR6A 1QV6A 4D46A 5A3JA 3FR7A 3TFOA 3O8QB 4E3ZA 1PJQA 1W6UA 3S2EA 3JV7A 2NTNA 3AM3A 1QSGA 5I7FA 1UAGA 2JCVA 3CEAA 1AN9A 2NM0A 8LDHA 3VAZA 5FEUA 2Y05A 2ZYGA 4WCFA 3BYZA 4GLOA 4ZVVA 4LN1A 1KY4A 3WYCA 2EP5A 1X13A 5JNLA 1MB4A 5A5FA 2W2KB 1R15A 3SJ7A 1N7HA 5MDHA 4ITUA 1T4DA 2GD1O 4URFA 3JQ7A 3ST7A 4FJ0A 1HE2A 2VRBA 5CFZA 5KTKA 5THQA 4IGEA 2BLLA 1R4MB 2NVUA 1PIWA 5A9SA 5COAA 2Q4BA 5ILOA 3ROQA 1PL6A 1GPJA 2DM6A 2FPIA 2DBVO 1UDCA 4PZCA 3VTFA 8ADHA 1P0FA 3GEMA 4WKGA 2FWMX 4R5MA 2HJSA 2E37A 2VHXA 2XOXA 3RUHA 5JAMA 1UZNA 3GF4A 1NQ5A 1PL7A 1KVSA 1N5DA 5JYDA 4I5EA 1PR9A 2NQTA 3ON5A 1KYQA 4E30A 1ADGA 3QWHA 4IJVA 1B14A 1GDHA 1OI7A 4LK3A 3PVZA 4Q9NA 5EN4A 5JDCC 1DAPA 1U8XX 3O26A 1LRKA 2O3TA 1IY8A 3QVWA 1XWFA 4YBZA 1OFGA 2GN8A 2AW5A 4H15A 3GEDA 4M54A 1Y8QB 3GUYA 3JYPA 5FF9A 3W8DA 5G0VA 4ALNA 4EYEA 4CR7A 1PZGA 4F6LA 3BHMA 3D5QA 4KUHA 3GR6A 3RBZA 4UEJA 3ZH2A 3QRWA 4HNHA 4CM1A 4Z0HO 1HDYA 1Q1NA 1MUUA 3K5PA 3HHPA 3ZWPA 5JFOA 3H9GA 1GZ3A 1O9BA 2HMTA 3ZV5A 2YW9A 3W4JA 2VYVA 4R1UA 4RVHA 4AJ2A 2J8ZA 3B20A 1E6UA 3KRTA 4MVJH 3HDQA 2O3QA 4MVJD 1VPDA 4ZRNA 3SEFA 4N5MA 3KYCB 4BGEA 2PKQO 4CLOA 1E6WA 3WBFA 1R0KA 4ZQBA 2I9PA 1E7MA 3ONFA 2FHSA 1QV7A 4ALMA 2JD2A 5TJ9A 1JVBA 2Y67A 2DFVA 3N58A 2EIHA 1P3DA 3K30A 4IZIA 4YCAA 1BTOA 4ZD6A 3RU9A 3T7EA 3T7CA 1PR3A 2F1KA 5T8KA 3GA0A 4IGFA 4A03A 3IP1A 3JQ6A 3F9IA 2VHYA 3PJDA 4RZIA 2VZ9A 1UH5A 5KIAA 4BGUA 4AJNA 1EFKA 1NR7A 1PJ2A 3DAGA 3E9MA 3RVDA 3HDYA 4IIUA 1HLDA 3NTRA 3EC7A 4HFJA 4B4WA 1OOEA 1XELA 1KVRA 2GNAA 3RUEA 1DEHA 4A10A 1XG5A 3K31A 4Z6KA 1C0PA 2WM3A 5C7OO 4Q3EA 4ZGWA 4NQZA 1MFZA 4CMEC 5DDIP 4KDEA 1MC4A 4LGVA 2BI7A 4XJSA 3H6KA 4ZQHA 4CLXA 4CMAA 5L7TA 2Q1SA 2VWHA 5CEFA 3SLKA 3NX4A 1E92A 3ETDA 2AG8A 3KLPX 4MJLA 3VVBA 5J23A 3NT5A 3GUCA 3AUTA 1UAYA 1I8TA 3TFQA 1SEVA 4JJIA 1YB4A 1YOVB 3P2OA 4JN6B 5JO9A 1HDCA 3S2FA 2R6JA 3WYBA 2C54A 3DL2A 4BV9A 1PGQA 1ONOA 4BNZA 1EK6A 2NACA 1MA0A 4N5NA 1U4SA 3LYLA 4DBVO 4L4XA 1N7GA 4U6SA 3IJRA 1I3NA 4BNTA 3G49A 3AUUA 3HDHA 1I2BA 2O3RA 1I5RA 4NU6A 2CSUA 4DQVA 3QHAA 3RUFA 4CV2A 2BH9A 3AY7A 4DQUA 2C59A 2VQ3A 2VOJA 1E77A 1NM5A 3KXDA 3ITKA 1A4IA 1RM4A 1E5LA 5T57A 1VJTA 4GH5A 4II2A 2TMDA 1QYXA 5L40A 4PCVA 4D3FA 1NHGA 3GPIA 3I23A 3N7UA 1UJMA 4HKTA 2ZTVA 3OIFA 2EF1A 2WTBA 4Q3NA 1LSOA 4YJGA 4DREA 4YAEA 1A7KA 4PLYA 4PIVA 2PKQP 3IDSA 3A28A 4FFOA 4KP7A 1A72A 1DC3A 1SC6A 1QYDA 2DBRA 2PGJA 2RCYA 2OXIA 3VZSA 3M2PA 1JDJA 1CJCA 2FZWA 3NV9A 2JD1A 3FR8A 2IZ0A 3E6AA 3U49A 3ZWMA 3WXBA 3E48A 3JD3A 3U09A 1DFIA 2DT5A 1C0LA 5EQDA 2P5YA 4NU5A 1X0VA 4UEOA 2IZZA 4OKIA 1IL0A 1I3MA 2Y1FA 3QQPA 4M87A 1ISHA 1DC5A 4DPMA 3OJFA 1SB9A 1PZHA 5BNTA 1ZH8A 4IZHA 3VPGA 4BB6A 2C20A 5JY1A 4Y6RA 1DDOA 4BNGA 3MJVA 4J1QA 1T1RA 3DFUA 3ASVA 4WLNA 1RM3A 1JN0A 3GHYA 1WDLA 1KS9A 3BTVA 1D8AA 3RKRA 3MTGA 2PZLA 3KV3O 1W8DA 1WZIA 2XXJA 3RFVA 1IPEA 3PFFA 2X0RA 2WYVA 4J90A 4FGSA 3ZNPA 4IQ8A 4GMGA 2JFFA 3KETA 5B1YA 3L07A 4FJ2A 2CDAA 2VOEA 1PS0A 1LLDA 2P9GA 4YXFA 1ISMA 2NU9A 3E5MA 1Y6JA 4NJOA 3H5AA 2CNBA 2CVZA 3JQ7B 4NG5A 4BMVA 1U3TA 5KNLA 1C0IA 1OMOA 1WLYA 4JK3A 4L4SA 3DZIA 3C85A 1C3VA 3JQGA 4JIGA 2NVUB 3RUCA 2OL4A 5A9SB 5G0UA 1D3AA 1VSVA 5F3RA 1DAOA 3KM0A 4R1NA 3K96A 2B69A 1MXFA 4BO6A 4BNKA 4OH1A 2GASA 1PQUA 1WDKA 2GN4A 4GLLA 2DPHA 2W4QA 3B1KA 4JBGA 2JAHA 1ZCJA 1M6HA 1K3TA 4XYLA 4PZEA 1CEQA 1VRWA 4PG8A 1E7WA 4Z3KA 1RYEA 1UP7A 3NAQA 1V3UA 2EKPA 4J49A 4AJHA 1NFRA 2BGMA 4R1SA 4CQLA 3TPCA 4AICA 5K9ZA 1HDOA 3PQEA 5F1PA 4GX1A 4TVOA 2I76A 4CM5A 2HRBA 5BSFA 3PDJA 3WSWA 1VM6A 2EG9A 2VNAA 2VZ0A 3QLJA 2WMDA 4IDEA 4TRRA 5F5NA 4BO8A 5CEJA 4NBWA 1DRWA 1NQAO 4QO8A 4CM9D 1UP4A 1JWBB 3ZDFA 1A5ZA 4IS2A 1R6DA 4YWJA 1XSEA 1X1TA 3GDOA 2PY6A 4GBJA 5TGDA 3TOZA 2GRAA 2OP1A 3IIEA 4PFJA 4BB5A 3I1JA 3PK0A 4DPKA 5KJCA 3DXFA 2O4UX 1GL3A 3ETEA 4TKMA 2VCYA 3TNLA 1QXSA 3AOGA 5L4NA 5KVQA 5DCWA 3KYBA 1D4FA 3OMLA 1BRMA
chains in the Genus database with same CATH superfamily
3L06A 3FLMA 3EMBA 2WQZA 5DGIA 4B6JA 4TXJA 3E58A 1GT6A 1QDUA 2XQIA 1UOPA 3FYHA 2WB4A 1X94A 2EGUA 4XYMA 3LP5A 5DHRA 3ROEA 1SXQA 2JDIA 2DMRA 2Y9MB 3QOYA 5IZ4A 3ADCA 3CKMA 3EXAA 4ZRMA 4PC1A 3CXUA 3KXPA 3G2PA 4HLNA 4LDPA 4N0QA 4EH1A 1U9ZA 4F21A 1HKUA 2D4HA 1S5PA 3ICOA 1D1TA 1TADA 4UAJA 4URZR 1KDYA 2XRFA 2ZIGA 2XT6A 5D3MA 2Q8PA 1RPJA 4QOJA 4XIIA 2IZ1A 4ISBA 5B7QA 1XN4A 3EZ6A 3PX7A 2H2FA 3KD2A 4FE4A 3FN4A 4RCZA 3CSUA 3LKBA 4WGGA 5AVQA 2VNSA 4IS3A 3R2JA 1DAEA 1BWRA 3W34A 1G5FA 2I29A 2FK7A 4BXOB 2JEZA 2NLOA 5TLSA 3I9OA 1LDGA 1CF9A 1NXQA 4FUQA 4JUBA 3NRBA 3UAYA 5FOQA 1VP3A 2EBUA 3P9SA 4QG7A 2H2HA 1WMAA 2PUVA 4US1R 2IEAA 1UPFA 2GXUA 1VL8A 2GDJA 4R54A 2UZ1A 4OSPA 3BTOA 3TZBA 2PUJA 1JUDA 4FZVA 3WO0A 4DA8A 3RIMA 2LR0A 3VOTA 5EP2A 1D1QA 4H1HA 1NBHA 1P4AA 3FDZB 1WF3A 3PFIA 4JHLA 1YR2A 4P31A 5GPBA 1U94A 2CE2X 3EAFA 3G5LA 4MV9A 2BUAA 2B2NA 2FFBA 2ZT6A 1FS6A 2IA5A 3QXHA 4COKA 4ABTA 1E0KA 3KCQA 4D0SA 1CV2A 5K5EA 2C9BA 4HZGA 5JAIA 1W0KD 3JY6A 4DJFC 3GLHB 3SHFA 1AZTA 4MNTA 1U2PA 4CODB 5IANA 1NQOA 4NY1A 2FPRA 3KCNA 4JGIA 3ZD8A 2BI8A 4CZ2A 3Q5GA 1G21A 5CDYA 3W0LB 4ZZ2A 3WYEA 1IMJA 4KQGA 4NBVA 2QE6A 3FFXA 5KC9A 2LCFA 2AHRA 1P0IA 1Q1QA 3GRFA 5H02A 2OPBA 2YWJA 3VSBA 4NCIA 3GFVA 1HL3A 1SXIA 2WEKA 2E89A 4P4NA 1KFEB 5FTNA 5H83A 1TT7A 5CW1A 3FHTA 3QXSA 4EB0A 3BJRA 5JRDS 4R8MA 3THRA 5HM8A 5KTNA 2Z6AA 1KARA 3DT6A 3HP1A 4F5DA 2H00A 4JJAA 2Y76A 3HADA 4GBMA 3VH4A 5LP6B 4WKNA 2BUCA 3THSA 1NL3A 3VR4H 3ZHBA 1MAHA 1KZ7B 1C50A 4TL6A 1I5EA 1HDZA 4TOIA 1OBVA 1NI5A 4ZT2A 2H9IA 4BLUA 2AWOA 1WXWA 3WNVA 2W2XA 3L77A 3L4BA 3WDLA 2FHPA 1WKVA 3MW8A 4RU1A 3Q8LA 4OI2A 3F4LA 3LC2O 1CUGA 4Y6GB 3PNBA 5K99A 2J85A 1W75A 2XA9A 3IKMB 1KXZA 3L01A 4RDXA 1V7PC 2J7PA 4HV4A 3PITA 2NP6A 1M8FA 2PX5A 2AJLI 3OEHD 4QU5A 3LBYA 1M5TA 1PX0A 1WVMA 2DC1A 4MRVA 1VIDA 5HFAA 3R9IA 5KMGB 1V8DA 2D62A 3O3MB 2B2CA 4FT4A 5KPJA 1Z75A 4XVHA 3I5YA 2AW3A 2WF8A 4MV6A 1JQAA 2P41A 3MBKA 2XWSA 1E1RA 4PYRA 3A25A 5FT9A 3FPHA 4OSEA 1KI9A 4ON9A 5AJUA 4Y2RA 1AKTA 4QICA 5D51S 5KOYA 2HHLA 4J75A 4R41A 5U1PA 3RIHA 2EIXA 4MUKA 2RKOA 3PI6A 3RUPA 2OV4A 1NBMA 2WG1A 2FMHA 1QYIA 5F3WB 4KO3S 3H9BA 2WWXA 1V4BA 4X66B 1LLQA 2VLIA 2FRVA 4RKYA 1UJ2A 2J87A 4MB2A 5JPCA 2OKCA 4Y8VA 1QQ6A 1G38A 5BQOA 1ZJJA 4HWKA 3ORHA 3AHCA 3Q3CA 2VT3A 2RGBA 4MIEA 3GFSA 1BN7A 2NV6A 2R751 2H29A 5BSVA 4DA4A 1TVMA 1K68A 4M38A 5IDQA 4Z4CA 2OWEA 4EGQA 3OBIA 2W11A 2QN2A 5BOVA 3SOPA 1IBCA 4IOJA 2B34A 4X84A 4DV5B 1BQEA 4XD2A 3GQBB 3FKQA 5ABPA 3ZX5A 1Q3TA 4ED9A 1DKUA 4RD3A 1V6CA 4R7TA 2EGHA 1KYVA 1VKRA 3ZVMA 2V74B 1HH4A 4Q4HB 4WH0A 3AR5A 1NKTA 2PT5A 2ZJ8A 3KZ1E 1NI3A 1Z68A 5KX5B 1KBZA 2Q29A 2O52A 2WD8A 4JVMA 3OZ7A 5HK8A 2RGRA 5JQGF 4BKQA 3NUGA 1X8KA 1QRUA 2RG1A 2UYCA 1L7MA 3MT0A 3BXFA 2EW2A 3MMNA 2WZBA 4PSCA 3RO7A 5LQRA 2D5BA 3KE9A 1O03A 3FG9A 1A2QA 4CMHA 4KWTA 4O4HB 1TD9A 1JE1A 1MVLA 3ZQJA 1YA8A 4XW2A 3VPDA 2EC5A 1GOTA 4QXQA 2DECA 2G82A 1PT6A 2QUAA 3QU5A 3S7TA 3UH1A 1PJ4A 4GDMA 2ZZNA 2O1WA 2BLNA 3QG1A 3UJ7A 4EY8A 1CKEA 1GR0A 2A9QA 2ZRAA 1XNJA 3CYFA 1DAGA 1H6BA 2P91A 5LC1A 4EGCB 4RTRA 2PUGA 3PLNA 2D2FA 2VR1A 1R27A 1BW9A 3A9VA 3TDMA 1AVTA 3Q40A 1XAIA 1WDMA 1Q6ZA 4IRUB 5SYMA 5CDFE 2P5UA 2GPSA 3F71A 4IGIA 4FMCF 1MZVA 3RBVA 3WLOA 5DK4A 3MT9A 2B1GA 2XUPA 1XWWA 4IG4A 4TQ9A 5G40A 4ZPXA 1QF7A 2J3JA 4NBTA 4Y2PA 3OJOA 2QRZA 2YVKA 1AO3A 3TZ6A 1RR6A 3WV5A 3MINB 1LW6E 4YCSA 1DIHA 4B79A 1YSCA 4DMRA 2P8SA 1D03A 5JJLA 3K9LA 2CXSA 3A0UA 2HEGA 3JYHA 2DR0A 1TKRA 3JZDA 2G1KA 4IIDA 1S0UA 3ZCXA 2VTDA 3RC8A 3MHPA 1KTIA 4U6NA 4CL8A 4BNUA 4DMHA 1G60A 2R84A 3O5AA 4XM0A 4ZMSA 4M86A 1AIPA 2XVYA 1Q7RA 3UT0A 2DG2A 4BV8A 2JGIA 5A04A 1UT5A 3IOEA 2FPXA 5KC8A 1H1DA 2WJAA 4G01B 2RHCA 2PEZA 3E3NA 2DXIA 1KJNA 2Q5JA 4R2XA 1Z2CA 5AK0A 4FDAA 5DBHX 3GD5A 4X41A 1JH9A 4WN9A 2WIJA 3W2HA 1K97A 2DPGA 2VXOA 2IHUA 4LPKA 1KMMA 1NT2A 3NUZA 3ZE0B 4I3FA 1U5BA 2B82A 2FSVA 3GMDA 5ILGA 3ZIUA 4FHZA 2JGDA 4OHFA 1EUYA 1C1YA 1LB1B 5E4TA 3LQYA 2QLMA 3HI6A 1KSFX 3KDAA 3SDBA 1USVA 2A35A 4L3WA 3TEMA 2FPPA 4K1XA 2NO9A 7AT1A 3JVUA 2NUAA 5EPUA 3JZIA 5IAJA 4RL6A 4AMBA 4OJTA 1B8PA 4Q3LA 5K0BA 2UXBB 1RHUA 1LVHA 3K9CA 2DULA 3KZVA 4NF2A 4I1IA 2ZYRA 4COOA 1L4BA 3L9WA 2VYQA 4O4IB 1EAMA 5D01A 4Z3DA 1FL9A 2YL2A 4ND5A 5K05A 1H2ZA 1XDDA 2F3TA 2QR3A 3AUYA 4G23A 4HFMA 1FFDA 1CZRA 1P4SA 1JLKA 1XJ5A 2VQDA 2XMGA 1CUAA 1Q1GA 2PU5A 2FW9A 5CEEA 3U1BA 1Q16A 2AOTA 2ZQ5A 1PG0A 4MWZA 5L95A 1MCZA 5DXFA 4DJAA 1MC8A 5FNVB 4UNNA 5D87A 1BFKA 2WG0A 2O0JA 3LYAA 4RO0A 4IIJF 3QV2A 1V3TA 2OZLB 2YWHA 3LM8A 4J9VA 1ZGHA 1YF3A 1PT8A 3GN1A 3NYIA 1TTQB 4L5JA 1BA3A 3L5OA 3PHIA 5CJJA 2WRZA 2WUFA 3E5RA 2HGSA 4OFXA 4IF6A 3GEGA 4C7KA 4YP5A 1MZPA 4PYMA 4ZVTA 2PXXA 3F78A 1XU4A 1QKIA 3HV0A 3R3XA 2X86A 5JZBA 3EQ2A 1MX3A 5FTJA 4E31A 4YDHB 3RUDA 2WZDA 2XMDA 1FIUA 4TSRA 5EEGA 3C48A 2Y4OA 1C7EA 3KB1A 1NN5A 3PFWO 2FWAA 3LT4A 3EEBA 1WCIB 4NNJA 1AQUA 3B9QA 4RSHA 3AMVA 4PVCA 4LAFA 3RK1A 3R44A 4HAZA 4RELA 1PJCA 2HJHA 1S2NA 3NHPA 4U0KA 6NULA 3CCFA 3CH7A 621PA 1U11A 3E3MA 2A9KA 3PRKE 1TQHA 3RTCA 1M2VB 4H0NA 4CVNA 4FU0A 1GUDA 4XI9A 1XZCA 2A9JA 5TJHA 4KPUB 3DZGA 1QLWA 4QWMA 1Y5MA 4UD6A 3UM9A 4UEWA 4S1NA 1FFXA 4ZYLA 2FWBA 3EDRA 1M1YE 3DV9A 4M1OA 1SKYB 4XIJA 1CDZA 5L3QA 3SC2A 3H5NA 1Q11A 1R9NA 2QB5A 2WV7A 4JGGA 3SE7A 2DR3A 2HWKA 3CEMA 1K8ZB 3OH8A 4GFDA 4D26A 3BAZA 2K2QB 4UBMA 2VRCD 1NIPA 1FYVA 2GERA 1E0DA 2ACKA 2ZJBA 2V6IA 3Q7SA 4FFLA 2VPZA 3F4KA 4I0WB 4DLRA 2R6CA 3DZFA 3OAAA 1TA9A 4I99A 3TLBA 3Q2IA 2N1BA 4TQGA 2IOFA 1KVUA 2KLHA 3LDHA 1VL6A 1C1DA 2AXNA 3IQDB 2WWRA 1T4CA 4GPIB 2AI3A 3JQBA 4I9GA 5KS2A 1CETA 2E3JA 3KJGA 3G0HA 1XTRA 1GLGA 4YBRA 1AT1A 1RSZA 1UPBA 4JBLA 5AI4A 3VPBA 5IH7A 1GCOA 2C58A 4NOLA 2G70A 1CWUA 3TQRA 2H31A 3Q6MA 2C5FA 3JR3A 1RQ7A 3LOPA 2O3SA 3MJEA 1K6JA 5H3LA 3ANXA 1JIQA 3C6XA 2O6LA 5HXAA 2EX0A 2PMFA 2HUPA 1YHZA 2GPWA 4A8TA 3EBOA 1R5NA 4FIZA 4HYTA 1H05A 1C3OA 4KQJA 5E9WA 4TV8B 5M04A 4B1FA 2HLHA 5TC4A 2ZB4A 4A0FA 2I4NA 1Y82A 4IV0A 4HDRB 1I5OA 1PQYA 2IYVA 3JXEA 4D45A 4D81A 4ZZ3A 3T9EA 5G3YA 5KWEA 3FPSA 4H0FA 4DRXB 4BZWA 1TECE 1XCPA 2WA2A 3LLSA 4ZQCB 5D85A 2FR8C 1WZCA 3I72A 5CB4B 5DHSA 3OCUA 2CLEB 2VHEA 4LDJA 1L5SA 2IIPA 3WIEA 3X44A 1B4DA 3IPYA 2KJQA 3SCZA 2IYUA 3E5NA 2LCQA 2K2WA 1KMCA 2JFGA 2ZT8A 4NAHA 2EV9A 4KUGA 2X9LA 3OTIA 3ZK7A 2IK8A 1ZSYA 2WSSA 4CF4A 4OL0A 4UU1A 3G3EA 5AUOB 1R66A 2C8VA 5AVWA 3O0TA 2AJCA 2NO4A 4M60A 2GQ0A 4YY3B 3D1LA 3UMSA 4ZQEA 1YQGA 5B53A 3NS7A 5JI2E 1G6OA 1HZZC 1W88B 4UUNA 2QTBA 4IUCS 3TLJA 1ZNZA 2UAGA 4Q4DA 3L7IA 4HH1A 1J56A 5IH3A 4B6OA 2VSXA 4BQFA 3LF2A 4GPAA 2EW1A 4UMEA 4QEKA 2FR0A 4ENQA 2IXBA 1FE8A 2IPNA 3EW7A 2AZMA 2NTEA 3S27A 1PR4A 2GO7A 4J4TA 4QBTA 1D1SA 1H5NA 3IE2A 3NHMA 4QARA 4QPNA 1QGDA 2CHVA 4RZHA 3U7QB 4AN0A 4CMJA 4BXOA 2DR2A 3TZQA 1G9TA 5I7OA 5LIPA 1CBUA 4M36A 1QYRA 1E2JA 3L84A 2H65A 1K5DA 5E4YA 3SHWA 1GAWA 4KIUA 4UPDA 1OLXB 4HQ6A 4WDRA 4XYGA 1TYDE 2Z1NA 4IRXA 4DTIA 4CIWA 2C7BA 4G5QA 1YI8A 4LTDA 4KR9A 4O2AA 1SHTX 4OU5A 4X20B 5I9IA 2X41A 5J47A 5I4KA 5TIIA 5BNFA 5CM8B 1SBCA 1SCQA 1X7YB 3I2HA 1F4PA 1BOFA 1REQA 2IY9A 2YHSA 2PJUA 1YVPA 1KH2A 1QRDA 4EW3A 4U00A 3OZVA 4IPTA 2Q6KA 3FVRA 3HE3A 3HBLA 4YLGA 3DEKA 4P0TA 1Y1QA 3GV0A 4QXAA 3RFFA 5EZQA 4DV0B 4UAVA 1RWQA 2X76A 2O2IA 3GWZA 4NYJR 4TSKA 4B3RB 3K0FB 3AUKA 3EB9A 1OT5A 1WY5A 1N7IA 2VDLB 1KGDA 1OZGA 1WCXA 3H2ZA 1BDMA 1B93A 4ACAA 2O59A 1CUDA 4IDFA 2VP9A 3A11A 4MW7A 4NOMA 5A7HA 4PO9A 4DHEA 1YDHA 4UM9B 2C7QA 3AVVA 2NNWB 1J06A 4LOLA 4O3FA 5E1BA 4AO8A 2MDTA 3BZBA 1ZXLA 4PPFA 1FXSA 2O8DB 1ZGJA 1JH8A 3T9FA 3F67A 2ZRKA 5K51A 4NYMR 2DB3A 3OOYA 4UTZA 2B5WA 3QKSB 1WXXA 2C2ZA 3LPLA 3KLMX 3SXPA 1FNSA 1YQ9A 2QSYA 2YIJA 5BPHA 3U13A 4IFEA 3CPEA 1TEHA 4XTCS 1PKEA 1E9CA 3PUVA 2Q6LA 3FVTA 1R74A 4BLSA 1W44A 5BURA 1Y34E 3SSMA 3T52A 1N3YA 3BK1A 2Y0BA 1ENOA 3TXXA 2PKXA 3J7TA 2FWJA 4E11A 4K0RA 3DEJA 2FMUA 5IF3A 3QU9A 4HNTA 4OXXA 3RADC 1U98A 5CX1B 3HB4X 5BSTA 3WGHA 3ADPA 4P54A 5L4SA 3HR8A 4BS9A 4D80A 4TMZA 2V59A 4U4AA 1M7GA 1E9BA 2BF7A 2OBFA 3AU8A 3QFRA 3S2GA 4B6FA 1TCVA 2W6JD 1JR3D 4GI2A 3O1JC 1VYVA 4LDNA 1WMBA 2Q3LA 4Y2UA 1MAAA 1QIGA 4GZMA 1GADO 2V7XA 1HDGO 4URYR 4MV4A 2G0AA 4WIAA 1QRSA 2HB6A 1CYEA 4Z1MA 2VQFB 3EFOA 3UHJA 5K8JB 3FTCA 1SCIA 2OK7A 3IAXA 3T41A 4JC4A 1BG6A 1EE1A 2EDCA 1EUDA 3JAMA 2V54A 3C3AA 5D3QA 1OBHA 4B46A 3EXFB 1CRQA 3OLCX 4P83A 4RYLA 4P7GA 1OYVA 4FFDA 3SR0A 4PZ9A 1XQ6A 1P2BA 2GCPA 3KJNA 3QLUA 3VKFA 4UJ5A 1U0RA 1AO0A 4AYXA 3CZ9A 3RS0A 4JJFA 1DIRA 2JLQA 2N0SA 2DRIA 2H51A 1IN7A 1IN6A 1EWKA 3GQBA 3R3JA 2WJJA 3DP7A 3BMNB 4K5QA 2NAFA 1NVEA 5I7VA 1J70A 1L4KA 3E2IA 4HLDA 4JLNA 1TAHA 2RHGB 2QRPA 3HO6A 4FYWA 2W8BA 1N5OX 3WICA 5KX5A 1D5CA 5E6SB 4EJSC 4G2TA 1TYBE 3G5MA 2W5UA 4L0CA 4ZREA 3AV3A 1D09A 4RIIA 1PSDA 2ECKA 1Z35A 4GVXA 4QELA 2C9ZA 1KJJA 1FJHA 2QN1A 3I1IA 3H0EA 3K53A 2XQGA 4MB6A 5ECWA 4RTOA 1TMYA 4YWHA 1YDFA 4MAFA 4EUFA 1MJ5A 2OE2A 1K9VF 1LVGA 3V8VA 5A4IS 4L50A 2OORA 2V4UA 1S3SA 4FI3F 4FFVA 4ER5A 3M4XA 1EYZA 1W8IA 1XZJA 3IOBA 3E3OA 3I76A 2EJUA 1DUSA 1YCGA 2QUIA 4YIKA 3SM9A 1O3YA 1T9HA 4BKMA 3ITDA 3IAS1 4RD1A 2V0CA 2I78A 1JALA 3EDMA 3I4FA 2Q0SA 1E1DA 2HMSA 2OBMA 1CE8B 5FYDA 2P2GA 1X7WA 3M3PA 4ZIRA 4FXOA 3EXEB 2QN7A 4W5WA 4YCBA 4CM9A 2XDWA 3HABA 1RYBA 5B6JA 5IS2A 1WD7A 3AVPA 3KUKA 4R0VA 4BMZA 5FPHA 3CGWA 2F00A 4ZCTA 3NIDB 2DSNA 3AI1A 4IZ6A 3DLCA 2VJCA 2KBFA 1VKHA 5EE5B 4IMJB 3HU1A 4FLEA 4MDEA 1EVIA 1VKOA 2COUA 2ZROA 1VTKA 3RVJA 4BQQA 3LRPA 2O06A 5EJ4A 1J42A 1U7PA 3ZNQA 5KQPA 3U61B 3AL2A 1VG0B 3FCCA 4OGKA 1WX1A 2OO5C 2YDYA 3W3AH 4AC9A 3WFZA 2NXWA 1N8TA 3TTSA 4HATA 4WX2B 4TXNA 1OH5A 3K8ZA 5I8WA 2R7NA 2I7VA 2OM2A 4L4YA 3P27A 5EG5A 1ID1A 3FJ1A 2WWTA 2PRKA 4K6OA 2X3FA 1W5SA 1PGPA 2FZGA 4P5PA 3D02A 4DDWA 1WUTA 2W9XA 5LQCA 3NXSA 3IO3A 4WADA 4CM4A 5A62A 1GAQA 4ZCSA 3C6QA 3GPBA 3IELA 1KORA 2AX4A 3QBTA 4RVFA 1D9ZA 1EWVA 3AESB 4HX5A 4E88A 3HXQA 1KSJA 4MQEB 2AQKA 1YBMA 5EE9A 3K5IA 3V97A 3RJZA 3WQSB 2VJNA 3A2MA 3GEIA 3H17A 4PEVA 4Y1GA 2HNBA 5ICSA 3SYKA 2P0AA 3UAVA 1L4FA 2A9RA 5I8PA 1B7GO 2J6BA 4C7OB 1VRCA 1K08A 1CR4A 4B85A 3SZOA 3HDGA 1QYVA 2FZ4A 3NU1A 3KKQA 3PZBA 4FBMA 4FOTA 3OPMA 5CIQA 5J2TB 5A0VA 4RSGA 5KYWA 1OHHA 3A9CA 5TF0A 4E94A 1XAJA 5JZVA 4Q66C 2V7EA 3KQPA 4MKXA 5C0OE 4LRWA 3ER8A 1FP2A 5EIHA 1P72A 2W6OA 4NE7A 5EZ6B 4D8XA 2CF6A 2EKLA 2MSLA 1NXXA 4GGMX 1Z17A 4O4IA 5IXYA 2IYLD 4CT0A 1BYIA 1N8SA 2B0CA 3IP3A 5BV1A 1L1QA 3OOHA 4B2LA 1OAAA 2A7XA 1JQKA 1OTXA 2FY8A 1KQ3A 3ZE2B 4Q02A 4BO3A 4DL9A 1QJCA 1ZM7A 2BL4A 3D54D 1CIVA 4INZA 5IUJC 2R25B 4LF4B 4YT8A 2PTGA 4NYIQ 3VYSB 1UMBA 5I9TA 3ONWA 2QL6A 1QH1A 1XTZA 2IF2A 1HDIA 3AG5A 3OMXA 3QKRA 3K2BA 1H5UA 1E3LA 4PE5B 4TM8A 1O7JA 4GU5A 2X4DA 3ECCA 3KKNA 1ZPDA 4FS8A 2QXYA 4BGVA 4EG0A 1U9IC 2HSWA 3ELDA 3ZCVA 4ZK6A 4Y0AA 2DCMA 1WABA 3VR0A 4E4YA 3P4YA 5LLTA 2IXTA 4A6DA 2JKZA 4Z86A 4CV0A 3KD3A 2A9FA 3DMFA 1QK5A 3WDSA 2VF4X 2E5FA 2ZSDA 5DCUA 4TYWA 3F5FA 4RD2A 2JAXA 2WHXA 1Q50A 4UKDA 5IJ0A 2F90A 1D6SA 2J9YB 3K0HA 2VNHA 3PDIB 4S1VA 4BZXA 4QDJA 3HYRA 4P5EA 3CLUC 2GJSA 4RANA 1M67A 1W36D 1LPMA 2YXBA 4IQGA 2RKWA 2H1IA 4OCZA 4HMPA 5I51A 1JAYA 1UFVA 1XX6A 2GXSA 4WLUA 2J0SA 4TXHA 2CXHA 1L0BA 1BEZA 1JG6A 1QG0A 3HB9A 1QP4A 1E5QA 1TAQA 4G4GA 4TTAA 2SNIE 4GKKB 3MELA 4L6CA 3Q41A 3PTLA 5BT8A 1N92A 1ZJ5A 2EVWX 4MARA 4R0NA 5AICA 3TZHA 1H2WA 5FCDA 4OIFA 1GKYA 3W5HA 5CB6A 1GHTA 5JCJA 1EG7A 4RJ2A 1E8MA 1GAEO 1OU0A 1ZKMA 1QMGA 2VWPA 5D3ZA 4DFDA 1QRTA 1BH2A 3H2KA 4JCOA 4GRDA 5IBQA 4BNJA 3NIFB 1J8DA 4DCCA 4P82A 1FTSA 3H5LA 1JR2A 4K88A 4NCHA 3I52A 4Z9AA 4JI6B 3ZHVA 4DCNA 1HE4A 1VYHA 1D0VA 4GKBA 2YUTA 3PWZA 2ZSUA 4OJMX 4CF3A 4ZICA 3ZBPA 1T26A 2ZIEA 2VAPA 1YRYE 4A8PA 4G65A 1N5MA 2YOHA 3O4GA 1G17A 1KH3A 1GCIA 1SD1A 3L0BA 5AXDA 2ZDGA 4YAIA 3NEAA 1DXOA 3SQXA 1U80A 2QN9A 4QGAA 3T1YB 1AV7A 1RXUA 4H7IA 4OHUA 4YYEA 3PP8A 3TZEA 4BC1A 1TK3A 4X7RA 2NTVA 3E2MA 3GAZA 3S8MA 2ZVPX 3PC6A 1U8UA 4N3GA 2LW7A 4RJIA 2GKOA 2JB9A 3BA1A 3C3JA 1MVOA 4LXGA 3V4PB 2XT9A 4IDHA 5IPFA 2RKBA 3EUFA 3LUCA 3MTDA 4E2XA 2F43B 2HTEA 3DNMA 4ABYA 4I55B 1XVTA 1KEWA 4PLPA 1HFJA 4GR4A 3AERA 3JASB 3T54A 4AJ1A 4CM7A 1DJMA 3NTUA 1M1YB 1QPBA 4PPNA 5B3AA 4W9NC 1LZKA 3G8AA 1S7GA 4F2PA 5LOVF 2MR5A 5DGDA 3ESZA 1FSZA 3GELA 2CL0X 3L4EA 3R1IA 4J0JA 4JXKA 4Y2XA 4YRBA 2BFBB 2NV2B 4IZOA 2CFCA 3Q12A 5F4BA 5JFGA 4DY4A 4C0LA 4F4IA 2DQZA 2XQKA 5FYQA 4D7AA 5IASA 2JBAB 2O23A 3CV3A 1DXYA 1U8FO 4UUOA 1XNRB 4D8WA 3IV7A 2PX4A 1P33A 4V1CB 2CXXA 3ZWWA 5B4VA 2IGTA 4EMBA 1RWOA 3EJWA 5COQA 4XWWA 1M1ZA 4FYXA 1QTIA 1VMDA 5JHHB 1NASA 5KNDA 3Q7PA 3GP5A 5CDFA 3NP7A 4FGKA 4OU4A 1PJBA 3HN2A 2YHBA 5HF5A 2RGCA 3SKYA 3TTWA 4PANA 4DLBA 4M1QA 5IJ9B 3MTAA 4JI2B 1W4BA 2OGTA 4KRXA 2R5FA 3UWPA 5J5VA 1IZ9A 4F38A 4CQNA 2MYTA 5KYVA 5IHXA 1FVXA 1IXKA 1DCFA 4KLAA 3U48A 2VVTA 4LMRA 3BGSA 1FX1A 3DZ8A 3LGAA 4FFRA 4PIMA 5BVGB 2ZSFA 3KEQA 4HADA 5C7LO 2OSBA 1BIFA 1PYGA 2WHRA 3MUEA 4IMIB 4J0GA 4JU8A 5FV7A 5ENVA 2YS7A 5AJYA 2J7PD 4KBYA 5IC4A 1YZ3A 4QYIB 3T9CA 3V4SA 1DADA 1QDEA 3HLYA 1GL7A 4J2OA 4CF7A 3LUBA 3AJDA 3UXEA 5JIBA 4BVHA 3P0EA 5FO1A 3WWYA 3U09A 5BQ5A 1X3LA 4QVKA 5EIBD 1EH5A 2ZB3A 3RV3A 3KQLA 5A05A 3H4MA 1ST3A 4LZOA 4TVKA 1YNSA 4MRSA 1Y6RA 3H3FA 1WB6A 3C14C 1L7XA 1X7YA 3O94A 3ZDAA 6REQA 2HNAA 4TLMB 4KMSA 3D3KA 3T7JA 3ASUA 3DLHA 2DQSA 3B7WA 4ND3A 1H0KA 2BFOA 2B4YA 2JK1A 4P7FA 2VH5R 1BXZA 1Z4QA 2FSPA 2H1SA 3CHYA 3FMFA 3L8EA 3RSHA 2CXOA 1N57A 5K6AA 1YIAA 3DOCA 2HBRA 3INTA 5JNUA 1PFQA 5L7YA 2FFHA 2GFQA 1Z74A 1M34B 1BQ4A 3LUDA 1JEQA 4XQGA 3OZXA 1ZRMA 2ZJ0A 1M33A 1W34A 2YZMA 3C5EA 1AKUA 4R51A 2A5FA 2FUKA 1FUIA 2FW6A 2ISQA 3PRJA 4JASB 4RHYA 4RZXA 2C8JA 2MSDB 1G7CA 1RKBA 2JLZA 4KE8A 1FQJA 2F8SA 1X1DA 3COSA 3O95A 5JECA 1VB3A 2QT0A 2IC5A 4A9AA 3MIZA 2CEAA 2Q1XA 1UJBA 2NOAA 2PYIA 3QKSA 4HDKB 4WINA 3WE7A 2AE2A 1X19A 1XHEA 1IZ0A 3K6RA 2ZJ1A 3ABIA 3FYCA 5A03A 1KQGA 1R0WA 3N9IA 2QMHA 4HRXA 4MVJI 4OBXA 3FYUC 3QPBA 1LJUA 3ZR4B 1SXJA 1UC8A 3FCOA 5E2AA 2QENA 4LNAA 3QK7A 5EJ2A 4BEJA 3RU2A 3OCCA 4KLRA 2GEVA 4B5KA 4L76A 1KYYA 4WCDA 4C6TA 3BE5A 1NPYA 1RKQA 3ROGA 2BTEA 2JFNA 4JENA 1SU7A 2D1QA 5G4LA 3FH0A 1GILA 2V7VA 1S9DA 1K4YA 3TNJA 1YJAA 3BICA 3NHAA 5CX1A 3QPUA 1Z5NA 3E1KA 4YFVA 5EE1A 2AB0A 4BV3A 1P5HA 4CMGA 5B3JA 2R11A 3WTCA 4BYGA 3NAZA 4E4TA 4W7SA 1A5SB 5ALIA 7MDHA 1QH9A 4Y2JA 5ALKA 3ZX4A 4F97A 3PA6A 4MVJG 2HT6A 3V2HA 1SBIA 4FEAA 1ZVVA 1PFKA 3R9XA 3OFVA 3VBEA 4YAJA 3OQIA 4YJ2B 1K5GA 1GGHA 3RVQA 4FM9A 1D2HA 3QPDA 1VJRA 4QXPA 5HR5A 4EHJA 2G9UA 3VJMA 2ZDHA 1GTSA 1D4OA 1KJYA 1FNDA 2WJPA 3FUXA 3H86A 1QS0B 5I45A 3PD0A 2X8WA 3TRDA 3EXFA 3OFSA 1JA0A 4BNDA 4D9GA 1Y9DA 1N75A 4I1OA 4M7RA 2O8EA 1XTQA 5FWNA 1GTJ1 3UK7A 4YB8A 5TMPA 2ZSKA 2WAYA 3BQNB 4GS5A 3BE4A 2NSJA 1LBTA 2VUTA 1K5PA 2P2DA 3EWNA 1J99A 1XZIA 4CXMA 5KX5F 3M2TA 5IXJA 2BGUA 4LMBA 1J21A 2AZ4A 3I0MA 4RK5A 4YJFA 2BGTA 1OH8A 1L6IA 2I3DA 1CU1A 5F1OA 3RODA 2C5HA 3M1LA 3ZCTA 3RT9A 4UC0A 2A8YA 1NNI1 4LRSB 3SOZA 4FYYA 2IHVA 1UFOA 4FDUA 2L0XA 2OQ2A 1P74A 2ZU0C 3V7WA 4N0DA 1EGMB 1LRLA 4A36A 2ZUUA 5A4DA 2Q2QA 2FQWA 4Z9YA 1LH0A 2ILTA 4NBNA 3RTBA 4CKZA 1RYNA 4YRNA 1U99A 2V9CA 1FC0A 1DO2A 4QTYA 3FD8A 5LA6B 5CAEB 2JLUA 4QGSA 2PK3A 3AEKA 3PRYA 2OCDA 4RVDA 4XSHA 3UGQA 4Y1EA 1TKCA 2HWUA 1VIAA 5A6SB 3DOJA 3P9XA 2H1LA 1RLJA 2X2FA 2QQEA 8MHTA 1PZNA 2WU1A 1P39A 1Z29A 3K72B 2JHPA 3JARA 5IFLA 2GZRA 4QYSA 4B45A 3TK1A 4EPRA 4PFQA 3P8ZA 3AINA 1IVYA 2WPDD 3B7PA 5B4TA 3BMOB 3F9RA 3IP7A 4MUYA 4EY7A 2JG3A 4P84A 1ZHOA 4CNQA 2WTNA 4JBIA 3RV4A 2YRFA 4E7PA 5AUNB 4ASUA 5T6MA 3WP0A 1RP1A 2XUFA 2XAUA 5KO2A 4JELA 3UMBA 3HBNA 1NFFA 5EKDA 2ZQYA 3KG2A 4TWIA 2G4CA 3O2NA 2AZDA 1PJ3A 4A6XA 3EODA 4DDTA 2MTBA 4O02B 3HU3A 1KP3A 4K86A 2IX9A 2PMEA 1KOLA 4O4LA 4D5EA 3AEXA 2VNKA 4LEIA 3FVWA 3JYQA 4GOOD 2C95A 5T3YA 1CQPA 1EX1A 5J5AA 4K3UA 5D7NA 4OQQA 2NW6A 3M1AA 3QKTA 1YC5A 3VNRA 2NVWA 2PWYA 4XJTA 3OM1A 1NXWA 4B9AA 3GRUA 4WNCA 1SN7A 4YONB 4F4DA 3L5KA 5BWOA 3FBTA 3GVIA 1EEXB 5IC6A 1Y5NA 5JISA 1W29A 1E1LA 1SCBA 4Q5IA 2B94A 2BFPA 1I3CA 1R6VA 4PCAA 1CB0A 2H1CA 1G7TA 3SS9X 1B3RA 2FPLA 4M0LA 2LPMA 5GGYA 2B21A 4KR0A 5KYUA 4ZDJA 4B3MB 2B37A 3F3SA 3HUDA 1RPAA 1QJ4A 2K7ZA 4NOJA 2XE7A 1BHO1 1EGHA 2YIVX 3AESA 2DJIA 3FMOB 3PE4A 4MIKA 1SAYA 3DGEC 3ZVRA 3UQYS 3IAS6 3JYLA 1CNFA 1RJ9A 4QQNA 1AM4D 2PAAA 3DWIA 4S0ZA 1JMYA 1ZOPA 3S2SA 5KCMA 4C7OA 1G0NA 1Z5ZA 2PL9A 4PR3A 5GP1A 2RHLA 3KPVA 1OIWA 3ZHZA 3M6LA 5J2TA 1T25A 3L6RA 4F12A 5BSRA 5GAJA 2OZVA 3K16A 4UUPA 4O4IF 5AT1A 3CB4A 3R7FA 2PVPA 2I4MA 3JQRA 4V3CA 1EHIA 4IW3B 1IJKA 3FAZA 3RH0A 2WYIA 4XDHA 3GLFB 1ZN8A 4C88A 3WRXC 1OV4A 1GNVA 3X1XA 3CPSA 2H7CA 1MJGM 2H2DA 4U3JA 5DNDA 3EGEA 1IN8A 1JPUA 5FNVF 5LXTB 3P7MA 3PC3A 1CY4A 2Z56A 1NNLA 2P4EA 2RSLA 3KSRA 1IH8A 4O08A 1HBJA 4QECA 5DJ5A 2GVDC 4ZRDA 4JJEA 1DBVO 2BF4A 3INGA 4AG6A 3D6NB 5HBRA 1DEAA 1V9SA 3CH4B 3QX8A 1ZICA 3EC2A 4KEAA 4YI3A 5NLLA 1IFXA 2YY7A 2X4IA 3M4JA 4OQLA 4YDRA 3AKCA 3G9UA 1A5AB 3EPPA 3DZKA 4Y2HA 2V9PA 3O47A 3SNKA 5HS4A 5E3JA 2WFLA 4MSUA 3W2IA 3U1VA 1CJSA 3B48A 1FP4B 4DWJA 3KP1A 3PF9A 1XYGA 4JJ4A 1A8QA 4PS1A 4KN5A 1AX9A 2IODA 3DV0A 3OMWA 3OZWA 2VYFA 1YQXA 1AKMA 4Q82A 4TWRA 4X45A 2ZTUA 3C70A 3P4UA 4W5HA 1ZVJA 3N76A 1EZ4A 1Y33E 5DW3A 2J48A 3ANMA 4B7ZA 1PUIA 5ITWA 1F06A 4QYTA 3WKCA 2PDAA 4IL5A 3T94A 2XUGA 3OWHA 1TM4E 5FBKA 1SBZA 3FE2A 3P2JA 4EL5A 5ARCA 1M8GA 2CNKA 2H07A 1NE2A 4IX1A 1I01A 1I4TD 1JKJA 3FHLA 5CH8A 4YDQA 4KGDA 2KE5A 3D7NA 1LBHA 2GYUA 1LLCA 2R00A 4B3HA 2B20A 3VDNB 3KZMA 4AX8A 1GVNB 5AJZA 5A3VA 4N65A 5BUZA 3GFQA 3ID6C 1XALA 4BO9A 1OH6A 3QMWA 3EPKA 1O95A 2ECFA 2W4MA 5GM1A 4ANFA 3CEHA 2IS4A 5DHFA 2VUSA 4KPFC 2NSLA 2OD9A 1DRJA 4IMRA 5TSDA 4R2HA 5U4QA 4ENSA 6GPBA 4E21A 2WSSD 2VATA 1ZJYA 2Y0DA 4JD5A 2VC2B 3M9WA 4K9PA 5FA6A 5FPQA 4DB4A 2LVBA 1HT3A 2BHTA 4OQYA 3UWMA 1IIRA 3CLRD 3PPVA 1QHHB 1EVEA 3K4QA 4LFAB 1OE0A 3HGTA 4UHKA 1XA3A 1DAKA 1NYTA 5GOTA 4YV7A 5CA1A 4RF3A 3WZLA 4KDFA 3WNCA 1AUXA 2VSYA 1NVKA 5KSPA 3U3RA 2FCRA 2QPOA 3GAFA 4LZLA 3U9SA 1K27A 2DLDA 1ZEMA 3UHOA 4BE7B 1DQPA 4II7A 1I2MA 4WNIA 2HN9A 4XQCA 1A9TA 2C04A 2OV3A 4Q24A 2XMPA 4TXLA 5BR8B 1E3TA 4RORA 3WLKX 3IQZA 1M6VA 3CH6A 5IUKC 3O73A 1PNQA 2RGUA 1W96A 5AKIA 3CVUA 1WSBA 4TV8F 4JGBA 4OFZA 5TEWA 3Q3JB 1PUJA 1XI2A 4KRYA 4IY1A 2REQB 2ORWA 2K4MA 4CQMB 3A37A 1ULZA 1WW3A 1I1QB 4KN6A 4LCEA 1FJXA 5LIRA 2J41A 4GI7A 1X9GA 1M83A 2J9ZB 4G4JA 1DRVA 1U0OC 1E7QA 4US0R 4YGYA 4NZMA 1FFGA 4GP6A 4MUFA 5CB4F 5GIOE 2XVAA 3JASA 3L8ZA 2WP0A 4QDOA 3V1MA 1TAUA 4NBRA 4JZKA 3AUAA 1KMIY 1IEVA 1TD1A 1XBTA 1PT9A 1U0NA 4BX9A 4EF6A 5J4KA 1X15A 4I5IA 3LECA 3USCS 4JLDA 3BEDA 5A4KA 1PZEA 4HQRA 5FWDA 3DE1X 2RC5A 1G63A 2JNWA 1H2RS 4R2JA 2YBDA 2X5JO 1UXHA 4L4RA 3R7LA 2BFDB 3ER6A 5PGMA 9MHTA 2O3JA 4HGQA 1T8YA 1L3CA 2WT4A 3HJGA 1NU6A 1GGJA 1EZZA 2VUHB 4LZPA 4V1CA 3FI9A 3BFKA 3EGXB 4LJ7A 4HQ0A 3MS4A 1P0PA 2PT6A 1XJCA 5E8JA 3N8GA 3OZAA 3SAJA 5A9TA 3IJ5A 1FNMA 1M8PA 1P9WA 1IHXA 3PFKA 3QEOA 4LBZA 4LXIA 4OYHA 1GQOA 2Q2OA 2YHIA 3E0QA 4PHGA 4QRIA 5TY0A 1NP7A 2UZIR 1KO1A 4FYHA 4E5UA 5DIFA 5IJ9A 3OKCA 1V7ZA 4RVSA 3PLAE 3U4GA 3BS4A 3TI9A 2I3BA 2D13A 4KXUA 1TXGA 4UTNA 1TPYA 1J2YA 2VJKA 3B8EA 2W0SA 2YICA 4R0MA 2WKQA 5BVGA 4BRZA 4B7XA 3A1DA 3FRHA 4EFLA 4CTKA 3VO1A 4RULA 1QX3A 2ZR7A 1V7QA 1YZVA 2CUTA 2WSBA 4OYLA 4UAUA 2ZYAA 1JWAB 4IFIA 5H3HA 4RMGA 5KJFA 4P3YA 3TYXA 4O2BA 2EJVA 3FPFA 1UM9B 1A0OA 3UAOA 1BU8A 1XJ0A 2ZKIA 3OPQA 4X97A 1BE0A 4TL8A 2ZWOA 1X7XA 5CA0B 3B2NA 1F20A 2W2QA 2Z09A 4JDUA 3KQOA 1NVGA 3OZSA 4Z8YA 3KJFA 1O97D 3PRHA 5EHXA 3QW4B 2Y1CA 4FGZA 5JAHA 5CNKA 1RWXA 2PTHA