2PTGA

Crystal structure of eimeria tenella enoyl reductase
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
307
structure length
224
Chain Sequence
PLPVDLRGKTAFVAGVADSNGYGWAICKLLRAAGARVLVGTWPPVYSIFKKVFDKIYPLDAVFDTPQDVPPEVSSNYAGVGGFTISEVAEAVRADVGQIDILVHSLANGPEVTKPLLQTSRKGYLAAVSSSSYSFVSLLQHFLPLMKEGGSALALSYIALESDCRTLAFEAGRARAVRVNCISAGPLKELESDDVGRAALFLLSPLARAVTGATLYVDNGLHAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-acyl carrier reductase
publication title Type I and type II fatty acid biosynthesis in Eimeria tenella: Enoyl reductase activity and structure
pubmed doi rcsb
source organism Eimeria tenella
molecule tags Oxidoreductase
total genus 68
structure length 224
sequence length 307
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ptgA01
4GPD1 3ZWXA 1T4BA 4ZQGA 4IJVA 1C0IA 1ULUA 1NR7A 2YDXA 4TROA 4BHTA 5CDUA 5C7IO 1HKUA 3I3OA 5COQA 4JN6B 3KSZO 3UN1A 4CM6A 5KVCA 3JQFC 3X2FA 1HDOA 4UEKA 1MP0A 4ZQHA 5THKA 2BGMA 3RUHA 2AQIA 3WLFA 1BSVA 1G6KA 1Z73A 2FN7A 4FR5A 1XELA 3ANNA 4NBRA 1FMCA 2PZLA 4WLEA 4Y98A 2VHWA 4BNTA 3R1IA 5TNXA 1RYEA 1UXKA 5AXAA 4ID9A 4ND4A 3UHAA 1F06A 1PZHA 2PWZA 3DHYA 4PVCA 4WNIA 1F8GA 4RF3A 3OJ0A 1E77A 2VYVD 1XA0A 4YJHA 4AJJA 4LMPA 1NXQA 3B6ZA 4CJXA 3ROPA 3QW2A 4P4NA 1VE9A 2RIRA 1B16A 5KIAA 3F46A 4BB6A 1T2CA 3KYBA 3WQQA 4LCEA 3A06A 4IBOA 5B12A 1U2DA 2YYYA 2C2XA 3E48A 3TQHA 3ADOA 4CM3A 5MDHA 3LF2A 1JA9A 3D5QA 1LTHR 3JQGB 4FOOA 4I8XA 4M55A 2DM6A 1PEDA 1RM0A 1E0DA 3K31A 4A26A 4WCFA 1NPYA 5GZ6A 5BSEA 1E3LA 3RU7A 1EMDA 4MOWA 2Z1MA 2JJYA 3PLNA 4E5MA 3ZNNA 1YOVB 1YBMA 3GDFA 5A9RA 4Y6RA 3RROA 1NNUA 4B8ZA 1PGJA 5I7FA 1I36A 3H2SA 4RDIA 1A4UA 2J8ZA 3QVOA 3SJUA 4BGUA 2HKIA 2DUWA 5DF1A 5GZ1A 2IZ0A 3I83A 1AXEA 4CR8A 4RJTA 1V0JA 3BHJA 3R0IA 4BOYA 3GVXA 2ZB7A 4AJEA 1M66A 3RFTA 4CV3A 2QIOA 1I3MA 3PHLA 1LDMA 1E3JA 1X15A 2QW8A 3GZ4A 5JO0A 5JBIA 4BMSA 1EBFA 2ZTLA 3JTMA 2G76A 5ER6A 2Q2WA 3DBHB 2NQTA 3AOGA 3JQDA 2DU8A 4CMJA 2PLAA 2VNSA 2ZKLA 3VC7A 5THQA 2Y66A 1FF9A 5JLAA 4GX2A 2OORA 3DBRB 1D8AA 4IDBA 4MVJE 4RV9A 3ZWOA 1UAGA 2PKRA 4A0SA 1OBFO 5ILGA 1Y8RB 4DA9A 3WS7A 2H63A 5KNLA 4IJWA 3HE3A 4BNZA 5DCWA 4KZPA 3HHPA 1YDEA 3WWZA 4GVLA 5F5NA 1WMAA 2FPGA 4CQMD 1J5PA 1MX3A 1GFSA 4YRDA 1SOVA 4CQLB 1LRJA 1B26A 3JYPA 4DLLA 1J0XO 3M2PA 3ZWYA 1O95A 2BI7A 2X7HA 1V9LA 3ZWNA 3BMOB 3PHGA 5CG2A 2EV9A 1VC2A 4MP8A 2ZB8A 4Q3CA 4YT5A 1EVYA 2NU7A 4P8RA 4I08A 4NNJA 1R4MB 1B14A 5U4QA 1GEEA 3ETDA 1R66A 1Y9EA 3TDKA 1ZSVA 4KTVE 2NU9A 4J43A 2VRBA 4IS2A 4DC1A 3DZKA 3W8DA 2CUKA 3BTSA 3NDRA 4OL9A 3NTRA 4Y67A 3DAGA 1P33A 4IDEA 3FD8A 3TL3A 5JAQA 1E1LA 2D8AA 1Y5RA 3SJ7A 5C3MA 1HDXA 1PJLA 2X9NA 3KEOA 1PIWA 5LCXA 3KLMX 4E2YA 1A27A 1WDMA 3WNVA 4ZN6A 1HE3A 2EGHA 1P1IA 4PG4A 3A14A 4ZRMA 1GZ6A 4NIMA 2FR1A 3H7AA 2DTEA 4N7RA 5JW6A 3KO8A 1TEHA 1B8UA 3VOSA 1H6CA 3QWAA 3KOUA 3DFZA 4IDDA 1OC2A 2ZB4A 4PZDA 4GQAA 3GN2A 4WUVA 3IKTA 3VH3A 1YB1A 2IRWA 2DLDA 3BMQB 3GHHA 2P68A 3LK7A 3GUYA 2B4TO 2NUAA 4HFJA 4TRMA 4BO5A 4E3ZA 2A92A 1XYGA 4XDYA 4FC7A 4JP2A 3GT0A 2QQ5A 3W4IA 1SEVA 3TOZA 3JYQA 4M49A 3KHUA 4IJKA 3NT4A 3CTMA 4A03A 4WEOA 2DPGA 1J6UA 1I3KA 2ZTUA 1SOWA 4DIBA 1LDYA 1S6YA 1NFQA 2XPCA 1ZJYA 2DC1A 3JV7A 3RFVA 2B5WA 3WTBA 2PH3A 1Q7GA 3IUSA 4RLHA 3H6KA 4FFMA 4EEZA 5JPIA 1WW8A 4R9RA 3GRKA 2IE0A 1QYCA 3AM4A 4WE3A 4GBJA 5IDQA 3FBTA 4WLVA 3UF0A 1LXCA 1KY4A 5DNAA 2FP4A 4I5GA 4FQ8A 5TS3A 1H5QA 5EL0A 4GX0A 2O3SA 3QA9A 3AK4A 1GYRA 2Z95A 3WTCA 4KDEA 3WFJA 3ZV5A 1QYDA 6ADHA 2AG8A 4XR9A 4J49A 2ZB3A 2WSBA 3JSAA 4EYEA 3PQDA 1HTBA 3WMXA 1K3TA 1PJBA 1HE5A 4BNXA 5I8ZA 4QEDA 4F6CA 3K92A 3JD3A 4Z9YA 1Z82A 2GN9A 2I99A 3TL2A 1GZ3A 1YKFA 3PI7A 5EPOA 1H6AA 4XCVA 2EGGA 4YJDA 3GK3A 2W98A 3U0BA 1LU9A 3FHLA 1UZMA 2IYOA 2VOEA 4I1IA 3VAZA 1TT5A 3GGPA 1ISHA 2EP7A 1E6EA 2VTEA 1BGVA 5L40A 1U1IA 2ZCUA 1GCOA 5ICMA 2VHXA 3ZGYA 5JDIC 4RVGA 1C0PA 1R15A 2BD0A 1YE3A 1NVTA 1CEQA 2OBYA 4BIIA 1N9GA 1GEGA 3KYCA 1J4AA 4IXWA 4UULA 1BTOA 4BUCA 2AQKA 1DHTA 4CMIA 3R3JA 1C14A 2HRZA 2Q1UA 4PG5A 1U8XX 3UICA 2Q2VA 5HM8A 1R37A 1PGQA 4NZ9A 4Z9FA 1I2CA 5G0WA 4WOKA 4RPJA 3ANMA 3E5RA 1V35A 3JYOA 5ES3A 3ZWCA 2EKPA 4NPCA 1ENOA 3D4PA 4ALNA 5COAA 1G0OA 5A1TA 4WASA 2EP5A 2BKAA 2I6TA 3QVWA 5IZCA 1LSOA 1LLDA 1UH5A 2PKQP 3B70A 3DQPA 4M87A 1AXGA 2QX7A 4JNKA 3ORFA 4XEHA 1UXGA 2D5CA 3ZU3A 3PZBA 1KYQA 3O26A 4BB5A 3FI9A 3U9LA 4DWVA 4AJ2A 3ABIA 4NH4A 2GPTA 4NG5A 4EJ0A 4O59O 1BG6A 1XKQA 1EQ2A 2ZK7A 5TC4A 4XX0A 4DGSA 1TT7A 2VT3A 3TF5A 3WB9A 2C5AA 5A5EA 1MV8A 3BTVA 1TI7A 2VT2A 3DZJA 2AEFA 2RBEA 3FNEA 5LDHA 3RQSA 1BRMA 1WPQA 4B8WA 1RPNA 2GCGA 4DPLA 4PLHA 2CF5A 2R00A 4R1NA 3TFOA 2X5KO 2RAFA 3KTDA 4YACA 3JQ8A 1HYEA 1I2ZA 4IDAA 3JD1A 4W7HA 3WMWA 4IINA 3F5QA 3LT4A 1FK8A 3OJEA 3RIHA 3IC5A 1ISMA 4FBGA 5B4UA 2OO5A 4QTZA 3VZQA 1EE9A 1SMKA 5ITVA 3RBZA 3HG7A 4E13A 2E6UX 4NBTA 4WKGA 1OC4A 2WYVA 3BTUA 4WLNA 1DLJA 5JCJD 1T24A 1BVUA 1C3VA 4TRJA 2GUGA 5LDGA 4QX6A 3ZDFA 4D3FA 5AOVA 5T8KC 2Q4BA 3ZNOA 4ZVVA 4TRRA 5CHEA 4YJHB 1GDHA 1KC1A 3GVCA 4OXKA 1UZLA 1HZJA 1VL6A 3OJOA 1HWYA 4BNGA 2GLXA 5BSHA 1Y5MA 2PNFA 4E6PA 1P1JA 3GZNB 4ALLA 4R1SA 2D1YA 4Z0PA 4J91A 4K28A 3SXPA 3DTTA 4D44A 3L4BC 4DC0A 1PJCA 3U5TA 4MVJA 5DP1A 5G0VA 4L74A 5JE8A 3TZKA 3O03A 4ALMA 3B20A 5CP8A 2NACA 1HDGO 1EUCA 1ENZA 2DUUA 3ROKA 2D5AA 1B3BA 1A9ZA 4D79A 4TZTA 4Q3BA 4BQRA 1NAHA 4XA8A 1VI2A 5HBRA 3ZWPA 5JNLA 3ZN2A 3GAFA 4XJTA 4ZQBA 3DZIA 4UUMA 1CETA 1MUUA 2QRJA 3CE6A 3WSWA 3H4VA 1YJ8A 4DIFA 4CMBA 1KVTA 2HMTA 3F9IA 4RQTA 4MP3A 3RBVA 3WYCA 3BMCA 1T1RA 2FWMX 4PCVA 5DOZA 1WP4A 4NFYA 1KS9A 3WXBA 3W4KA 5EINA 1I0ZA 3C1TA 3GDGA 4R1UA 2I3AA 4YT4A 3WGQA 4Z3KA 4YCAA 1UP4A 4FD3A 1DIBA 2PGDA 1P1HA 4OGWA 2BFOA 1C1DA 4XZ3A 4K6FA 3DHNA 3H65A 4IXTA 4ZQFA 3SC4A 2YV3A 1B3RA 4J2OA 2V7PA 2DT5A 3DMYA 4L0QA 2HO5A 4FFLA 2ZYGA 3L9XA 5CEFA 2EF1A 4BO7A 3IIEA 1WNTA 4MKXA 5G2OA 2X6TA 3CZRA 4KQWA 4LW8A 4TRNA 4GKBA 2J3HA 2NVWA 1SBYA 1A7AA 2Q99A 2PY6A 1ZBQA 3ZU4A 4RORA 1PS8A 4DMLA 1P0CA 3F47A 1OMOA 3UOGA 5F5LA 2FRDA 4CMEC 1P1KA 4CR7A 3RUDA 4L4RA 4CUKA 4DIOA 2O7QA 3NX4A 2NVUB 4CODB 1V3UA 2BFAA 2Q4EA 3DZGA 3CPSA 4D3DA 3VKUA 1BVRA 1CQJA 4D0SA 1ONNA 3OA2A 3PQFA 4FC6A 3KYDA 4FFPA 5DULA 4LCJA 1I10A 2DBRA 5IDYA 1JVSA 1IULA 3E1KA 3TNLA 4ALIA 3GH3A 1NBOA 4B79A 4WJZA 4YTEA 5B37A 4YVFA 4CLXA 4J90A 5DN9A 3G3EA 4ND3A 3JQ6A 3HN7A 2IODA 2OGUA 2FPIA 2I65A 1W8DA 3WWYA 3GPDG 3S2GA 1KEUA 2Y1OA 1I33A 2EHDA 2GR9A 2NVBA 2Q45A 1U4SA 4UEJA 1NHWA 1Q0HA 3EYWA 1X0VA 3KBOA 4G81A 4J9UE 2D4AA 4W9NC 3WQSB 3CMCO 3OQBA 1QG6A 2JCVA 2G5CA 3ZWVA 5JAMA 4IZIA 4NBWA 1R4NA 2GNAA 3UW3A 2DFDA 2C5EA 4FOSA 1QV6A 4C7JA 5KVVA 4INAA 4DMMA 2OHXA 4CM4A 4PLWA 4U6SA 3JQ9C 3HWRA 5ITWA 1IY8A 4TQGA 3HFSA 1TLTA 3TWOA 4ALKA 2EKLA 4W82A 4TSKA 2X9GA 2HK8A 3C7DB 3DDNA 4J1QA 4BVAA 3F5SA 4PLYA 2J3KA 3O8QA 4EW6A 2JFHA 2OFPA 4DBVO 3E9MA 4YAIA 5CPBA 2FHSA 3JD4A 4ZJUA 2I66A 3U4DA 3P7MA 2BGKA 4Q3DA 4QO7A 1QLHA 3QV1A 4ROSA 4A7PA 5JDCC 4OMUA 2Y68A 3PGXA 3OFSA 2FSSA 3GUCA 2RCYA 2B69A 1U3WA 4YJFB 3WFIA 1QRRA 4RO0A 3F1LA 2X58A 4XDZA 1CF2O 2GYYA 2PFGA 4J7CA 7MDHA 5A9SB 4E5YA 3RUFA 1Q7BA 2C2YA 2Y1GA 4CUJA 3CKYA 2GZ2A 1T26A 4UVHA 2EW2A 3DBVO 6LDHA 2Z5LA 3NDIA 1A5ZA 4CV1A 2YJZA 1PGOA 4OHUA 4RVDA 3U62A 4JIGA 2FR0A 4GX5A 4FB5A 4IQ0A 4U0KA 2OUIA 1GV0A 1GL3A 2C0CA 4CM8B 1DBVO 1P3DA 3ITKA 2PZKA 4II2A 5EQFA 1I3LA 5EN4A 2AA3A 1DSSG 4GLLA 1ID1A 1P77A 4HP8A 5FWNA 4OOEA 4UVDA 3TOXA 1GY8A 2OP0A 3C7CB 1B2LA 2UUOA 5CDYA 4OH1A 5HTOA 5L95A 4KWHA 2UVDA 1PQUA 1Z74A 3NKLA 2B0JA 4CLOA 3L6DA 4IQ8A 2ZJ1A 1K6IA 4BMNA 4ILKA 4RPGA 1K2WA 1QORA 4L73A 1UDCA 4NFSA 5I9LA 2YFHA 4RGBA 4AL4A 3VPFA 4CLRB 1FDSA 4CV0A 3SVTA 1H6BA 1QKIA 1YQDA 4R51A 3DTYA 1E7WA 2CNBA 4J9VA 1IZ0A 1Q7CA 4YA6A 2P5YA 2VRCD 4FGSA 1ADFA 2CDAA 5I7VA 4UEOA 1FJHA 3S2FA 1N1EA 1RJWA 1HEUA 3RVDA 1X0XA 4W7IA 1AUPA 3G0OA 1N7HA 1O5IA 1JTVA 5L51A 4O0LA 1LEHA 5DDIP 3H5RA 3NTOA 4KOAA 5KWEA 5L7TA 1AGNA 4LSMA 4OIMA 3KYCB 1SZJG 4XYEA 2X4GA 3BAZA 3C24A 1H9AA 5T6BA 1AN9A 1QV7A 4YAJA 4B7XA 1ZFNA 3E6AA 2HUNA 1E6UA 3RU9A 3PEFA 3NTQA 4EDFA 4IDFA 1PU2A 4YDRA 3NJ8A 5TJ9A 1BMDA 2B4RO 4FDAA 3RUEA 1E3WB 2C07A 5FFFA 3OBBA 1EVZA 4XGIA 2Y1FA 4MVJI 1GPDG 4XIJA 2VZ9A 5F1OA 4XIYA 3WJAA 4GL4A 1LUAA 2HQ1A 4PN3A 1R0SA 1DC4A 3RJ5A 2IZ1A 4M89A 2VTDA 1PWXA 1P31A 4E5KA 1OAAA 1R12A 1TXGA 2QYTA 3LYLA 2R2GA 4BO0A 1ULSA 2CDBA 5KTKA 1HZZA 1T4DA 3ZWAA 5HS4A 5L4NA 4E32A 1XU9A 3CSDA 1U3UA 4R5MA 2VYND 3INRA 4E5NA 3E9QA 2QRKA 4IGFA 1I5RA 2O4CA 4IGEA 4PRLA 3WGOA 2PD4A 1OOEA 3TZQA 4CMCA 1XIVA 3OQ1A 2NSDA 1PJ4A 3JQBC 1H6DA 1M67A 5CFZA 3LQFA 1GUZA 5I8WA 3JQ9A 4GSLA 4KUGA 4Z0HO 4HFMA 5JY6A 3RFXA 4M86A 1KIFA 3HDJA 3RUAA 5HS6A 1GR0A 1IHXA 1DHRA 3LT1A 4AICA 4BNWA 3MJCA 3DONA 3G79A 3P19A 5JYEA 3DEYX 1DJQA 5AQ1A 1V8BA 3CH6A 1U2GA 2V6BA 3CZMA 3E18A 5JYDA 1T2AA 3AY3A 4CM5A 4URFA 3LC7O 4N5MA 3KRTA 1ADGA 2P9CA 4ONEA 1LDEA 1G0NA 3AM3A 3ZCXA 3WYEA 1P44A 4MINA 1GUFA 3MCVA 1CDOA 3FNFA 3EAGA 2ZTMA 4D0RA 4IM7A 2HK9A 4YYZA 2JD1A 4P22A 3EZLA 3PYXA 3PFFA 5JAIA 1EFLA 2C29D 3C8MA 1MG0A 3E82A 3K6JA 3LZ6A 4D43A 2BI8A 4Z9XA 1D7OA 3FR8A 2I9PA 2LDXA 1JW9B 3LC1O 4IQGA 4BV8A 4BKUA 4HX5A 3AFNA 2C7VA 1HLDA 1EDZA 1SCUA 4NK4A 3DAPA 3NT5A 4JX8A 4AJNA 4LSWA 1PGNA 2Y1EA 4MP6A 1JKJA 4L75A 4IUYA 1Z6ZA 2Q49A 4JJGA 3UXYA 2O3JA 1DPGA 4TKMA 1WMBA 3RKUA 2HSDA 2W2LA 2QYSA 1T2DA 1EUDA 4XYGA 1HRDA 1U9JA 4KP7A 4ZQEA 3LVFO 3MTGA 2X86A 1IHYA 4AJ1A 1YDWA 5T64A 3KSUA 5JO9A 2P4QA 1NR1A 2YQ5A 4X54A 1VL8A 3AUAA 4JK3A 1ZK1A 1DFGA 5COBA 1SEPA 4YBZA 1W0CA 3T4EA 4U7WA 5TT1A 4TWRA 3BMCB 1ADBA 3CEAA 4F6LA 4PRKA 3JQFA 1LQTA 2A35A 3C85A 1UXIA 2CVZA 2NADA 5TJHA 1YQXA 1TVEA 4FN4A 4TVBA 3RBXA 2BFMA 2NLOA 4CM7A 1PJTA 2WD7A 4U6QA 4R9SA 4PLPA 5KOIA 4RZHA 3VH4A 1ZNQO 2WYUA 3G1TA 3OQ6A 3GVHA 1C1DB 2E48A 2Y93A 4N54A 3RWBA 4BNYA 5ILOA 4XRGA 4MIOA 3TZHA 5JSFA 3WGGA 3MOGA 2P91A 5KKCA 5DCUA 3AWDA 3D7LA 5A03A 4O6VA 4UUOA 2O48X 1B8VA 2ET6A 2Q46A 3ETGA 4GGOA 3UUWA 1GUYA 4PG8A 3VDQA 8ADHA 3P5SA 3ANLA 3CIFA 3WLEA 1P45A 3EMKA 2WE7A 2CZCA 3PWZA 3ZHZA 1EVJA 1WLYA 3RSHA 3BHMA 4RDHA 4Q3EA 1OI7A 2W2KA 4Y9DA 1DLIA 3R6DA 3MZ0A 3X2EA 4HV4A 2POQX 1RM3A 3ICCA 2B83A 1YO6A 5G0TA 3PZRA 4LGVA 3L9WA 5JXWA 4NBUA 2C7GA 3ZH2A 4R1TA 3HFGA 1NQOA 3OJFA 3I9MA 1U7TA 3I6IA 4F45A 3KYDB 4PGFA 4B3IA 1IB6A 3IQDB 4F3YA 1NVGA 4IY1A 3FPCA 4Y6SA 3DBLA 3E9NA 4DREA 4J16A 1NQAO 1ZEMA 1E7YA 2D2IA 2ZYAA 5K9ZA 1G1AA 1ZVMA 1HYGA 3PHHA 4RLSA 1BWSA 2WMDA 4DXHA 3BMNA 3SLKA 1PL7A 3JQBA 3COSA 4BKOA 4LRTB 3NV9A 4CR6A 1O89A 3BIOA 3I9JA 3JQ7A 4D42A 1P9LA 1N8KA 2P4HX 2I67A 5CEEA 1YQGA 3F4LA 5JAZA 4LVCA 4BNNA 3GGOA 4JCOA 3OECA 3NGLA 5FI3A 3WIEA 3DC2A 1F0YA 3DZBA 3D4NA 5A05A 1O9BA 1V6AA 3LDHA 2CF6A 5DOVA 3RC7A 4Q3NA 1U8FO 1KBZA 3GY0A 3EVNA 1X7HA 3GMSA 2NTNA 4J1SA 4UAGA 3EK2A 1C0KA 3MTJA 1M76A 5ENDA 2JHGA 4ND5A 1IPFA 1JU9A 2HMWA 4DVJA 4OKIA 1ONOA 2WTBA 4YJGA 4AFNA 5KVSA 4J1TA 4H15A 2VUUA 1PZFA 3ZW9A 1ISFA 1MFPA 3DL2A 4JGBA 2EXXA 3GAZA 1XQ6A 3PYMA 5CDGA 2GD1O 4O5OA 5ER9A 3VZRA 3K30A 2DBZA 2FY8A 1B7GO 4DBZA 1P0FA 3UGKA 1NAIA 2JCXA 5AXCA 3DZFA 1MFZA 3PDUA 2AE2A 5FF9A 5IG2A 1KETA 1YB4A 1H94A 3MWEB 4BV9A 4BNLA 4K26A 2X1HA 3DMTC 1E1KA 2OP1A 4DPMA 5EMHA 4CM9A 4E4YA 1A72A 5L7WA 5CDSA 4E0BA 1HE4A 3QQPA 5KCZA 1T2EA 1DRWA 2AG5A 1DEHA 1X7GA 3V2HA 1GYPA 4ESOA 3GLQA 2WEKA 1ZSYA 1YL5A 3OIGA 5BNIA 3EC7A 1SB8A 1BXGB 5EERA 3I9KA 4O63O 3NAQA 1ARZA 4I5EA 3Q9NA 3D64A 1R0LA 2ZQZA 4QFCA 5L3ZA 4BNVA 2C59A 2YHIB 4EBFA 4IIUA 4QECA 1W73A 3KEQA 4G65A 4EJMA 2VHYA 1DIAA 3PRJA 5EIOA 1YL7A 1PJ2A 4Z6KA 4TVOA 2GN4A 3U09A 5K6AC 5TGDA 1FXSA 4MVJP 3WX0A 1N5DA 1YBAA 2EIHA 1A7KA 2R6JA 3JYLA 3HDHA 4JLWA 1PZEA 3ITDA 4XRRA 5IDWA 3QVXA 1UXJA 4JROA 2J3IA 4ND1A 1P1RA 3PVZA 3GNQA 3FBGA 3NEPX 1XLTA 2OXIA 4WPGA 2VZ8A 4MIYA 1HT0A 4OM8A 2PZJA 3F1KA 4B4VA 4CL3A 3PTZA 1QLJA 4MIEA 4FFRA 3EHEA 4WLOA 1HE2A 1YOVA 3S2IA 2JL1A 3TSCA 4FS3A 4QFDA 2OZPA 4EITA 3UFXA 2XXJA 3K5PA 2NU8A 3UVEA 5JCXA 2EG9A 3MJ4A 3INTA 1UDAA 4WOJA 4E5PA 3OSUA 3HNPA 5AXDA 3DR3A 5C5IA 3D3EA 2EEZA 5TLSA 1H2BA 3P2OA 2HMVA 2Q50A 1T25A 3DZHA 2VZ0A 2V6FA 4XWYA 3ZNPA 4GAEA 2ZTVA 1PS0A 1NFFA 4DQUA 1NPTO 2H9IA 3V1TC 5KKAA 1D1TA 5CEJA 3DBHA 3I6QA 1QP8A 1D3AA 2Y1CA 4QO8A 1E7MA 1EVIA 4ZA2A 1T2FA 1DRUA 4NBVA 3LU1A 2BRUA 5DBGA 4BNMA 4NDNE 1CJCA 3VTFA 4R4JA 3VH1A 4A5OA 3AY6A 1DIHA 4OQZA 4B7UA 4YAGA 3DBRA 1DIGA 4N18A 1R0KA 2EKQA 3JYNA 1GADO 1U3TA 1MXHA 1HLPA 1Y8RA 3AOEC 3QE3A 5AYVA 4DTIA 4WCFB 1ZUD1 1DJNA 1L7EA 1QYVA 3PIDA 4CPDA 1HETA 1KERA 3K2EA 2SCUA 1VJ0A 1B0AA 4NU6A 2VYVA 3PDJA 3GVIA 1A71A 4JBIA 1BHSA 1HSOA 4CQLA 1H9BA 3ASVA 2DPHA 4HUJA 1PQWA 3MJTA 2IXBA 4CMGA 3A4VA 1Q0LA 3OHSX 4DQVA 4CMAA 1LC3A 4J2HA 3E8XA 1ZK2A 4BO2A 1A4IA 5TRTA 2C82A 1SB9A 3IDSA 4M8SA 5TSDA 4FFOA 2HDHA 3KUXA 5TX7A 3VVBA 3DFUA 1X13A 4NI5A 2YFQA 2CVQA 3KM0A 1O0SA 5CAEA 2HRBA 4EI2A 3SC6A 1AHHA 3GRPA 3UH1A 4KUEA 5KJ1A 3K2BA 1M6HA 2C20A 4HFRA 4XB2A 4D7AA 5JDIA 5I9MA 2UUPA 2DQ4A 3ZHXA 3MWDB 3JCZA 4YB8A 2GASA 5G0UA 5TT0A 3Q3CA 3FSRA 1UP6A 3HQ4O 2IEBA 2PTGA 2Q2QA 3IP3A 4DPKA 4B7CA 1HXHA 1RYDA 3ZU2A 1DIRA 4XQEA 1U3VA 3M2TA 3ST7A 2V6GA 1FDVA 2X8LA 2UYYA 4FJ0A 4DRYA 2FOIA 3DMTA 3O9ZA 1PGPA 3L0DA 2NTVA 5TQVA 5FYDA 1VKNA 3IJRA 4ZHSA 2E49A 3H3FA 4R3NA 5F1PA 1X14A 2FSVA 4BO9A 3L07A 3RI3A 1EZ4A 1PJQA 1KEWA 2G1UA 4DUPA 2YV2A 3GG2A 1ZK3A 4BO8A 2YY7A 4KDFA 5JMPA 3C1OA 7ADHA 2VOJA 3KXDA 4Y6PA 1DO8A 5IN5A 1MC4A 3BMQA 3U4CA 1CIVA 3P2YA 3WJ7A 3BA1A 3TRIA 5BT9A 4BO3A 2O3TA 4LN1A 2HJRA 1GQQA 1J49A 1EK5A 4WCDA 2ZATA 4WEQA 4WGGA 3MJSA 5K6AA 3TFQA 2ZYDA 5ICSA 3UCFA 5HA5A 1PZGA 4GWGA 1E7RA 4BL5A 4FJ1A 1I01A 4RVFA 4XJSA 4CQMA 3PHJA 1MGOA 3DHEA 3ADPA 1YH3A 4FPXA 2O50A 1AHIA 1IUKA 1U4OA 3DB2A 3G1UA 4BO4A 4FCCA 2HAEA 4B3JA 1BXZA 3CXRA 2Q1TA 1Z75A 5DBIA 1QYWA 4OJNA 5IF3A 3GFGA 1H93A 3ZWBA 1CERA 2B35A 2Q3EA 4UVIA 3RASA 2P2SA 4AJHA 3PK0A 1XGKA 4I5DA 4WCFC 2VHVA 3UAGA 3V2UA 4KWIA 2YV1A 1MLDA 2O7SA 3VZPA 1XG5A 5FEUA 5H82A 4MDHA 3U49A 3V5NA 4CLHA 1CYDA 2WD7B 4MJLA 1EDOA 1PL6A 5DBFA 2TMGA 1NHGA 4GSKA 4OKNA 3V8BA 3OA0A 1LQUA 2EJVA 4YEDA 5T8KA 1UR5A 4C4OA 2VWPA 1ISJA 2PH5A 2DKNA 1Y9AA 4AJLA 3O38A 3Q6IA 1N7GA 1P1FA 2IEDA 3FNHA 4QUKA 1IZ9A 4D41A 5IFLA 4B4OA 3F4BA 2X5OA 4CM9D 5JY1A 1UJMA 4B3HA 2YUTA 3QY9A 4MVJG 4PZCA 1U5CA 4S3MA 3FTNA 1LDBA 4ZICA 1EQUA 3L4BA 2W2KB 4IMPA 4NU5A 4R3WA 3AOEA 2VWQA 1RWBA 2RHRA 4AJKA 1MA0A 2YW9A 1ZK4A 3QWIA 4UUNA 1KOLA 4CMHA 1LX6A 2AHRA 3ICPA 2I76A 4MKZA 1QMGA 1NASA 2DBVO 3PP8A 3HUDA 1ZKMA 1PSDA 2XOXA 4E31A 2PA3A 4OSPA 2CD9A 4BGIA 8LDHA 4Y8VA 1N92A 3WG9A 2GRAA 2JFGA 5BQFA 3IKVA 3ON5A 3H9GA 4WLFA 2NQ8A 4RF4A 1C0LA 4M1QA 3BMNB 1ZSNA 1E92A 3WBBA 2CDCA 5C37A 3HADA 5DCYA 3GDOA 2NNLD 2JHFA 1PL8A 1WZEA 2QRLA 4N5NA 2ZQYA 1I8TA 3EY4A 2WE8A 3H5AA 5A02A 4WLUA 1K89A 1HF3A 1JAXA 1HYHA 4LVUA 1ZIDA 3C3XA 4Z0TA 4HADA 3H9EO 2V6MA 1RKXA 5JS6A 1BDBA 3PJGA 3U4HA 4OAQA 4UVGA 3VKVA 3ETEA 3OIDA 4ZD6A 3Q0EA 3HB4X 4R01A 3LLVA 5U1PA 3WYBA 2WD8A 1ISGA 3RUCA 1LSUA 1TT5B 5BR7A 4BS9A 1Z7BA 5BSGA 3MOIA 3H8VA 1NP3A 3IAHA 3KLPX 4RVUA 3DOCA 3ZV3A 3A28A 1F17A 1IYZA 3ENNA 1M75A 4IMRA 2O2SA 1YONA 3QJ5A 3UCXA 4YRBA 5G4LA 3KB6A 4G2NA 5TIIA 1I30A 3U3XA 4E30A 3T4XA 4AJPA 4MKRA 4D45A 4PLFA 3AFMA 4R41A 1N9GB 5KJEA 4PLVA 4HNGA 5A9TA 4GLOA 4CMIB 4CMEA 3OEYA 3PQEA 4OQYA 1XCBA 3WGTA 3CUKA 3W8EA 1LRLA 2PK3A 3GF4A 1KVUA 1B8PA 1L7DA 2UAGA 5GMOA 1Y8QA 4JBGA 1E3EA 4JXKA 1LJ8A 4MVJD 2Y99A 4GMFA 3I5MA 3WGHA 3ULKA 1K6JA 3RJ9A 5A4DA 2WWRA 2VWGA 4AJOA 1LSSA 1E6WA 1M2WA 5JC8A 3IOYA 3QRWA 4NJOA 1O8CA 3O4RA 1OZAA 3QP9A 4JBHA 5MGBA 4EUHA 2X0IA 1DRVA 4PLGA 3NJ4A 1BXKA 2JKVA 2H1SA 3NDJA 3GZNA 2QZZA 4W9NA 1VPDA 1K5HA 1I2BA 3AM5A 4WECA 4P38A 3OEWA 5EESA 3IL2A 1K0UA 1ZW1A 1IL0A 1LLQA 2NM0A 5HWSA 3PIIA 3H3JA 1EFKA 2W8ZA 3TZCA 5JC1A 3T7CA 3OH8A 4YQYA 2D3TA 1YWGO 4PIVA 1E1NA 2TMDA 4PVDA 1XR3A 3GVPA 2AQHA 1E7SA 2DBQA 3WICA 5BNTA 3AU8A 1ZCJA 4BMVA 3BYZA 4MVJH 3JQ8B 1W4ZA 3LC2O 2I3GA 2A94A 5L7YA 1SAYA 2B36A 1X1TA 1DFIA 1VSVA 4RL6A 3SLGA 1UDBA 5G4KA 3PJEA 1WWKA 2V65A 2QZ9A 5DZSA 4A2CA 5F1KA 2O3QA 4O1MA 2X23A 3BXXA 3IUPA 5LC1A 5JDCA 3GG9A 1PX0A 3LT2A 1X7DA 4L9RA 1U5AA 2AEJA 3ONDA 1XEAA 4GMGA 3MJVA 1MXFA 1Q0QA 4J7UA 4XR4A 3QIVA 2Y0CA 2W90A 3VPSA 4BQPA 4J6FA 1KEVA 5A5FA 3FR7A 2X5JO 1U28A 4E2XA 3RCBA 3GHYA 4OSOA 3PJDA 2J5RA 2HU2A 3QWHA 4HNHA 1YL6A 2QG4A 1JWAB 3B1JA 1GPJA 4MO2A 1CWUA 3GOHA 4XQGA 2P9GA 3F3SA 3I23A 1SNYA 2PGJA 2XF8A 2ZJ0A 2PD6A 3GMDA 4Q39A 4HXYA 5JCJA 4MVJF 4DLBA 4NMHA 4EGFA 1YRLA 1I32A 3C7AA 2AXQA 3EDMA 3KV3O 4TKLA 4L8VA 1P74A 4DQXA 2J5KA 1DOHA 3RKRA 4FJ2A 1NWHA 2CMDA 5U9CA 5CPFA 2NVUA 1IPEA 1SO8A 2CY0A 4HFNA 2AW5A 3ASUA 3FTPA 1LBEA 4PG7A 5AXBA 3KVOA 3DWFA 3JQAA 3E03A 4H3VA 1BW9A 4IDCA 5HRUA 3WQRA 2GDZA 3V2GA 4CLDA 1NQTA 4GI2A 2E82A 3FNGA 3D0OA 5B4TA 3BTOA 2W4QA 2PZMA 2HMSA 3SEFA 5H81A 1DDOA 3TPCA 2Y67A 2FZEA 4NR0A 3Q11A 5IZCC 4XB1A 3I1JA 3FCOA 4NK5A 1XQ1A 4E21A 1DC3A 1GCUA 2WYWA 3WGYA 2PV7A 4IIVA 1YGYA 1S7CA 2E4AA 4W99A 1GZ4A 5G0SA 2GGSA 2HCTA 1UZNA 4UREA 2B5VA 2G0TA 4E2ZA 1LLCA 1PS9A 3WIDA 5BNFA 3JQEA 3H2ZA 1QXSA 1UP7A 4IS3A 2OL4A 4YR9A 4XKJA 1E3IA 4HKTA 1VM6A 2O3RA 3MEQA 3AU9A 3M6IA 4G5HA 4YT8A 5AVOA 1I24A 3W4JA 2BLLA 3AW9A 3KZVA 1PR3A 2VUTA 4H16A 2GN8A 2FR8A 2I5PO 1QYXA 2PGLA 4AJIA 4CUZA 5TF4A 3H5NA 3PYLA 3D3WA 3VDRA 3WSVA 5I7SA 3WR5A 3DAFA 1ENYA 9LDBA 2R00C 3GGGA 1TA4A 3SBOA 1GQ2A 1ZO8A 2JAHA 3Q1LA 1F8FA 2BH9A 1GTMA 3PPIA 4K6CA 1C1XA 4OXYA 1WAMA 1L1FA 4I9NA 3TZ6A 4RVSA 1V3TA 2ZCVA 4L76A 2D0IA 1R6DA 3I9NA 1WDKA 4RVHA 1WVGA 4J0FA 1DB3A 1JQBA 3W6ZA 2CFCA 3W1VA 4R5HA 2OBNA 1IE3A 3TN7A 4YJFA 4R16A 3VPGA 3NT2A 5DP2A 3HDYA 1GV1A 4Q9NA 5A9SA 2JD2A 3A1NA 4CQMB 3WDSA 1ZZEA 3RC1A 3HDQA 2A9FA 2HJSA 2NTJA 4J4BA 4Q3AA 1D1SA 5BSFA 5K0ZA 4J7XA 4I9HA 4RPLA 2JCYA 4GX1A 3I9LA 1XDWA 4I5FA 3HZZA 4II3A 4ND2A 1KEPA 2J3JA 4J3FA 4A10A 4OOFA 1PJSA 4LISA 4XYMA 1Y7TA 4GWKA 4H7PA 4PZEA 4BNJA 2IZZA 5L45A 3AI1A 1R4NB 3PJFA 3QVSA 1UUFA 3RD5A 1ZEJA 4CM8A 4E2WA 2VUSA 3K73O 5IN4A 3M1LA 4LRSB 3CINA 1F14A 3U4IA 4CM4B 4YAKA 1EUZA 1RM4A 1ZK0A 5F21A 1WDLA 3GC6A 4PLZA 4NJMA 2EJWA 3DO5A 3HB5X 4QT0A 1NQ5A 3PFWO 4L4SA 1VJ1A 4U8GA 1T1SA 2X9VA 1KC3A 2WDZA 3LT0A 5A04A 1NFRA 1H2HA 5CDTA 1WXDA 3OP4A 3O8QB 4YQZA 4P4GA 4EUFA 1LRKA 1HDRA 4XQCA 1MG5A 1B15A 1EBUA 1NYTA 3OMLA 5L53A 2FMUA 4XGNA 4CLRA 1FDUA 4TZKA 3C1AA 4FGWA 4RF2A 3PHIA 4BNFA 4FSHA 1ZXBA 2AE1A 1JKIA 5FI5A 4OYRA 3KETA 1QSGA 3DOJA 1MC5A 3N74A 4R68A 1XU7A 4YAEA 1ML3A 4R54A 4XYBA 2OOSA 3AUUA 3FWNA 2GERA 3BHIA 3HJAA 4QXMA 1RM5A 1H0KA 1Q2XA 2JD0A 2GZ3A 2X0JA 3FN4A 5CG1A 3ZZNA 2A4KA 3I4CA 2RHCA 3I4FA 2NWQA 3ZWMA 4CL8A 4BGVA 4DYVA 3VPHA 4RZIA 1JDJA 3DOOA 4HWKA 2G82A 5B1YA 4BGEA 2YQ4A 2X0NA 1GD1O 3ROQA 5KJ6A 3TJRA 1HDCA 2HLPA 3ZNQA 3MJEA 4ITUA 4B4WA 1X1EA 4YXFA 1E3WA 3VHRA 4KMSA 3L6OO 5KJFA 3JQGA 3K96A 4R69A 1XSEA 3FWZA 3V1YA 3IJPA 4F46A 3WGZA 2PR2A 5GY7A 2J6IA 5A3JA 4RQUA 4CLOB 2HK7A 4ZU3A 3EUWA 1Z45A 4LMRA 1VJTA 3N7UA 2AQ8A 1FDTA 1KVRA 1VLLA 2AEMA 2IYPA 2Q1WA 3AY7A 5L9AA 1ORRA 5H83A 2HMUA 1ADCA 1BDMA 4K1LA 4W6ZA 2IXAA 3ZHBA 5JMWA 3L6EA 4U5QA 3L77A 1N1GA 2Y1DA 3FRJA 2VCYA 2F1KA 3HN2A 2IDZA 3I52A 1CRWG 3ONFA 4WK6A 1IOLA 2EWMA 9LDTA 2YHUA 1UXHA 1NM5A 2VQ3A 3OJLA 1F12A 1VL0A 3VH2A 2P5UA 1FDWA 3Q2KA 3ZI0A 2GO1A 1A9YA 4IDGA 4GKVA 2PD3A 4J0EA 3EGOA 2EERA 3PWKA 3ZWWA 1KY5A 1TB4A 4IPTA 2Y0DA 3B1FA 4RF5A 2GN6A 1EK6A 3WGIA 1VKOA 1E7QA 3GR6A 2RH8A 4ZGWA 5IJZA 2VRCA 4IZHA 1Y8QB 2O2YA 3G17A 4ZRNA 3LSYA 2B37A 3GPIA 2P9EA 5C7LO 4EUEA 4YT2A 3VPXA 2JAPA 4BKQA 3UCEA 2BELA 4YWJA 4M54A 4RPKA 2W2LD 1JWBB 1O94A 3NYWA 4GVXA 5I9NA 4JQCA 3W8FA 4A73A 3OICA 3H9UA 3GEDA 2WJPA 2BMAA 3GN1A 3GNSA 4NFHA 2DVMA 3IP1A 4NQZA 3D1LA 4JP3A 2BGLA 1E1MA 1Q1NA 3I9OA 5GZ3A 5I7EA 2EW8A 4XQ9A 1NPDA 4RCVA 4EZBA 3JQAD 4YRAA 3OM9A 3OIFA 3Q9UA 3BMOA 3ZV6A 2FPPA 2XXBA 1E3SA 4EEXA 1CQIA 5IDXA 1GQYA 5IZ4A 3R3SA 2NU6A 3VVCA 1ZMTA 1R4MA 1PJ3A 1HDYA 4K9DA 3V1UA 3JD2A 3NRCA 4TMFA 2XAAA 2AMFA 3EW7A 1Z7EA 2G17A 3QSGA 2DFVA 3JD0A 4FIZA 4XD2A 1KVQA 2F00A 4QSMA 3ZW8A 5T67A 1PQPA 4U0JA 1DAPA 4KUHA 2VYNA 5G4KB 4AG3A 1D4FA 1LC0A 1N2SA 1NX6A 2O23A 3D5TA 3A9WA 3ENKA 1HL3A 1LI4A 1JN0A 1VSUA 2B4QA 5IAAA 3Q2IA 3M1AA 4PLCA 5ENVA 1QR6A 1ISIA 1VRWA 3AJRA 1NTOA 4FW8A 3KSDO 2JFFA 3RC9A 4EJ6A 3PXXA 4CMKA 1HSZA 1O6ZA 3LF1A 4ALJA 2UDPA 3ZHYA 1JVBA 1GYQA 5B4VA 3N58A 5DT9A 4DYDA 3JQCA 4P4LA 3VTZA 4NHEA 2CVOA 1LDGA 1LDNA 3D4OA 5T57A 3S55A 3VZSA 4BO1A 3QLJA 2X22A 1HDZA 2Y05A 4UVEA 1AE1A 1UAYA 4LK3A 5IXSA 5EQDA 1Y81A 2O3UA 3RC2A 2Q1SA 1Y1PA 4WNCA 1PR9A 3HSKA 3PLRA 4KTTE 2FZWA 3LLSA 2VHZA 1K6XA 5T5QA 4GGPA 4DLAA 3ROMA 1LSJA 1ZMOA 4AJ4A 4PFJA 1ZXLA 1JAYA 5A3VA 1I3NA 3BZUA 2DTXA 1OFGA 4J4TA 3OETA 3UKOA 4DL9A 3AUTA 4N5LA 4PG6A 4W4TA 1E5QA 2DTDA 5EJ2A 4BNKA 2ZIZA 3GFBA 5C7OO 2ILTA 3JQAB 1ENPA 4S1VA 1BW9B 2RH4A 2X0RA 3DXFA 1GU7A 4IJUA 3AUSA 3S8MA 5L4SA 3FPLA 2VN8A 4JJFA 3SX2A 1W6UA 1PTJA 3B1KA 4MPDA 5A06A 1DAOA 4D46A 3GNTA 3E5MA 1YBVA 2YDYA 4MVJM 1LNQA 2BFPA 4E33A 5IXYA 4B4UA 1V3VA 3QWFA 1XWFA 3FF4A 2GSDA 2UV8A 3RUIA 4J1NA 1R16A 3QVTA 2GF2A 3PWSA 4BNIA 4CV2A 2OMEA 3QHAA 2O4UX 4KQXA 1YB5A 1GAEO 1DFHA 4XYLA 3GEGA 3EVTA 2Y0EA 3T7EA 1DC6A 1DC5A 4OO3A 2WM3A 1YXMA 3GA0A 2J5QA 1WZIA 1ONPA 2C54A 1JLLA 4PLTA 3PGJA 4C7KA 4BNHA 1EE2A 1MB4A 1DXYA 4BO6A 1NVMB 3D3WB 3IMFA 1E5LA 5L4LA 2VNAA 2NV6A 4JJIA 1Y6JA 4BKRA 3CMMA 1SC6A 3NGXA 4HBGA 4E12A 2BHLA 3AI3A 4A27A 1U7HA 1C1XB 3GEMA 4RPHA 2E37A 4CM1A 3G49A 4CLEA 2LDBA 3INGA 3ONEA 1LLUA 4AVYA 1YVEI 2VWHA 1NWCA 2QHXA 4L4XA 4J4HA 3STHA 5J23A 5JFOA 1YS4A 1KVSA 3ZV4A 3DBLB 1JKFA 4QQRA 2Z1NA 5KVQA 4HY3A 4Z3DA 4BKPA 4FFNA 2DAPA 1SPXA 2H6EA 1EEHA 3GQVA 5KJCA 3WNQA 1ZJZA 1BXGA 1M6WA 3JQ7B 3QWBA 2PKQO 2GZ1A 4XGKA 2YZ7A 3WOHA 5F3RA 2YHIA 3NUGA 3H9JA 4UUPA 3S1LA 5ADHA 1ZH8A 3K9QO 1PWZA 3RAJA 3IS3A 1LA2A 2CSUA 3EZYA 4YPOA 3ZU5A 2D59A 3W6UA 3K8ZA 3H9QA 4GH5A 2BF7A 4OXNA 4NJMB 3L4SO 4I9UA 2H5LA 1XHLA 1YJQA 3OF2A 4D3SA 3S2EA 3AI2A 3WBFA 4BNUA 3F6YA 4YJGB
chains in the Genus database with same CATH superfamily
4DOMA 2RE8A 1T3TA 3RSGA 2AI2A 1C0IA 3OEED 1RWQA 2QSJA 2XYQA 4TROA 4B35A 2VO1A 4QYIA 3H9CA 1Y6GA 4ECEA 4QM7A 2HM7A 2ISSD 5C7IO 3CLUC 4Y0VA 1I9GA 3I3OA 3QIAA 1ZR2A 4DDKA 4JN6B 3IIIA 3BPSA 3MT0A 4QWWA 2ZQ5A 5FPTA 3ZHUA 2BGMA 5A4FS 2C1ZA 2Q5LA 2YVQA 1E6KA 4ZO4A 4XSVA 3W5AA 2FP3A 1QUEA 1Z73A 2ZETA 4ZGGA 3DL7A 5DTRA 4PSKA 1ODFA 1OLSA 5IC6A 1Y7IA 2OYCA 1L4EA 3EG9A 4RJ2A 3A6HA 4RH0A 2XVZA 2PS9A 2VHWA 2V96A 4BNTA 1F20A 5TNXA 4EAAA 1KFBB 5LWHA 5AXAA 4ID9A 1AO0A 4JQZA 2LKCA 4AN1A 1NJFA 4D9HA 5J2TB 1YA6A 3MYYA 5FPPA 5IT9A 4H0CA 3WYGA 3NRJA 3CPHA 3FTDA 1V1RB 3PX3A 5LYJA 8ABPA 3PITA 4RANA 4NBKA 3S5JA 3OT4A 3MC1A 3M6WA 2Z1DA 3B6ZA 4PRYA 3U7JA 1SCAA 8OHMA 3QW2A 1D2RA 2W48A 4Q4AA 4P4NA 4X45A 1VE9A 4ND7A 1B16A 1FMJA 2G36A 3F46A 3N86A 1UBMS 5IJWA 4QT4A 3WQQA 3A06A 3PDCA 1R3DA 2GEUA 2FA9A 1LW7A 1F2VA 1U2DA 2WICA 3AP2A 4RFSB 3ADOA 1UMBA 5LZ8A 1Z08A 3ESBA 5JD4A 5FBQB 1IQ0A 1IEVA 1JA9A 4FOOA 4M55A 4Q16A 4U2FA 4WBXC 3H11A 1EUYA 4BECA 2PWAA 4EQ6B 1N5KA 2J5BA 3PFIA 4KO3S 5GZ6A 1PZMA 3RU7A 5JMOA 1KZ6A 4OLFA 4YO7A 1J09A 5EHQA 5HOEA 3T1YB 5JS1A 1D6JA 1Z62A 2IEAA 2QJRA 2ZJFA 1IWBB 2XYPA 4ER0A 5JATA 1S5PA 3V8VA 2VJOA 5LZ2A 2IKSA 2J0VA 2PX0A 4AO6A 3KSAC 4GMHA 3ZHQA 3RROA 3UFXB 2ERCA 2NPOA 1NNUA 4YPVA 2VDVE 2B5OA 4FT2A 1PGJA 5FTJA 2ZRGA 1OVMA 1UKAA 3A2MA 4Q4JB 3VSBA 5SY9A 5C35A 3O2JA 2HV9A 3N6RA 3RTCA 1A4UA 3H97A 3TX2A 4B34A 3NP7A 5GZ1A 4RJTA 5ALOA 3R0IA 3DE2X 2YY5A 1PVDA 5KI6A 6AT1A 3FOEC 1FSZA 1RAHA 2IYEA 3MSCA 5KDOA 3GFTA 4I50B 3SXJA 2Q5IA 5HRCA 5GGYA 3S4YA 4J0HA 1PN3A 4GWLA 1O5TA 1ZVJA 1DTSA 2OKCA 2WINI 4I1SA 4CV3A 5E3IA 1NTRA 2QW8A 4OJMX 2Q7DA 1S4QA 1JLRA 1SU6A 4Z4GA 3D7MA 3G8BA 3LDAA 3ZJVA 2C0PA 4RD2A 4GOKA 3NNNA 1U02A 3E8SA 3MPUA 4MEAA 2Q2WA 4Y0NA 4EF4A 3DBHB 3AOGA 3HVIA 1U2PA 4QSHA 2PLAA 1SD1A 5JADA 1E2EA 1RKBA 5M04A 2FZGA 4TQAA 4Q1FA 4GQIA 4RKRA 4QOGA 5H80A 3CG0A 2Y66A 1FF9A 4UBNA 5JLAA 4RV9A 4M0MA 2KPOA 3HNOA 1P8JA 1SVOA 1P6XA 3TD2A 1C2TA 2EIXA 4MQ5A 3IV9A 5KNLA 1YQQA 2XIJA 4BNZA 5DCWA 1OXBB 3HHPA 4PS1A 1M1YE 1NXXA 5JAUA 1W5AA 1Z2OX 4LHWA 2WF6A 1J5PA 4ETMA 4P98A 1GFSA 3O1LA 3PXCX 1SOVA 4Y2GA 4DLLA 3JYPA 1J0XO 3FB4A 2CV0A 5EZ5A 5B4UA 4U4AA 2Z2KA 3SS7X 3GMTA 2J9FB 2VQ6A 3HHEA 4QPPA 1XZJA 3PT5A 4D9FA 1L4MA 1KE1A 5ELXA 1H1LA 5EXTA 2GETA 3CO0S 1PVVA 4W5HA 5EHNA 4M1YA 3QA3E 4WSOA 2I29A 2WUWE 4DUZB 1KQFA 2HLHA 2RKOA 4KE9A 2H7XA 2A1IA 1VC2A 3FDZB 3U44B 2ZB8A 5EP1A 3Q9SA 3TINA 2GPAA 4HGNA 2WVAA 1REQA 1C9MA 2E4XA 1WUJS 4I08A 5F77A 1B14A 1GEEA 4Q3OA 3T38A 4X7RA 1OBVA 1EWRA 1Y9EA 4AKGA 4KGXA 3G7SA 3PKJA 4KIGA 1XZBA 2O8CB 1W96A 1YVRA 2VRBA 2PT6A 5C9ZA 1RKUA 4GG1A 1A2BA 3DZKA 4Q3LA 2CUKA 5EMLA 2H5JA 3G2IA 3RIGA 3HM9A 4QBTA 3KPJA 4Y67A 4LGYA 1P33A 4F4HA 5DTJA 3GA5A 1JMKC 2YIVX 3FD8A 2QLFA 3TL3A 4DABA 4BWYA 1F7UA 3A6PC 1E1LA 3LHIA 3T1QA 3SJ7A 2EEPA 3WYNA 3UJAA 5AUOB 1R0WA 3HTXA 4E2YA 1XPRA 3TLYA 3N8HA 3WNVA 4ZN6A 2F64A 4PO9A 1HE3A 1JI0A 3H18A 1OT3A 5ALXA 1XPJA 4G26A 3V8RA 3DQQA 3A14A 3H0EA 2A2ZA 4YUVA 3TTTA 4LHZA 3VC1A 4BATA 4MHTA 1MH9A 1UJNA 3ET5A 1BO6A 2DTEA 3AQIA 1GPUA 4UU8A 521PA 3ET4A 1NJ8A 4HRAA 1C29B 2KW5A 2D06A 1Q1EA 4B7ZA 3KOUA 5C8YA 4QOJA 1OC2A 4BVGA 3SEAA 4EW3A 2J9ZB 1ZAYA 1GLNA 2ZB4A 4PZDA 4GQAA 4PPNA 3GN2A 4WUVA 2FUG6 3VH3A 4AY6A 3GCWA 2XGSA 3VYTB 5M2QA 1AV7A 4EJSA 1YKGA 2OFWA 2P0AA 2P68A 4NVRA 2GRJA 3KTAA 1U7XA 5H70A 3A9UA 1VGQA 2W6IA 4XM2A 1OW3B 3FLAA 5B2FA 1YB7A 1Z2DA 3VR4D 3NHJA 3CBQA 1MOPA 1NATA 4HTFA 5EWMA 1UINA 5B1IA 2SKDA 4EPRA 3JYQA 4M49A 4AG6A 4A1OA 2WWGA 4DCTA 2JRCA 3PNQA 1T2VA 1KOFA 1V2HE 3D8SA 2ROQA 4ILEA 3UUGA 1LDYA 2XPCA 4UHBA 1ZJYA 3WHPA 3JAMA 2H18A 1RLIA 3JV7A 5EZYF 5FWYA 1AK2A 1KBOA 1C4OA 1YI1A 2EHJA 3PV0A 3ZK7A 5EHZA 4RQBA 3IMEA 3ZTWA 1XAIA 4UARA 3UBMA 2R84A 1L3IA 2J3LA 3NHMA 4K6MA 2XQVA 3MUFA 3GRKA 1I4LD 1QYCA 2FKNA 1N4AA 1NI4B 4WDQA 4ZVPA 3UF0A 5D3KA 2VP0A 1VIDA 3H4IA 3D3NA 5DNAA 4YRJA 4F97A 4I5GA 5FX2A 3QKWA 5TS3A 4Q03A 3HPQA 4GX0A 1AKEA 2Q3CA 3AK4A 2I6SA 3E7WA 4ITVA 4C07A 2HA2A 1UT6A 2O8VA 5B6PA 4MV0A 4UTRA 1E0JA 4K2AA 5BVHA 1U6IA 3WYFA 1KQPA 4J49A 3SQNA 4DA6A 4F3NA 1A82A 4ABYA 3O4IA 3CGWA 1VSQA 3HKCB 3O3MB 4LNAA 1KE2A 3WLKX 1HTBA 2N46A 2OESA 5CT4A 4LJ4A 2HT6A 4RMIA 4BNXA 4DNOA 1PL0A 4D5GA 3ZJ5A 5B64A 4QQKA 3TL2A 1YKFA 3LRPA 3ZDQA 1TLFA 4HDMA 4B33A 2F8TA 2XXAB 2FQWA 1TJ4A 4TMVA 5HILA 1N6PA 5ALLA 2JW5A 3FHLA 1UZMA 2BEVB 4C0AC 2IYOA 3BN3A 2GA8A 3BX1A 4I1IA 4N41A 4NXNB 1ISHA 2EP7A 2VPQA 2PJRA 1P2GA 3HS3A 5KMGB 1J7JA 2XLBA 5LQJA 1BGVA 4H3HB 5E38A 3H3XA 5IJ9A 3ENZA 2INGX 3FYHA 1WOMA 2ZCUA 2QVCA 3OZEA 4X94A 5TPZA 2A86A 3B2NA 4FD2A 4EABA 2O06A 2NYAA 1R15A 4HK4A 3TTUA 1T6YA 5AW8A 1YE3A 4EJFA 2CJPA 4IEIA 4TL7A 3PD1A 3Q72A 3FSGD 1TTPB 2YWJA 1DHTA 3AB8A 2ETXA 2H48A 3Q40A 3CE9A 5HCNA 5LIPA 1RKQA 2P9QA 2XSZD 4BP9A 4KITB 4Q9IA 3PL5A 4L22A 3CR7A 1AQJA 1CK4A 2FW7A 3OFND 3KCNA 4XUGB 1I2CA 4WOKA 3H1BA 1W1WA 2HW8A 1SQSA 1QB7A 1XZGA 2WJAA 3LKBA 3QG1A 4JOSA 2W43A 1ZA2A 1Y5NA 3JYOA 2NSLA 3TZEA 2JGRA 2EKPA 2ISCA 1QIGA 1ENOA 1RSZA 1P39A 1XEXB 2CXRA 2PX6A 3G2PA 3GWGA 3MTQA 4AUKA 4QGBA 3W90A 2WF5A 1G0OA 5A1TA 4WASA 3N2NA 4AY5A 1E0KA 1J42A 3MAGA 4G25A 4X60A 2YFYA 4IIFA 1F2TA 2BKAA 5KYYA 2P3OA 1LSOA 3UXEA 5HE9A 1NA5A 1UH5A 3AKDA 4K1XA 5DM70 3B70A 3IERA 1PFQA 4M1EA 2HMAA 5FTMA 4EA9A 1KQOA 4MJ7A 2VP3A 3OMWA 1IM5A 1G8YA 2GJ9A 3YASA 2Z6VA 1WXQA 4JNKA 4XEHA 1UXGA 3PZBA 1KYQA 3T9FA 2HWKA 4GRAA 4KQIA 3SZOA 1M73E 1ULAA 3MIZA 4LGCA 3ABIA 5IC5A 1YFKA 3ETHA 1KA9H 3AB3A 2GEDA 4O59O 4WZBE 5HF6A 1YZLA 1ZH4A 3OU2A 4G84A 3IT3A 1GZ5A 4NMLA 3EGXA 4KNYA 3FPGA 4YP5A 3UYKA 1C3XA 1FYVA 2FN4A 4OLJA 2VT3A 4TT8A 4YONB 4CZ2A 3V6MA 1TI7A 3DZJA 1M2GA 1AKYA 1SVIA 2JAWA 4DR4B 1S8NA 3S2YA 4YLEA 4YDHB 4MJ3A 2GCGA 1NE2A 4PLHA 2GRUA 3DTVD 3RRMA 5ILQA 3TIIA 1PDOA 1XDUA 1D9ZA 2DPLA 3V7NA 5DW0A 3TFOA 1E2LA 1G63A 1GT91 1I2ZA 3IH5A 1SA0A 4W7HA 4EUSA 1QHIA 3UJNA 2E4VA 2WHYA 3KT0A 3HA3A 3P9CA 3QELA 3RRFA 1CNEA 2AKYA 2J33A 2XV1A 2OO5A 4XM0A 4L28A 1AM4D 3GLHA 1XRRA 1QH1A 3HG7A 1CS4C 3OLCX 4C4RA 4AC9A 3UJBA 4CN9A 5CM9C 1TJPB 2C9CA 4KPUA 4OHOA 5KX5B 4WLNA 1DLJA 1VL5A 2FN8A 4CG0A 3L7LA 2Z2JA 4IRMA 4QX6A 2NZVG 5AKZA 2P1DA 3IEVA 1E2JA 2Q4BA 3CF6R 4KAAA 1DCFA 1N3IA 1GDHA 1JX6A 3ED1A 5KWIA 5LYJF 2CVHA 2C7QA 3GVCA 4R7TA 3TGLA 3SNKA 1HZJA 1VL6A 2C4KA 1P3Y1 3OJOA 4K9NA 3W9BA 1MB0A 4ER5A 2QR3A 4QARA 1G60A 1R9JA 2EBUA 4E6PA 2BPOA 3NANA 1VPEA 3X2SA 1QOPB 3GZNB 4ALLA 5AI6A 3F8SA 1NR5A 2BCEA 4J91A 4Z0PA 5K6RA 5KKNB 3SXPA 1KAMA 1TO1E 2JGLA 3L4BC 3U5TA 2VSYA 4MVJA 1PJ8A 5DP1A 5TEVA 5G0VA 3SVZA 4L74A 2ORIA 3JW8A 4ALMA 3IVXA 3B20A 3I0NA 4YGYA 3CPJB 1ZM2A 1ENZA 3D81A 5DISB 2HWWA 1B3BA 4JS0A 3ZVRA 1A9ZA 4JR2A 4W7SA 3CLKA 2KMLA 3QPWA 4TWJA 2QTFA 4XA8A 5HBRA 2XT6A 3VPDA 3ZBTA 3ZWPA 4ZK6A 3O8OA 4ER6A 3NB0A 4OQXA 5IKPA 3DZIA 4BLPA 4CF5A 2NO6A 4UUMA 1CETA 1MUUA 2F3SA 4I4CA 5LZ4A 2QRJA 2Y9PB 3CE6A 3H4VA 4P86A 3GEPA 4P92A 4DIFA 1THZA 3UATA 1KOJA 1P29A 4XJXA 2B78A 5FBLB 1QKJA 5I9TA 3GAMA 1DAFA 4NZOA 4RQTA 3IRVA 4MP3A 2BM9A 3RBVA 4H4CA 1R74A 2PL3A 2ZWIA 1I5OA 2FWMX 3CNBA 3LXRA 5DHAA 5CB4B 4XX1A 4F92B 2JVKA 2JGIA 1EI9A 5IASA 3OX2A 1ECBA 1W93A 3FHJA 1HORA 1FBTA 1I0ZA 1VGVA 1E2DA 3C1TA 4NMMA 3LH5A 1JMVA 2R8EA 4FCTA 4YT4A 5KYWB 4A15A 5CHYA 4JU9A 3U13A 1OIWA 1PK9A 2PS3A 2PGDA 3NHSA 5MN4A 3FNBA 3E7PA 4OGWA 4XZ3A 3CS3A 4R9UC 4L5AA 4OLBA 1Y5IA 4G0VA 3R7BA 2YV3A 4J2OA 2V7PA 3GFSA 1OH7A 1XN1A 4L0QA 3RYCA 4KIFA 4KSBA 4UCXA 6NULA 4L6CA 1AB6A 1TM5E 2FPSA 3X1DA 5CEFA 4EI8A 4C0LA 5CYOA 3IO3A 3K6SA 2ZIXA 2GBFA 2CMFA 4TRNA 4GKBA 2J3HA 1C8KA 1P61B 1A7AA 1R3UA 4J0KA 3GP8A 2Z3ZA 3KXKA 1XDDA 4RORA 5HOQA 2H08A 2EBHX 3PCXA 4DMLA 2B2XA 3PWTA 4OPMA 3WYDA 2F4VB 3VMFA 1OMOA 1D2HA 4RSRA 4CR7A 5HF8A 2DMRA 1K5PA 4E70A 5FIUA 1KSHA 2P2YA 4DIOA 2P77A 4NONA 3D7SA 2NVUB 2HQOA 3QVLA 4FCVA 4H60A 5DXFA 2DHDA 1GTG1 1ZI9A 3DZGA 4Z1MD 1NLUA 3IB6A 3ZBUA 2R7MA 1AIPA 1ZD4A 1DX9A 4D3DA 2X7JA 3EXFB 2WG2A 4J0DA 1ONNA 2B98A 1UC8A 3LGAA 5I7OA 2A88A 2B7CA 4I8DA 4LCJA 1RPZA 4PAOA 5IDYA 1IULA 1M34A 2QM8A 1JEJA 1TKCA 3GH3A 4TS1A 1E79D 2I6XA 1T35A 2C83A 4CF3A 2IOFA 2OCIA 5AR1A 3LZCA 4HQLA 2OZEA 2R65A 4Z2AA 2IODA 1SCJA 2OGUA 2M6RA 1RJ9A 3MVEA 4DV3B 1A0OA 3BWYA 2AJDA 4HX9A 3JYHA 3KD2A 5HUJA 1BJTA 4OHRA 2EHDA 2GR9A 2Q45A 4ERXA 1EIZA 1U98A 1R0BA 3KQVA 3EIUA 2ONJA 1DV1A 1UMKA 1NHWA 3B53X 4ZZIA 3UC9A 1X0VA 2D4AA 2PS1A 1NQWA 2VXYA 1KSGA 5FUWA 4GT1A 3OQBA 2JCVA 1U3FA 2W2TA 3GEBA 2VHTA 2PIAA 4ICIA 4AF6A 1CS0B 1EHYA 5FBKA 4C6TA 3PJRA 2ZS8A 2FPRA 2C5EA 3B6JA 3BAFA 3A3OA 3GH1A 4G4SP 2DP4E 4INAA 1VIMA 2HNBA 2OHXA 2ZYIA 4WD3A 1VZ3A 2WD9A 4U6SA 2FZ5A 5DWDA 1YR6A 5AT1A 4Y6OA 3G8AA 3QX8A 4WCVA 1TLTA 3TWOA 1TYEB 4ALKA 1UOQA 2EKLA 1U7DA 1WUYA 4EG5A 5KC9A 5I9BA 3DDNA 3OPYB 4J1QA 4DARA 2G6TA 3FYUA 4FW9A 2F6RA 3C3CA 2GVNA 3IOEA 3PUYA 4PHCA 1PYOA 4EW6A 1GSAA 2OFPA 4DBVO 5J4LA 4YAIA 1J0EA 3FRIA 4AZ0A 4ZJUA 3MERA 2I66A 2REOA 3FA2A 1QO0A 2BGKA 4FMCB 4Q3DA 1WD5A 1QLHA 4QO7A 3BWXA 4LF5B 2RHHA 2NXNA 5JDCC 2QTLA 1WZ2A 3ID6C 3IQFA 2Y68A 4OMUA 1Y98A 3OFSA 3NH6A 1YCDA 3C45A 3GUCA 4X7BA 3TLJA 4DVGA 4EPWA 2G5GX 2PUJA 1U3WA 3Q0TA 1F8XA 3ZGNA 3CX6A 3IEMA 3F1LA 4XDZA 1CF2O 2QG6A 5BV1A 3R7DA 3OKPA 3OUTA 3ACCA 4QOEA 3F71A 4DA8A 2JCGA 2JLWA 2Y1GA 1ND6A 1QP7A 1WCIA 2PL5A 3UFBA 2JJ1A 6LDHA 4UZFA 1TMKA 3NDIA 1N5OX 4GE0A 3K1AA 2GJSA 1Z37A 4I8IA 4UDYX 4OHUA 3GFRA 3WNZA 5GOTA 2ECKA 3BCUA 1XO1A 1LB1B 3R3HA 1P18A 4GX5A 4IOJA 4XSGA 4YWHA 4ND6A 2Y4OA 4U0KA 1PX2A 3X1ZA 2FUCA 2C0CA 3INYA 1G8KA 4CM8B 3AFHA 1DBVO 1N5IA 1P3DA 3HCDA 1GKUB 1QX4A 2C1EA 3HGTA 5EQFA 1PR1A 2ZRMA 4GIBA 3T94A 1VQ1A 2WKRA 3B1ZA 3DPIA 2C03A 3RSZA 1ID1A 2QTBA 3A4TA 2QDXA 3O4GA 4A0FA 2AOXA 4HXFB 4CF7A 5FWNA 1SIUA 5KYNA 3VKGA 3ZWQA 3Q87B 3AVQA 2H3HA 2P1RA 5AIBA 1RI4A 5L95A 3T5AA 4D26A 4C4SA 3PVCA 1SGWA 1U1DA 1DQZA 4REMA 5KAPA 3HGMA 4L7QA 4F3CA 3PPWA 4IOMA 2F2TA 4FFBA 4RTSA 1AN0A 3L6DA 4IQ8A 4U7TB 1K6IA 2OYRA 2MYPA 1SBNE 1QORA 3PS9A 3O3CA 2AOTA 2QUBA 5I5EA 3HWWA 2A1UA 4DLXA 4MS4B 1FDSA 3H5IA 4MYHA 4CV0A 2PUAA 1YQDA 4DLSA 1Z0IA 3NC0C 1NC3A 4NOLA 4F9GA 2OQRA 4KPYA 4E6EA 1Y1QA 4WA8A 4XDHA 1Q14A 3N76A 5B55A 2WW8A 2QWXA 5L8VA 1ADFA 4HQOA 5I7VA 4UEOA 1FJHA 1JIKA 2Y1KA 4PPFA 1PFWA 5IFKA 3E5NA 3SZ3A 1XTTA 1N7HA 3KOZA 1G3QA 4B4DA 1BOFA 1BWPA 4LECA 1JLMA 1JFRA 2OCBA 4ENTA 3MFQA 1JXMA 3NTLA 5F78A 3C3YA 4O0LA 5DDIP 1DELA 1TCAA 2X8BA 3NTOA 3PE4A 4OXXA 4TN5A 4D9MA 3K1ZA 1CKEA 4LSMA 3TMYA 4XYEA 1F3LA 2X4GA 4UEWA 5CK4A 5J2TF 4AXXA 4X97A 1ZFNA 3ZE1B 2FDRA 2HD4A 1D4OA 2BOVA 2ORVA 1GL7A 3SZMA 4DYHA 2V7UA 3MBKA 3GD5A 1B6GA 4PZUA 4Y30A 1PU2A 3PUHA 4H35A 1CFJA 1MAAA 3W7VA 2HSJA 3F5MA 5CX1B 3RUEA 4U7DA 2XJ9A 3OBBA 3DO8A 4XIJA 3NHYA 2I7DA 5HCUA 3JARB 2Q3FA 2IU4A 4WESB 3KXIA 4GE3A 1U90A 3ODPA 3ZLBA 1F8YA 2ZEJA 3LZDA 3AERB 1PSZA 3L7AA 3A70A 2R2GA 3OCUA 2H7CA 4HDOB 5CIWA 4BO0A 4C4AA 1ULSA 2BMJA 3H9BA 3IVRA 5FQOA 2Q0XA 4Q21A 2FFBA 3ZDEA 2ZM5A 1E3MA 4H1TA 1RZVA 3IODA 3ITEA 1T4DA 3ZWAA 3JVVA 1GTRA 5HS4A 2C2OA 3NS7A 1Z28A 5L4NA 3INRA 3T4PA 1Z9BA 3LX6A 1ZQ1A 1PNTA 2QRKA 4IGEA 3W77A 1FYWA 2JIZD 2WKPA 1TK2A 3NHFA 2XZDA 1BNCA 3CV3A 4L9WA 3OQ1A 1H5NA 3JQBC 5BNZA 4XX0B 4P58A 3W5BA 1XRSB 1RCUA 3KG2A 1GUZA 3Q3JB 4FVTA 5I8WA 3HBAA 3AXSA 1E98A 3RFXA 4M86A 2HEGA 1JJFA 3RUAA 2HH9A 4GXRA 3L8CA 2L42A 1P0PA 3IQXA 3F90A 5HS6A 2C7RA 1E94E 1L5VA 4BNWA 1Z07A 3WE7A 5JYEA 3P19A 5JJ5A 1TOAA 3HBMA 4G63A 5AQ1A 1P9NA 4NX2A 5KVAA 2I03A 3Q8XB 3E18A 3RODA 1TDJA 3UJDA 3AY3A 5JT1A 3A6DA 4OBWA 4BN4A 1SELA 4JHLA 1KFKB 4P9NA 4ZJZA 2C31A 3AM3A 2CLFB 3ZCXA 3WYEA 4B2LA 3MB8A 4J29A 2VQEB 2W83A 4KRYA 4O3FA 2MINA 3WB0A 2J5XA 3AINA 4KVGA 4D0RA 1ODIA 2CV2A 1J8DA 3SDBA 3EZLA 1KNXA 4OEHA 3PFFA 3DM9B 3S68A 1XHEA 3E82A 3BXFA 4AKTA 1YTUA 2IU3A 2ZANA 1U8UA 3GJSA 4XE5A 1E3DA 1E5TA 2R86A 1JW9B 3LY7A 3LC1O 1XK6A 4Q0MA 4BV8A 4EHLA 1PR2A 2B0CA 2JLSA 4MW7A 3B5EA 5EJ6A 4KO8A 1GM5A 1JHAA 3G1WA 4DKJA 2GBGA 4LQDA 4B09A 1RRCA 3JZIA 4LSWA 5FD8A 4JVMA 4MP6A 2Q41A 3OLWA 4FE3A 4IG9A 3WLSA 3M5DA 4BFVA 3QOFA 3RRXA 5LFAA 2W9XA 5CCXA 3I45A 2W0MA 1CQIB 3Q41A 4F5WA 1Q0TA 3UXYA 4CTKA 5TV2A 2O3JA 3AR3A 1WMBA 1XYYA 4TTPA 1BDIA 4ACBA 1YSCA 2W2LA 1SXJA 2X8JA 5HVNA 2ZB2A 1M1YB 1CT9A 2GEBA 4LI0A 4WNAB 3QSYA 1KH3A 3B85A 4BLOA 1RI3A 4XYGA 1HRDA 1XLWA 3PB3A 2JRLA 2XOKD 2QAGA 1XNHA 4LKOA 4AJ1A 1Y6FA 2PMDA 1SURA 4AMYA 4ZYVA 3FAZA 3WAJA 2WKQA 3LIPA 5T64A 4B17A 4D98A 5LDDC 4LZWA 4OP3A 1VL8A 3GV0A 5BW6B 4DR1B 1ZK1A 1DFGA 4HLUC 1SEPA 4MV4A 2XBUA 5LLTA 1J8YF 1U0JA 4DJFC 5LM3A 3NM4A 4G1CA 4U7WA 4WKBA 2SKCA 5F73A 5FNVF 5TT1A 2FUKA 4TWRA 3CEAA 5CBKA 2WNSA 3EIOA 3VPBA 4PRKA 2XUFA 1LQTA 1HURA 1BXRA 5LL6P 4ZT7A 5A0FA 2CVZA 4C7OA 2C97A 3FKSA 2QORA 4EPVA 1OVGA 1G21B 2J0UB 4TVBA 2DQZA 2BFMA 4CWAA 4C7XA 5E1MA 4EJ2A 3CEJA 4BMOB 1PJTA 2I2XB 3A1DA 2ZUVA 1Y3CE 3DYVA 4HAXA 4PLPA 1Z33A 2EJUA 3BKWA 3KQTA 3TQFA 1UPFA 4P5DA 3BHNA 4B7AA 4QLOA 1U8ZA 4LHYA 2H16A 2VRNA 4XPZA 5ILOA 1JXQA 2FB9A 1MQ8B 2PV0A 4EPXA 3AVVA 1JH9A 1F4LA 5KKCA 1QS0B 2CMGA 3D7LA 2CHQA 1HFKA 2XOEA 2YN4A 3CT4A 4GP6A 4O6VA 5A03A 2VH5R 1UK6A 3QEAZ 2EQBA 2O48X 3EIQA 3RGGA 4EHAA 3OX3A 2JHCA 3O73A 1EGAA 5C32A 4B48A 1XHFA 1DDGA 4O4HF 1Q95A 1N33B 2GFIA 3WLEA 1K1EA 3ONWA 1PLJA 1P45A 1PZNA 2WE7A 3G9ZA 2QQ0A 1Z0SA 1KZYC 4PIPA 3CH5A 3L0BA 3O9MA 5HGJA 4Q3EA 1OI7A 2AIRA 3WMRA 1DLIA 1HQKA 2POQX 2CFOA 4LTDA 3KALA 3PZRA 2RHJA 2R8BA 1PKEA 5LR6A 5CLGA 1UM8A 4DC9A 5IK2D 2C3YA 4LWQA 1M0EA 2F8SA 1I4WA 1Q6YA 3M6MD 2BTQA 4HDAA 4DNPA 2NNWB 3OTOB 3QEKA 1OWOA 3I6IA 3ICWA 2QMEA 3B3JA 3KQHA 1P2UA 1SKUA 2IBMA 1E5VA 2Q5EA 4B3IA 5ALNA 1I7QB 4BEWA 2NYRA 3NIWA 4F3YA 5BR1A 3NOVA 3F6BX 4Q47A 2C2WA 2HPAA 3EQ2A 4JOCA 3VVMA 5CGQB 3GLKA 4F06A 3PNBA 2D2IA 2LCIA 2PDAA 2NSJA 4BFXA 4NCAA 2ZRPA 2G9VA 3DXZA 4RLSA 1J99A 3T15A 1Q22A 2R8RA 1GSIA 2ODPA 2RG1A 1NBME 3I5YA 1TF2A 1RYYA 4ML3A 1DG9A 5IKXA 1O89A 2WTNA 3JQ7A 4D42A 4QUHA 3ADDA 1NVAA 2WLTA 2Z2ZA 3MQ2A 3QE2A 5CEEA 2R6AA 1IONA 5JAZA 2OGSA 1EHIA 2FJPA 3HJTA 4LVCA 3NXSA 4D0NA 1JHZA 1VA5A 1XCPA 3OECA 5BUZA 2P2DA 4PYQA 1GKLA 3AFGA 1O9BA 1V6AA 3VKFA 3UK7A 3RSFA 4QAQA 5DOVA 3O31A 4LXUA 3O4VA 4E08A 3OD1A 4Q3NA 5JV5A 1X1QA 4PYMA 2AMLA 4F21A 2OLEA 2LKDA 5EXSA 5EJ4A 3VR3D 5ITSA 3EK2A 1C0KA 1P4AA 3MTJA 4CCSA 2SECE 4JLJA 3TSWA 2CHFA 1XOIA 4ARAA 2GCNA 4BEVA 3ROTA 5B3KA 1IPFA 1JU9A 2XUKA 4FHEA 1ORVA 3CF4G 4UFOA 4WY5A 4J1TA 4V1CI 2BCGY 3L0ZA 2P9JA 4JGBA 4JLBA 1ZM4A 3L0SA 1T36A 3OQHA 1XQ6A 5I9IA 4HH1A 1E9FA 1B0UA 3I04A 3K30A 2OOKA 3P0HA 4MR7A 4CFYA 5JQWA 1HK7A 3DUFB 5CD1A 4G5FA 2AMYA 2X1VA 1MFZA 3MXTA 3PDUA 4MGKR 1T9AA 4AULA 4ZYTA 4DCCA 4G89A 3PDIA 1H94A 2OC4A 3MWEB 3UKJA 4BNLA 4BV9A 5C1BA 2GK4A 3PNMA 3KD3A 1E1KA 2FCAA 4B76A 4DPMA 4CM9A 1J1IA 1LV7A 4E4YA 5CDSA 1WSAA 3U4AA 1HE4A 5KCZA 1XMOB 1DRWA 3EC2A 3KOYA 2AG5A 4XB6B 3UJ7A 3OE7A 1GWNA 3GLQA 4S05A 4P0TA 1GTVA 3A9TA 2WZDA 2OENG 1YL5A 2E3JA 2QN1A 2KWIA 2ZWVA 2HGSA 1QFJA 1NC1A 2EZ8A 2OBMA 4I5EA 2ZZNA 3Q9NA 1Y3HA 3OG9A 3PC4A 3QUQA 4HXEB 3ADCA 3N5CA 4Z9BA 5CXXA 5DNDA 2QBYB 5GM2A 2ZT6A 4JVSB 1ORHA 3E84A 3RC3A 1WHSB 2XE6A 3NHLA 1HQCA 3G7UA 4I1RA 4EJMA 3CSUA 2PZBA 3PRJA 4BMPB 1NF3A 3NBXX 4ZJPA 1KPGA 4RDCA 3EEYA 1KO8A 1WQ4A 2WT4A 1QBGA 1RLOA 1KDTA 1PCXA 1UFOA 1NNI1 4KXQA 5FJIA 4GW3A 4RBNA 3SQLA 3WX0A 2D7DA 1C9DB 2ZI7A 1YBAA 4U2KA 3JYLA 4KEAA 4JLWA 4XRRA 5IDWA 2XB8A 1A96A 1UXJA 2WNHA 1R2QA 1MAVA 2J3IA 1XNGA 4ZYLA 1P1RA 3WOVA 2YIDA 3PVZA 5KOJB 1DJMA 1XLTA 4NBLA 2X9QA 4GKAA 4D57A 1Z56C 1VBFA 2O0HA 3BORA 1Y9DA 1XTIA 1IHOA 4P4SB 3ETJA 2VPPA 2K4MA 1H8HD 4UBKA 4DT1B 4QU8A 2WM2A 4A23A 5FT9A 3WLQA 3PR2B 3DPUA 2WRZA 3MS7A 2XXJA 3QKIA 4NY1A 1GIAA 1QAQA 4QLAA 3MJ4A 5HCIA 3INTA 1VI6A 1OLSB 4UNQA 4NV0A 4PSDA 3RVOA 4ARSA 4FTWA 4MEBA 5CA0F 2PGOA 5H4HA 2VYQA 2JLXA 5C5IA 3D3EA 4A6DA 1E3QA 2EX0A 3EGDA 1H2BA 3OEEA 5AHRA 3AX6A 1Y3IA 1MZPA 3CNQS 2Q6KA 1AGXA 2OZLA 4D0LB 2VTBA 3RLFA 5H3CA 4X41A 2D62A 3RAEC 4RTRA 5J5VA 3OZXA 5DGTA 5BQXA 1NPTO 1YDHA 1QHYA 1U0RA 3W8NA 4BASA 3KDSE 1XZQA 4P81A 2ZJOA 4HPJB 2PRJA 2YV5A 1QP8A 4MYRA 3QLVC 5SYMA 1EVIA 4FZRA 1T2FA 4AP5A 1ZD8A 1LFDB 1DRUA 2WU4A 3LU1A 3NHUA 1UBUS 4L3OA 4NDNE 1CJCA 4R83A 4RZ3A 5DBGA 4BNMA 4EYOA 1UMBB 3AY6A 3DBRA 1NVVQ 2CYAA 3GRRA 4DA7A 4DFDA 5HIJA 2PQMA 2O1XA 4LY3A 2QPTA 3AOEC 1HLPA 2QUHA 4DTIA 1H42A 1KAHA 4C43A 1JHPA 1CZUA 2P9TA 1MIHA 1T5HX 5CLJA 1K7YA 3I62A 3BF7A 1VJ0A 4F91B 2Z8YA 4HWGA 4NU6A 2GCOA 6YASA 4DZTA 1VKRA 4JBIA 1VRCA 1BHSA 5EHXA 4QULA 4ENVA 1FLNA 3P45A 3WKEA 3V55A 2JK0A 5B7NA 5LXTB 2W42A 2FVXA 3HN6A 3C8ZA 4HUJA 3EMBA 3PFBA 2G63A 4PPQA 3N7AA 2C77A 3PHCA 1AUOA 1JAHA 3OHSX 5TMPA 4J2HA 2KE5A 5HUHA 4L4ZA 4BO2A 3AJEA 4HAOA 2H54A 1LPBB 3LP8A 5TRTA 2PYIA 3L8GA 3MIIA 4YIKA 3N87A 4U63A 4FFOA 4JX9A 1AKWA 1TU4A 3KUXA 1L7BA 4FOPA 3DFUA 4W8OA 3VVBA 4MA4A 3K0AB 1CG6A 5C18A 4ESVA 1SHLA 2IL1A 2VDOB 3E3LA 4MTLA 1M2OA 3DMDA 4MUGA 4NI5A 4QPCA 1TVMA 3KM0A 5BSRA 1PNRA 1BYIA 5CAEA 4EI2A 3ZE9A 3DLCA 3GRPA 3UH1A 3H17A 4KUEA 4MRAA 5KJ1A 2E1RA 5JBNA 3NYIA 2C20A 1O9HA 1W5TA 2DQ4A 3U39A 3VSDA 1XL1A 2Q6VA 3PXAA 3SOZA 4BGDA 2JLCA 3Q3CA 2VCEA 4MMYB 4ZT2A 1UP6A 1CVLA 5ALQA 1NVWQ 1PSWA 4UATA 3IP3A 4DLPA 2ZW9A 3HVUA 4XQEA 1H0HA 4NCHA 5AM4A 2XNCA 2V6GA 1J00A 2ZPAA 1HT3A 1ZOSA 3NUQA 1Z29A 2UYYA 4KXMA 5ALRA 2WAYA 3DMTA 3QU4A 1PGPA 3L0DA 2JFUA 1W52X 5ALJA 2QVZX 1SQ5A 1UBGA 3B3AA 4HVCA 4ZHSA 2WF9A 4MB6A 3N8NA 2HHCA 5DEOA 3CVYA 5LSAA 3OAAD 4R3NA 5F1PA 5JH7F 4JXXA 4K0RA 4YV7A 3BBPA 2EKZA 3AR5A 4G1MB 2ZBGA 1OCEA 1EZ4A 2WC1A 1V4VA 4H6WA 3QQ5A 3AF4A 2QGFA 2YV2A 3DE6X 4RVNA 1W76A 1YC2A 1VFNA 1CJVC 2YNMD 3VJLA 4BRZA 5EIAA 1SHJA 2VOJA 1LS1A 3AUYA 3IEUA 3M6AA 4LJ9A 3TNYA 3TPFA 1XRMA 1G2PA 1KO4A 1DO8A 2XAUA 5G1OA 4UZEA 2QRPA 4I3FA 1CIVA 1RTKA 3P2YA 2AFRA 2TS1A 1H1LB 2DETA 1IH8A 3BA1A 2IUYA 4TYQA 1EM8A 1JHOA 1Z35A 5BT9A 1I3CA 4BO3A 3T3IA 3D2LA 1USGA 2PMKA 4NHOA 4LHVA 1SU7A 1IMOA 4XWAA 1WNFA 2H31A 1S2MA 4ZI7B 1GQQA 2Z2XA 3EFEA 1G4UR 4WEQA 3LGSA 2F1IA 2QVBA 3NIBA 3V4PB 3T3OA 4ZHQF 1P19A 3OHMA 2J7KA 2ZYDA 4EP1A 3UCFA 4NOMA 1JZSA 4X91A 5HA5A 1G5IA 5ICSA 2FF7A 1E7RA 2YXPX 4BL5A 1I01A 1H2WA 4A8JC 5AKEA 4RX1A 4KQHA 3G2QA 1KEEA 4WW0A 2N1MA 4C08A 1PWYE 1W94A 3I9V6 3P9ZA 4NF2A 2Z9DA 1YH3A 3W3AH 2O50A 1AHIA 4RAOA 3DB2A 3VU0A 5G53C 4FCCA 1T9ZA 2CCGA 2HAEA 3DOUA 1XVUA 4FBLA 2IK8A 3FX2A 4FXOA 1CZRA 4NYJR 1XTUA 3DOEA 4KQ9A 2RSLA 3I6MA 3KSRA 4I55F 4I0WB 5IF3A 1Z2CA 3I2IA 2XKBA 2ZYSA 3RASA 3NHWA 3GROA 3PK0A 4I5DA 4M76B 3THXA 1QHNA 1G1MA 3IAEA 1MLDA 2O7SA 3VZPA 5FEUA 2WHXA 3THRA 1P1CA 5E9QA 3D8RA 4U00A 4OI2A 1XDGA 3IDZA 3PEVA 5DBFA 3O9VA 3VHXA 5ABPA 5JQGF 4XIFA 4HZIA 2OYSA 2JLZA 3OA0A 4RL4A 2DHEA 4RPCA 4BNDB 4G8DA 5C8YB 5JPCA 2BR4A 3MK31 2FPXA 3A05A 4MW4A 4P54A 2WJ6A 1R8JA 3FSJX 5FA8A 1VE7A 3TRJA 3UZUA 1M33A 4OXIA 1NW5A 1DCMA 2ZIVB 2G72A 3X1WA 3S28A 3KQMA 3W9YA 1Y9AA 3BGOS 2O07A 3ELBA 1MEJA 3OE5A 3KTAB 2XMGA 1Z3CA 3EF1A 5JRJA 4Y6GB 2D74A 3KOWA 4IJ6A 5BN4A 2H0QA 1M2FA 3QITA 4M9ZA 4S1TA 1Q3KA 2X5OA 1PW7A 2AG1A 5DK6A 4ZIRB 5JY1A 1TEVA 4BLRA 4URZR 1FQWA 1WVMA 1KXZA 1UJMA 2A8YA 2I54A 2PL9A 4TV8F 5FO0A 4B3HA 2QMZA 4ER7A 4MVJG 1Z5ZA 3CLRC 3ASYA 1U5CA 4K81B 4TLCA 1LDBA 3LDGA 1S9DA 5JCOC 1OSNA 3GJ4A 3MGAA 4YV2A 1TAGA 3O84A 1Q50A 4IMPA 2VWQA 4R3WA 2QTHA 5FWYB 4M88A 1G4AE 1ZK4A 2YW9A 3QWIA 3PPVA 4IDHA 4KBGA 4UUQA 421PA 3DD5A 2AF3C 1QQ5A 2AHRA 2QRNA 4LHXA 3ICPA 1E4OA 4KO1S 3VXKA 3NTUA 3P1JA 4RHFA 3C3BA 5ULLA 2P3LA 4UPEA 1JLSA 1JPUA 4JP1A 4OSPA 1U81A 2CD9A 1JH8A 1GRVA 1ULTA 4HUQA 3WG9A 4BY9E 2D2XA 2FFAA 3MRVA 1YA8A 3CEPB 4FI3F 2D13A 2FW9A 3VR4A 3FZGA 4LOIA 1IAQA 1COWD 3ON5A 4FGZA 4JBXA