2PTLA

Three-dimensional solution structure of an immunoglobulin light chain-binding domain of protein l. comparison with the igg-binding domains of protein g
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
78
structure length
78
Chain Sequence
ENKEETPETPETDSEEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEYTVDVADKGYTLNIKFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional solution structure of an immunoglobulin light chain-binding domain of protein L. Comparison with the IgG-binding domains of protein G.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Binding protein(immunoglobulin l chain)
molecule keywords PROTEIN L
total genus 8
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 1994-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ptlA00
4OZCA 1K51A 5BMIA 1IBXB 5HI1A 2JWUA 5BMGA 4HKZE 2RMMA 1IGCA 5HHDG 2RPVA 5HFYA 2EELA 1PGXA 1YNTE 3GB1A 2NMQA 2PTLA 4OZAA 2QSDA 5BMHA 2KQ4X 2ON8A 2I38A 4D2KA 1KH0A 4MACA 1PGBA 1C9FA 1F2RC 1HEZE 2JZPA 4WH4A 1K50A 5JXVA 2N9KA 1GB1A 1QKZA 1MPEA 1P7EA 1XCQL 1K52A 2LUMA 1JMLA 2J52A 1D4BA 2JSVX 2KACA 2ZW0A 4OZBA 4IOIE 1MHHE 1PGAA 3MP9A 1UWXA 4KGRA 4KGTA 4IKGA 1XCTL 1HZ5A 2ONQA 4KGSA 3FILA 2JXTA 5HG2A 2GI9A 2KN4A 1IGDA 1ZXHA 2PW9A 1FD6A 1HZ6A 2PLPA 1FCCC 2K0PA 2GB1A 4HJGE 1F2RI 2LHDA 2IGHA 1EM7A 4GLSC 2N9LA 1XF5L 1K53A 2ZW1A 3FILB 2QMTA 2JU6X 2N7JA 1FCLA 2J53A 2IGGA 2I2YA 1IBXA 1MHXA 2LHEA 1MVKA 2LGIA 1P7FA 3UI3A 2OEDA 1Q10A 2KDMA 3V3XA 1MI0A 1YMHE 2IGDA 1GB4A 2KWDA
chains in the Genus database with same CATH superfamily
2MW5A 3N3KB 1IBXB 1UH6A 3RMKC 3L10B 4HJKA 3DWMA 1SGHA 2JQRB 1JROA 3DCGA 3VTWA 1NYQA 3ZKJC 3HVDA 2W82A 3GB1A 1YD8U 3ZYYX 3B1LX 3HM6X 1CQVA 1EWYC 4W9DA 1YX6B 2WU2B 2IBIB 2LGYA 4OZAA 5LXHA 3BZDB 1LGRA 1E8YA 2GMIC 2PJHA 3NZ3A 1WGDA 1E7VA 1QF6A 4K7SA 2WXHA 1F2RC 4XYCA 1SBBB 3SHQA 2FIFA 3PT2B 3R7QA 4TKNA 1EU3A 1KLUD 2MLBA 4W9FA 2K5PA 4HEA1 1FMAD 2LMCA 5G2NA 2BYTA 2KACA 1WE7A 4ZRPA 2G45B 2ZW0A 2BVCA 2YEPB 1YQ3B 2R2OA 3IAM1 3LDZE 5AZHA 1ZW7A 4LJPB 4ZHOA 3BYYB 3CMMB 1YX5B 2VZKD 1HZ5A 2ONQA 2Z0DB 2L3ZA 3HHMA 5E6PA 1TKGA 2LRWA 4K3CA 2AEHA 4IDIA 1WZ0A 2LHDA 1EM7A 3V60A 3EHVA 1L0YB 2J0MA 1V1PB 5I4DA 5J2RA 1FCLA 1EF5A 1UUPA 4B95A 4X57B 2J0KA 4BBNC 4HROA 2TSSA 2LVPA 1TKYA 3H7PB 2INCC 4MSQB 2R2QA 2V4IB 3GP7A 2GBJA 4ZOHC 2KDMA 3X23A 4DHZB 1VRAB 3W2DA 3DBHI 2BYVE 2RR9A 3QAQA 3PHWB 4FHJA 2LJ5A 2DX5B 2HJ8A 3A9KB 4C00A 4ANWA 3AEEB 1E0ZA 3IHPC 4HDQA 1A5RA 3DBHB 2KQ4X 1HE8A 3VFKA 3I5JC 3RNEC 1FNVA 1QT9A 4HXDA 2O6VA 1FM0D 2RDGA 2XK5B 1UNSA 4NJ7A 3CSTA 4A6QA 3A9JB 1QKZA 4R3DA 4NZLB 2QCZA 4N9F4 4AOFA 3URYA 1XLNA 3UIPB 3WAMA 1WX9A 2I1JA 2N9EB 3NJTA 1E7UA 2V4LA 4TQ1A 5D94A 3A4RA 3CF6E 4JL9A 4EKUA 2AQ3B 5BYRA 5D3IB 5E6JA 1E6EB 3EC8A 5IKCM 2INPE 3DPDA 3ZDMC 4TMAB 4RF0A 1PDXA 3WIMA 4XE0A 3R2TA 2KN4A 3ZTDA 4A55A 2BQQA 2K0PA 2MBQA 5IOIA 3BINA 4IWQA 1TS5A 2KFKA 4DBGA 4OW0A 2M56B 3KVFB 2J4XA 4KX6B 1LM8B 2V3NA 1I4XA 2JZ3B 4IW0A 3EFUA 2WGSA 4PS7A 1T3QA 4A8XC 3Q8CA 3RYTA 2DBYA 2H89B 4ZHPA 4GXBA 1C77A 2IO3B 4XX5A 3OG5A 3M3JA 3KUCB 4LDTD 1YMHE 2ZPNA 4Q2JA 3TBLD 4GSWA 2DYOA 3SDLC 2WX0A 4G0NB 3PLUA 4MGKE 1WXVA 4J6IA 3N32A 3H1UA 3H7PA 2LASA 4W9JA 4ARCA 4NJCA 3GE3C 3DHHC 2FUG1 1GJZA 2KQSA 3S2AA 2MSED 2AYOB 3PHXB 3R66C 1CMXB 5FR6A 3ZW3A 4BKSD 1YOVB 1YQBA 4TQ0A 4WH4A 3WA0A 4G50A 2KKCA 4DDGD 1VLBA 1XCQL 2L7RA 4IC7B 4EOYA 1E10A 1TY2A 4HCNB 5FR3A 1B9RA 2BTEA 4HPMB 2ZCCA 3PZ7A 3PZ8A 3L13A 4XDDA 1XXGA 2CR5A 2KTFA 4P1CC 1K8RB 1ISNA 3AXCA 1H4RA 1UBIA 1ZXHA 2LRUA 5FK9C 1SIJA 2JWZA 2V9HA 4PT5A 2JT4B 5CTRC 4IUMB 1F0ZA 3PVLA 1ZDXA 1WJNA 1OQYA 2QEJC 5JHBA 4YWGG 2DZIA 3W5VB 3NVYA 4KIKA 4A9AA 1FNWA 4W9HA 2LGIA 2LUEA 1WX7A 1GC7A 4BZAA 2MRPA 2INNE 1WH3A 4F1SA 5DPRA 2KX3A 1D5XC 2HJ1A 4W9KA 2IGDA 1BT0A 4ZRKA 1WE6A 1PQSA 4LNNA 3NS8A 4FN2A 2JXXA 3AEDB 2WXRA 2R61A 2RPVA 1C4AA 1L4DB 1NEKB 4KZCA 2V0GA 2Y5BB 1V5OA 1ET9A 3RZFA 1FO4A 1KH0A 3NRZA 2XNAC 5G5HA 1C9FA 1TGZB 1L7YA 4DDID 1KRHA 2B3AA 4LNOA 2NCNA 3PO0A 2FCSA 4WQOB 2N7DA 1FIQA 3A33B 1NENB 3H7SA 3VR9B 4IOIE 1YN4A 1XT9B 3PPAA 4RMAA 2Z59B 3X0WA 3QWZB 2L52A 4NAWB 4A20A 2JRHA 2RPQA 3J9CA 3V6CB 2IO0B 2BYEA 1XD3B 2K22A 4F7ZA 3ZXVA 3SEBA 2ZJDA 1WY8A 2ZZPB 1ESFA 1WXSA 2N4FA 2EMTA 2KDIA 1YIWA 2O2VB 2VH2A 4II2B 4OVUA 1XF5L 2D3BA 4MH0E 1TJEA 4WWMA 2KWVB 4WWPA 3ZJUA 1UGJA 4HVBA 4ACFA 2MX2A 3AE5B 4WWOA 2PE6B 3ZQ4A 4RGNA 3A9KA 3WALA 3VHTC 1MVKA 2KHWB 3ZNHB 2IDYA 1QOBA 4RNAA 4K7UA 1SE3A 3VQIA 1F9JA 4LTUA 4MELA 3AEGB 2C7NB 2E6XA 4RGTA 1JWMD 1WWTA 4CO7A 3NY5A 1NVID 4N6EB 4K3BA 2IY1B 4HPPA 2WXOA 1C1YB 2HE7A 2AL3A 4B6WA 2NMQA 2FCQA 4GU2A 3UGBB 4RM9A 1GOZA 2VH1A 3ZLZA 2MWSB 4AWJA 2WP9B 2EKEC 3PRPB 1RFKA 3Q3JA 3RPFC 1IPGA 3HUIA 2AL6A 1UZXB 2FCNA 2INDC 2Y3AA 4P1BC 4EEWA 2ZNVB 2PIAA 4BAXA 3A1QA 5BO4B 2JYTA 5T8IA 2MCNB 4GDKA 3BK2A 2JZZA 2RD0A 3I57A 1D3ZA 1NDDA 1N62A 2UYZB 4M00A 1T6BX 3RNAC 4CQNA 1RLFA 1B1ZA 3DVGX 1SF0A 2K6DB 1ET6A 4KGRA 2WXIA 3WCQA 3VUWA 4KGTA 2SAKA 4WJQA 3K9PB 3ZVVA 2K39A 4L23A 4AP4C 1JWSD 4USAA 4US8A 4WAFA 5AZFA 3AE7B 3DBSA 3A1QB 1JALA 4HWIB 4NAWA 4XGAB 3ABVB 2WWZA 1V80A 3IVFA 3TEZA 1WM2A 3W9CB 3PREA 3ML9A 5IA7A 1ZKHA 2DZMA 3LXFA 1EF1A 2NR2A 1ZPSA 3OWEB 4KDIC 1H8CA 1WF9A 2ZVNA 2BS4B 2MBBB 2Y5PA 2JWUA 1RWSA 3IAS1 1IGCA 5E6OA 1WMHA 3B9JA 5HHDG 2CU3A 4JIOU 2BYFA 3Q3FA 2JF5A 2PE9A 3ML8A 4FHKA 2M8SA 2O6VD 4ZRJA 4AJWA 3IT4B 2FIDA 3HVZA 1FRDA 2D10A 5DPWA 2MBOA 1I4GA 3M63B 2C9WB 2JUOA 3W1YA 3ZXRA 3EGRA 1E7PB 1WGHA 2L0FA 3CSFA 3MJ5A 2LZ6A 3RI7C 5AUIA 3NVVA 5EDSA 3JVZX 5MPOA 1MHHE 3QX1A 1FRRA 2DWQA 3ZIMA 2BWFA 1Z5SB 5CHFA 4RM8A 1QOFA 1TIFA 2JXTA 3VDZA 3TEYA 4FADA 2LGSA 4TV3A 1L5PA 2CU1A 2LGDA 2KT7A 4DHJB 1R4NI 3IXSA 3AULA 1E8XA 1WGRA 1DGJA 2FBWB 1OQRA 4KV2A 3FILB 3UINB 2PPHA 3IFWB 1N5XA 3KWVA 2QHOA 1EWCA 1DOXA 2J53A 1FNUA 1GC6A 1IBXA 1JQ4A 4YSZB 5DCNA 4FJZA 2V3SA 3MHZA 2KYWA 3Q3NC 3R2IA 2LXCA 1M94A 2W3SA 1YJJA 5HI1A 4DK5A 2KWCA 3E56A 3RULA 1PGXA 1YNTE 1SE4A 4KSLC 2J42A 3DVGY 2LGXA 1F77A 4BKSA 3TEWA 3BYTB 2FAZA 1UF0A 4FXCA 3AMZA 1E8ZA 4AQ7A 2JZPA 1V5TA 3KUZA 1K50A 2IJ0A 2KK8A 1MPEA 4A3PA 4I6PA 2IO1B 1ENFA 2J52A 1JRUA 1S3SG 3HIZA 5C1ZA 4HLEA 1HTQA 1E8WA 1TS3A 1STEA 4WJPA 1CJEA 4PS3A 3L16A 4KIKB 4C80A 4GB9A 3MC8A 3TEXA 2ZNVC 2KJ6A 4BOZB 5J17A 1HTOA 2BKFA 5KHQA 2KDEB 3P4QB 2PLPA 5DPSA 4LNIA 1YN3A 5IO9A 4ZYSA 5BYSA 1F2RI 4KZ0A 3KW5B 4BOSC 3L4PA 2WDVB 3ECIA 2N7JA 3ZNID 4J3OD 4YTMB 1WZ3A 3UIOB 1RRBA 2PEAA 3DWGC 3DOWA 1VZ6A 3QJZA 5E6NA 4LLGM 2G1EA 2B76B 4DWFA 3UQBA 5LLIA 3V61A 2RMMA 2NTTA 2L76A 3RFZB 4HDOA 2EELA 2HTHA 4LCDE 1KM7A 1VCBA 2V3PA 3KH0A 1I4HA 3T3OA 2KAJA 3SFEB 2HDEA 1D5ZC 3AH7A 3E9SA 2DAFA 2CHWA 1L4ZB 4GMVA 4EZLA 5AEKB 1FXTB 2PKOA 2DHZA 4GGQA 4UDUC 1WXQA 1E5WA 4JX1C 1VD2A 1FFVA 1VJKA 5L95C 4NY0A 4DQOC 1T0YA 2HD5B 1BMLC 2N1WA 3ZUNA 1C78A 1ZOYB 1WR6E 3N1YC 4C4VA 5EE9A 1FPYA 2H88B 3NOBA 3V62A 2N0SB 5GXGB 3V05A 1YN5A 1MG8A 2XBBC 4JGHB 3FILA 3H8HA 2REXA 1FEHA 1ZGUB 3AECB 1JW9D 1TYGB 2BS2B 2WXPA 1RM6C 1TBEA 2LFIA 1T0QC 3H6NA 3W1SC 4HPLB 3AI5A 4JWUC 2KQ7A 5HKHA 1WR1A 2KJRA 3B08A 1E90A 4GDLA 2MQJA 3PRZA 2K1FA 2OEDA 4P16A 3P4SB 3SU8X 1WYGA 4OZCA 2M4NA 2GRIA 3BK1A 1Q5WB 1WFYA 2DNFA 3KQ4A 3ZRCA 1WRIA 2WYQA 2GLSA 1GAQB 3U52E 4G11A 1PUTA 1V81A 2D3AA 4KSKC 3GE8C 4BBNF 4NJ6A 5CHWA 4MH8A 3Q3OC 2UWQA 1T0RC 1FXIA 1LFDA 4I6LB 4M0WA 4MGZE 5BMHA 3ZRFA 3TJPA 2J7QB 1DOYA 2WXMA 4W9CA 3AE8B 4P6VF 2I1KA 5C23A 2D3CA 3RUIB 3JW0X 2FCMA 2KJHB 4P7IA 3DBRB 2JYEA 1GB1A 2RSUA 3EECA 3VH4B 2MP2B 4W9LA 3VVWB 4M02A 1RYJA 4MM3B 1UGMA 4W9EA 3A9JA 2KXJA 1P0RA 2NBWB 2KFKB 1HQRD 2RGFA 4FBJB 4JE3B 2W3RA 2KDFB 4G3XB 2GBMA 2JVCA 2J0JA 5AZGA 2KANA 3AV8A 2GBNA 1FD6A 1TTNA 4LNKA 1FCCC 2K8CA 2EMSA 1TKEA 2KOXA 4WAAA 4GLSC 4LNFA 3ZJVA 3DVNU 1IUEA 3ZGZA 1Y56A 3AEBB 3TIXA 1TS2A 1SXTA 1UBQA 4DXAB 2L32A 3OJ4B 1WJ4A 2MBEA 1I4QA 1MI0A 3OLMD 1KLGD 1V2YA 4JQWC 5BMIA 4HKZE 3QA8A 4NQLB 2OJWA 1Y8RC 3N20C 5LXIB 4JLCA 1WMHB 4PYUA 3KUDB 2LD9A 2PTLA 4MGYE 1C4PA 4YTPB 4DXFA 3CWIA 3T8MA 2QSDA 4KVGB 3BY4B 1YJ1A 2ON8A 4IM0A 4JWSC 2LVOA 1J7CA 1MFWA 3FC4A 3N30A 3WAOA 2GBRA 1L6UA 2YVCA 1VR9A 3SD5A 4NAMA 1C3TA 4M0WB 2QIEB 3DHGC 2MJEA 2QILA 2WXFA 2Z8LA 2JSVX 2KD0A 4LK0M 2NPTB 5JH5C 2BB6A 3NZUA 2BKRB 2YLMA 4O1NA 3PZDA 1TY0A 2JY6A 1TS4A 1P9DU 3JSVB 2K25A 3QCAA 4RGOS 2WXJA 3AB5A 3C8YA 4JPSA 4YTNB 2WXKA 1GUAB 1SEBD 3KLSX 4LDTB 1SB3C 3P4PB 1RAXA 1XLOA 4TUUA 4FLHA 1SE2A 4BFRA 2KVRA 2M0XA 1NI3A 5IN7A 3AE6B 3GOEA 4AJYB 3UF8A 3TSSA 4KDLB 3APDA 5D2MB 3R3MA 1N61A 1JWBD 3AE3B 1NYRA 3ZTCA 3AE1B 3LB8C 3PSEB 3MC9A 4C56C 2IGGA 1KFYB 2I2YA 2M17A 1M4VA 2L1AA 3ZNZB 1ZXIA 4E71A 1YJIA 1GB4A 2GBKA 2WNMA 2GOWA 2M1MA 3QARA 4WJOA 1I7HA 1GNUA 1UD7A 1SIFA 1EO6A 3GZNB 3Q3MC 4BKGA 3MC0B 4F8CB 5H8YE 1S1QB 2O6VB 3VTUA 1C79A 2FNJB 4TSSA 2QJLA 4MDKE 2JRIB 3R8BA 1L0VB 1V9JA 1WXAA 2I38A 2KC2A 2XN9C 2MJDA 3U7ZA 2LJIA 2XK5A 2PVGC 2D3GA 4WIPA 3ONSA 1TZ1A 5JXVA 3RD2A 3V6EB 3BIID 3VH3B 2L00B 1K52A 1X1MA 3A4SC 3TUOA 2BGFA 2K9XA 3LYYA 2KDBA 4MSMB 3QQ8B 3AEAB 3RCZA 3QIJA 1UWXA 3Q14C 2C7MB 1KLVA 1JWAD 2K6QA 3GZNI 1ZDVA 4KGSA 4YSYB 3PLVA 4XWTA 3I3TB 3NVZA 4ICUA 1J19A 2L83A 2LWPA 1MG4A 5G55A 3EUB2 3GS2A 1N6ZA 4ITKA 3PS6A 3QHTA 2DZKA 2BWES 3DHIC 2OJRA 3FKYA 4URKA 2ZW1A 4EZKA 3DBLI 4PS8A 5C3JB 2WXNA 3NHEB 1D6EC 3ENEA 4M8NA 2V1YA 2WLBA 2WX1A 2BB5A 2LHEA 1P7FA 3O65B 3AE4B 3UI3A 1C76A 4K1RB 4DXGA 3BVGA 4KKJA 2LI5A 2MP2A 1K51A 2VRRB 3L0WB 4L2YA 3RNFC 3DBLB 3AM9A 4EE2A 4K81A 4XZ4A 4MJSB 2D2QA 2Y5CA 1QLBB 4GIVA 1V1OA 4GN1A 1IP9A 2DZJA 1ZE3D 4W9GA 1WGYA 3L08A 1CK1A 2OOBB 3PRMB 4AUQC 5EE3A 1JCKB 1OEYJ 1QILA 2WDTB 2G3QB 3NVWA 2LUMA 4FULA 3ZDTA 2N1VA 3KYCD 2X38A 2ZEQA 4GDKB 3DQVA 1U4AA 4CYEA 1F52A 4MT5A 3B0AA 1PGAA 4OHJA 3QC8B 3MP9A 4M8MA 5IAAC 3MTNB 1G6JA 4IKGA 4C4VB 4ZDVA 2AWTA 1WRDB 2N7EA 1NI2A 5DPTA 3ZJTA 2D11A 3U8ZA 3ALBA 2GI9A 1IGDA 3VUYA 2PW9A 5TSSA 2KLCA 2YEPF 4HJGE 3RZWC 3APFA 2ICIA 4C7ZA 4C7YA 5C2TB 4E3CA 4WWNA 4IG7B 3K9OB 2AQ2B 4MJSA 3VTVA 3BWUD 3HK0A 3UQAA 2WHIA 1MHXA 2KVZA 1ACCA 1P3QU 5JZEB 5LNK1 3P42A 3Q8EA 5JHAA 2KMCA 2NPTA 2M19A 2KWDA 2DENB 2Z0EB 2NTSA 3M62B 4DHZE 2PVOD 3P2BA 2L0TA 1V8CA 4PYZA 3AE2B 4HKQA 1D5MC 1F1HA 3EA6A 3PGEA 2CHZA 5HFYA 2KTRB 2W54A 5CHVC 3FAHA 2ASQA 2KZRA 2NBUA 1V49A 4B0MA 3D32A 1L6VA 3RN9C 3TCAA 4IM2A 4D2KA 3PTFC 4MACA 4ASWC 1VZ8A 1CZPA 1HEZE 3T3NA 3DBRI 3HM3A 3BVMA 3VRAB 1FXAA 1AN8A 1P7EA 2C60A 2G4DB 3VUXA 4BVUC 1JMLA 2BF8B 1AARA 2WXGA 2WXLA 4RF1A 3VR8B 1P1AA 3N1XC 1FFUA 3M95A 4N59A 1I35A 2DYBA 1SSNA 2A5UA 2SEBD 1WJ6A 2O2VA 4E74A 1EUVB 2RDHA 1R4MI 3RNBC 1GG3A 2CS4A 1QOAA 4OVVA 3ETRA 2ZCBA 2WU5B 3VAWA 4ZRQA 2MBHA 5EE0A 1MJDA 2KTRA 3NG0A 1P98A 1UELA 1WYWB 1OFFA 3AN1A 5D6JB 4KKIA 3VXWA 1ZP0B 2QDFA 1Q1OA 2MEKA 1Q10A 3V3XA 4YXDB 3RNGC 2PMVA 2LEKA 1GPXA 1OEYA 4WQMA 3I9V1 1LQBA 2NBVB 3NZSA 4HCPB 4L1BA 3RNCC 2KLGA 4FJYA 3C19A 2FUHB 1N63A 4B0EA 2DYMA 2JX5A 3KYDD 2BW2A 2IY0B 4YL8A 1KJTA 1J0GA 2DAJA 3APCA 2IYDB 2WDRB 2HTME 4HK2A 5CX3A 3IG3A 1PFDA 4LJOB 1WXMA 1N5WA 5D7GA 4DHJD 1D4BA 3KWLA 2IO2B 4II3B 2AX5A 4OVZA 1ROEA 3Q69A 4PK1A 2OHFA 2UU7A 4RGMA 2A4ZA 5EE1A 3W5UB 3VRBB 3AE9B 3L17A 2BT6A 2KFJA 4XDCA 2VZKB 2XEWA 3CIRB 4BKTA 2EKIA 1HZ6A 2L05A 1WGGA 4MM3A 4NPNA 4HRSA 4YT0B 5TR5A 2N9LA 1VZ7A 5G5GA 1LO5D 2C5LC 1WJUA 1WGKA 1TZOA 3N9YC 1IYFA 2RDBC 4S0RA 3AU5A 3SR6A 1BUIC 1JWUD 4ARIA 2K8HA 2JPHA 3DVNV 3JSVA 2X8XX 3IT6B 1DOIA 2WS3B 1YQ4B 2W55A 3R7RA 1DYQA 3ZO5B 3BVZA 2BS3B 1I4PA 2BPSA 2KMAA 2CJOA 3MHSD 2ZPYA 5BMGA 1XLQA 1A70A 3Q8BA 4MGIE 5IP4D 2G4SA 3OJ3A 4RCOA 2FE8A 3RT3B 4ANVA 2D07B 4B9KA 3TMPB 1E9MA 3MFGA 2DLBA 4NQKE 3QK0A 1T0SC 2CJNA 2D5GA 1V86A 4S17A 1WI0A 3HRDD 3ZNGC 1OQQA 2K3UA 3LJ3A 3P4RB 1XO3A 1PGBA 4AS1A 1I42A 3U2SC 4YSXB 1PYWD 4A90A 2ACZB 3O13A 3DDCB 3IBEA 1SJHD 3B2GA 3W1SA 4I6NB 4EFOA 5BYQA 3I63C 5L83A 2N9XA 5H92C 3U7DA 4RH6A 4FJVB 1SE9A 3AEFB 3Q8AA 3TL5A 4US9A 3JYUA 2KNBA 4ANXA 4ICVA 1UWMA 4ANUA 2M0AA 1WX8A 1N60A 1V97A 3NS1A 4REZA 5HG2A 4EZJA 4W9IA 1WIAA 1SJED 2IZVB 3P63A 1AWDA 2GB1A 4H2AA 5GMVA 4M01A 2IGHA 2KWUB 2KC1A 1K53A 4GOCA 2NS5A 2E3TA 4N58A 2CHXA 4WJNA 4NNJB 4IWPA 1AW7A 1ZUD2 3Q2AC 1T5XD 5D3DA 1R4NB 1VDVA 2MA9B 4MEMA 1EU4A 1JRPA 1J7BA 1Z2MA 3WAPA 1L0XB 3Q8FA 2KN5A 2AQ1B 4ZYNA 3B2FA 3OAWA 3Q6BA 4K7WA 1WSPA 3U30A 2WQYB 4CHKA 1QOGA 3U4EG 2WDQB 2L8JA 3WANA 1Q0WB 1LXDA 1KTKA 2KMMA 4WURA 1XEEA 2MH7A 5J18A 1R4MB 2N9KA 1QZEA 1QQRA 4RFBA 3EFCA 3H9DA 4EUTA 1V6EA 2LXAA 2C7HA 1WM3A 1HA5A 1R7SA 4ZRIA 1TT5B 4XWWA 2LVQA 3AU4A 1KOTA 4OZBA 3N1ZC 3NUHB 3C0RB 2CKHB 4QAYA 1XLPA 4GDLB 2G9HD 3MJWA 1XCTL 3T9LA 4XC2A 4A3OA 2IPKD 1J8CA 2KO3A 3P1MA 2KX0A 1BXTA 1OGWA 2WXQA 1L2NA 2NVUI 5AUKA 4FA6A 1RFAA 2W9NA 2BBCA 2QC8A 5FKAC 4IM3A 2K8BA 1I4RA 2QMTA 2JU6X 3PV1A 1NBFC 1KF6B 1OTRB 1V1PA 3L54A 1C4CA 2ZVOA 1J7AA 3SFDB 1XQQA 1HXYD 2MJ3A 2MHJA 2N9PC 4IWOA 5KHOA 1AYFA 2Q5WD
chains in the Genus database with same CATH topology
4LTUA 1WYGA 3AEGB 4OZCA 2GRIA 3BK1A 2NTSA 1IBXB 2PVOD 2E6XA 4RGTA 3KQ4A 1JWMD 1WWTA 1V8CA 3AE2B 1WRIA 3DWMA 1NVID 2JQRB 1JROA 4N6EB 4HKQA 1NYQA 1GAQB 3U52E 1D5MC 2WXOA 3EA6A 3HVDA 1PUTA 5HFYA 2W82A 2W54A 3GB1A 3ZYYX 3FAHA 2NMQA 1CQVA 1GOZA 1EWYC 4B0MA 2WU2B 4MH8A 4OZAA 3BZDB 1FXIA 1L6VA 5BMHA 4M0WA 3NZ3A 2WP9B 4D2KA 1DOYA 1RFKA 3RPFC 2WXMA 4MACA 1VZ8A 3AE8B 1QF6A 4P6VF 2WXHA 1CZPA 1F2RC 1HEZE 3HUIA 1SBBB 3T3NA 3BVMA 3VRAB 1EU3A 1KLUD 2Y3AA 2JYEA 1GB1A 1FXAA 2PIAA 1AN8A 1P7EA 2K5PA 2JYTA 4HEA1 5T8IA 1FMAD 1JMLA 2LMCA 2BYTA 2KACA 3BK2A 3I57A 4ZRPA 2WXGA 3VR8B 2WXLA 4RF1A 1N62A 2ZW0A 1RYJA 2YEPB 4MM3B 1FFUA 1T6BX 4N59A 1YQ3B 4CQNA 3IAM1 1B1ZA 1SF0A 1SSNA 1ET6A 4KGRA 2WXIA 3WCQA 4ZHOA 2SEBD 4KGTA 2SAKA 3BYYB 1HQRD 2VZKD 1HZ5A 2ONQA 2W3RA 4JE3B 4L23A 1JWSD 4USAA 4US8A 4WAFA 2RDHA 3AV8A 1FD6A 1TKGA 3AE7B 1FCCC 4IDIA 1TKEA 1QOAA 1JALA 2LHDA 1EM7A 4GLSC 3ETRA 2WU5B 3ZJVA 3ABVB 4ZRQA 1IUEA 3ZGZA 1L0YB 1Y56A 1V1PB 3AEBB 5I4DA 3TEZA 1FCLA 1TS2A 3W9CB 1UUPA 5EE0A 4HROA 2TSSA 1SXTA 1TKYA 2L32A 3LXFA 1OFFA 3AN1A 4KKIA 1ZP0B 1I4QA 2V4IB 3GP7A 4ZOHC 2MEKA 1Q10A 2KDMA 1ZPSA 3V3XA 1MI0A 3OWEB 1VRAB 2PMVA 4YXDB 1KLGD 2LEKA 1GPXA 3W2DA 2BS4B 4WQMA 3I9V1 5BMIA 2Y5PA 2JWUA 1RWSA 4HKZE 3IAS1 1IGCA 3B9JA 5HHDG 4L1BA 3AEEB 1E0ZA 2CU3A 2PTLA 1C4PA 4YTPB 1N63A 4DXFA 4B0EA 3CWIA 2DYMA 2JX5A 2QSDA 2KQ4X 2BW2A 3IT4B 2ON8A 4JWSC 3HVZA 1FNVA 1J7CA 1QT9A 1FRDA 2WDRB 3FC4A 1FM0D 2HTME 2RDGA 1UNSA 1L6UA 1VR9A 4NAMA 1I4GA 1PFDA 4A6QA 1QKZA 3EGRA 4R3DA 2QIEB 1E7PB 2MJEA 4NZLB 1N5WA 2QILA 2WXFA 3MJ5A 2Z8LA 5D7GA 3URYA 2JSVX 1D4BA 1XLNA 3KWLA 4LK0M 5AUIA 2AX5A 2BB6A 3NVVA 4OVZA 1ROEA 3Q69A 4O1NA 4TQ1A 1TY0A 2OHFA 5MPOA 1MHHE 1TS4A 4RGMA 2AQ3B 5BYRA 1FRRA 2DWQA 5D3IB 5E6JA 1E6EB 4RGOS 5EE1A 3W5UB 3VRBB 3AE9B 2WXJA 3AB5A 3C8YA 4JPSA 2INPE 2BT6A 4TMAB 4RF0A 4YTNB 2WXKA 1SEBD 4XDCA 3KLSX 1QOFA 2VZKB 1PDXA 1SB3C 3P4PB 4XE0A 2JXTA 3R2TA 1XLOA 2KN4A 3CIRB 2EKIA 4A55A 1HZ6A 3TEYA 2K0PA 1SE2A 1L5PA 1NI3A 3AE6B 3IXSA 1TS5A 4HRSA 4YT0B 2N9LA 4OW0A 3TSSA 1VZ7A 2M56B 5G5GA 1DGJA 2FBWB 2J4XA 1LO5D 4KX6B 1OQRA 3FILB 1WGKA 1N61A 1TZOA 1JWBD 2V3NA 1I4XA 3N9YC 1N5XA 3AE3B 1NYRA 3AE1B 3KWVA 3LB8C 3SR6A 1DOXA 1EWCA 1BUIC 1JWUD 1T3QA 2IGGA 1FNUA 1KFYB 2J53A 3Q8CA 4A8XC 4C56C 2DBYA 2H89B 2I2YA 4ARIA 1M4VA 2L1AA 4ZHPA 1JQ4A 3IT6B 1DOIA 2WS3B 1C77A 4YSZB 1YQ4B 2W55A 3MHZA 1DYQA 1ZXIA 3BVZA 2BS3B 1YJIA 1YMHE 1I4PA 2CJOA 4Q2JA 1GB4A 3R2IA 2WNMA 2DYOA 2W3SA 1YJJA 5HI1A 5BMGA 1I7HA 1XLQA 1A70A 3Q8BA 3MC0B 2FE8A 4RCOA 4ARCA 4NJCA 1E9MA 3E56A 5H8YE 1PGXA 1YNTE 3MFGA 1SE4A 2DLBA 1C79A 4TSSA 2FUG1 2QJLA 2J42A 2CJNA 2D5GA 1F77A 3R8BA 1L0VB 3TEWA 3BYTB 2I38A 3HRDD 2XN9C 2MJDA 1OQQA 2K3UA 3AMZA 4FXCA 2LJIA 3U7ZA 3P4RB 1XO3A 1PGBA 4AS1A 2PVGC 4WIPA 3U2SC 4AQ7A 4YSXB 2JZPA 1PYWD 4A90A 4TQ0A 4WH4A 1K50A 2ACZB 5JXVA 2IJ0A 3O13A 1MPEA 3BIID 1VLBA 1SJHD 3B2GA 1ENFA 3W1SA 1XCQL 1K52A 2J52A 5BYQA 5H92C 3TUOA 1E10A 2K9XA 1TY2A 3LYYA 5FR3A 1B9RA 4RH6A 1TS3A 1STEA 2BTEA 3AEFB 3Q8AA 1CJEA 3AEAB 3PZ7A 3PZ8A 4US9A 1UWXA 4XDDA 4C80A 1XXGA 1UWMA 1JWAD 3TEXA 1ZDVA 4KGSA 4YSYB 2M0AA 4XWTA 3NVZA 1N60A 1V97A 3NS1A 2L83A 4REZA 5HG2A 1ZXHA 3P4QB 2PLPA 3EUB2 3GS2A 1SJED 4ITKA 5FK9C 3P63A 1YN3A 1AWDA 1SIJA 2GB1A 4H2AA 4ZYSA 5BYSA 1F2RI 2IGHA 4PT5A 1F0ZA 1K53A 2ZW1A 3L4PA 2E3TA 2WDVB 1ZDXA 4N58A 2N7JA 5C3JB 2WXNA 1D6EC 4J3OD 4YTMB 2QEJC 4YWGG 3W5VB 3NVYA 1AW7A 1ZUD2 2WLBA 1T5XD 4A9AA 1FNWA 2BB5A 2LHEA 5D3DA 2LGIA 3DWGC 1P7FA 2INNE 3AE4B 1VDVA 3UI3A 1C76A 1VZ6A 1D5XC 4DXGA 3BVGA 2IGDA 4KKJA 4LLGM 2G1EA 2B76B 1EU4A 1K51A 1JRPA 4L2YA 1J7BA 3AM9A 3AEDB 2WXRA 2RMMA 1L0XB 2NTTA 4EE2A 2R61A 3Q8FA 2RPVA 1C4AA 3RFZB 1L4DB 2AQ1B 2EELA 3B2FA 2Y5CA 1QLBB 1NEKB 2V3PA 1V1OA 3T3OA 1I4HA 1WSPA 2V0GA 2WQYB 1ZE3D 1QOGA 1ET9A 2KAJA 3SFEB 1FO4A 2HDEA 1D5ZC 1KH0A 3NRZA 1CK1A 2XNAC 2WDQB 3AH7A 5G5HA 3U4EG 3E9SA 1KTKA 1L4ZB 5EE3A 1C9FA 2KMMA 4WURA 2PKOA 1XEEA 4UDUC 1JCKB 1QILA 1WXQA 2MH7A 4JX1C 1KRHA 1FFVA 1VJKA 2N9KA 1QQRA 4DQOC 4RFBA 3NVWA 2LUMA 3PO0A 1FIQA 2X38A 1HA5A 1R7SA 4GDKB 1BMLC 1NENB 4XWWA 4OZBA 4MT5A 3VR9B 3NUHB 1C78A 1ZOYB 4IOIE 1YN4A 1PGAA 4OHJA 1XLPA 3MP9A 4GDLB 2G9HD 5EE9A 2H88B 4IKGA 2L52A 1IBXA 1XCTL 2N0SB 4NAWB 5GXGB 3V05A 1YN5A 2IPKD 3J9CA 3FILA 3H8HA 1FEHA 2K22A 3AECB 3ZJTA 1JW9D 1TYGB 3SEBA 2BS2B 2GI9A 1IGDA 3P1MA 2PW9A 5TSSA 2WXPA 1BXTA 1ESFA 2WXQA 2YEPF 1RM6C 5AUKA 4HJGE 1XF5L 2LFIA 2ICIA 4C7ZA 2BBCA 5C2TB 4C7YA 1TJEA 5FKAC 4WWMA 2QMTA 1I4RA 3ZJUA 1UGJA 2JU6X 2AQ2B 4JWUC 1KF6B 1V1PA 3AE5B 3BWUD 1C4CA 3ZQ4A 1J7AA 1MHXA 4RGNA 3SFDB 1ACCA 1MVKA 1HXYD 5LNK1 2IDYA 2MJ3A 2OEDA 3P42A 3Q8EA 1QOBA 4RNAA 1SE3A 4P16A 1AYFA 3VQIA 2Q5WD 3P4SB 2M19A 2KWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OZC A;  1K51 A;  5BMI A;  1IBX B;  5HI1 A;  2JWU A;  5BMG A;  4HKZ E;  2RMM A;  1IGC A;  5HHD G;  2RPV A;  5HFY A;  2EEL A;  1PGX A;  1YNT E;  3GB1 A;  2NMQ A;  2PTL A;  4OZA A;  2QSD A;  5BMH A;  2KQ4 X;  2ON8 A;  2I38 A;  4D2K A;  1KH0 A;  4MAC A;  1PGB A;  1C9F A;  1F2R C;  1HEZ E;  2JZP A;  4WH4 A;  1K50 A;  5JXV A;  2N9K A;  1GB1 A;  1QKZ A;  1MPE A;  1P7E A;  1XCQ L;  1K52 A;  2LUM A;  1JML A;  2J52 A;  1D4B A;  2JSV X;  2KAC A;  2ZW0 A;  4OZB A;  4IOI E;  1MHH E;  1PGA A;  3MP9 A;  1UWX A;  4KGR A;  4KGT A;  4IKG A;  1XCT L;  1HZ5 A;  2ONQ A;  4KGS A;  3FIL A;  2JXT A;  5HG2 A;  2GI9 A;  2KN4 A;  1IGD A;  1ZXH A;  2PW9 A;  1FD6 A;  1HZ6 A;  2PLP A;  1FCC C;  2K0P A;  2GB1 A;  4HJG E;  1F2R I;  2LHD A;  2IGH A;  1EM7 A;  4GLS C;  2N9L A;  1XF5 L;  1K53 A;  2ZW1 A;  3FIL B;  2QMT A;  2JU6 X;  2N7J A;  1FCL A;  2J53 A;  2IGG A;  2I2Y A;  1IBX A;  1MHX A;  2LHE A;  1MVK A;  2LGI A;  1P7F A;  3UI3 A;  2OED A;  1Q10 A;  2KDM A;  3V3X A;  1MI0 A;  1YMH E;  2IGD A;  1GB4 A;  2KWD A; 
#chains in the Genus database with same CATH topology
 2MW5 A;  3N3K B;  1IBX B;  1UH6 A;  3RMK C;  3L10 B;  4HJK A;  3DWM A;  1SGH A;  2JQR B;  1JRO A;  3DCG A;  3VTW A;  1NYQ A;  3ZKJ C;  3HVD A;  2W82 A;  3GB1 A;  1YD8 U;  3ZYY X;  3B1L X;  3HM6 X;  1CQV A;  1EWY C;  4W9D A;  1YX6 B;  2WU2 B;  2IBI B;  2LGY A;  4OZA A;  5LXH A;  3BZD B;  1LGR A;  1E8Y A;  2GMI C;  2PJH A;  3NZ3 A;  1WGD A;  1E7V A;  1QF6 A;  4K7S A;  2WXH A;  1F2R C;  4XYC A;  1SBB B;  3SHQ A;  2FIF A;  3PT2 B;  3R7Q A;  4TKN A;  1EU3 A;  1KLU D;  2MLB A;  4W9F A;  2K5P A;  4HEA 1;  1FMA D;  2LMC A;  5G2N A;  2BYT A;  2KAC A;  1WE7 A;  4ZRP A;  2G45 B;  2ZW0 A;  2BVC A;  2YEP B;  1YQ3 B;  2R2O A;  3IAM 1;  3LDZ E;  5AZH A;  1ZW7 A;  4LJP B;  4ZHO A;  3BYY B;  3CMM B;  1YX5 B;  2VZK D;  1HZ5 A;  2ONQ A;  2Z0D B;  2L3Z A;  3HHM A;  5E6P A;  1TKG A;  2LRW A;  4K3C A;  2AEH A;  4IDI A;  1WZ0 A;  2LHD A;  1EM7 A;  3V60 A;  3EHV A;  1L0Y B;  2J0M A;  1V1P B;  5I4D A;  5J2R A;  1FCL A;  1EF5 A;  1UUP A;  4B95 A;  4X57 B;  2J0K A;  4BBN C;  4HRO A;  2TSS A;  2LVP A;  1TKY A;  3H7P B;  2INC C;  4MSQ B;  2R2Q A;  2V4I B;  3GP7 A;  2GBJ A;  4ZOH C;  2KDM A;  3X23 A;  4DHZ B;  1VRA B;  3W2D A;  3DBH I;  2BYV E;  2RR9 A;  3QAQ A;  3PHW B;  4FHJ A;  2LJ5 A;  2DX5 B;  2HJ8 A;  3A9K B;  4C00 A;  4ANW A;  3AEE B;  1E0Z A;  3IHP C;  4HDQ A;  1A5R A;  3DBH B;  2KQ4 X;  1HE8 A;  3VFK A;  3I5J C;  3RNE C;  1FNV A;  1QT9 A;  4HXD A;  2O6V A;  1FM0 D;  2RDG A;  2XK5 B;  1UNS A;  4NJ7 A;  3CST A;  4A6Q A;  3A9J B;  1QKZ A;  4R3D A;  4NZL B;  2QCZ A;  4N9F 4;  4AOF A;  3URY A;  1XLN A;  3UIP B;  3WAM A;  1WX9 A;  2I1J A;  2N9E B;  3NJT A;  1E7U A;  2V4L A;  4TQ1 A;  5D94 A;  3A4R A;  3CF6 E;  4JL9 A;  4EKU A;  2AQ3 B;  5BYR A;  5D3I B;  5E6J A;  1E6E B;  3EC8 A;  5IKC M;  2INP E;  3DPD A;  3ZDM C;  4TMA B;  4RF0 A;  1PDX A;  3WIM A;  4XE0 A;  3R2T A;  2KN4 A;  3ZTD A;  4A55 A;  2BQQ A;  2K0P A;  2MBQ A;  5IOI A;  3BIN A;  4IWQ A;  1TS5 A;  2KFK A;  4DBG A;  4OW0 A;  2M56 B;  3KVF B;  2J4X A;  4KX6 B;  1LM8 B;  2V3N A;  1I4X A;  2JZ3 B;  4IW0 A;  3EFU A;  2WGS A;  4PS7 A;  1T3Q A;  4A8X C;  3Q8C A;  3RYT A;  2DBY A;  2H89 B;  4ZHP A;  4GXB A;  1C77 A;  2IO3 B;  4XX5 A;  3OG5 A;  3M3J A;  3KUC B;  4LDT D;  1YMH E;  2ZPN A;  4Q2J A;  3TBL D;  4GSW A;  2DYO A;  3SDL C;  2WX0 A;  4G0N B;  3PLU A;  4MGK E;  1WXV A;  4J6I A;  3N32 A;  3H1U A;  3H7P A;  2LAS A;  4W9J A;  4ARC A;  4NJC A;  3GE3 C;  3DHH C;  2FUG 1;  1GJZ A;  2KQS A;  3S2A A;  2MSE D;  2AYO B;  3PHX B;  3R66 C;  1CMX B;  5FR6 A;  3ZW3 A;  4BKS D;  1YOV B;  1YQB A;  4TQ0 A;  4WH4 A;  3WA0 A;  4G50 A;  2KKC A;  4DDG D;  1VLB A;  1XCQ L;  2L7R A;  4IC7 B;  4EOY A;  1E10 A;  1TY2 A;  4HCN B;  5FR3 A;  1B9R A;  2BTE A;  4HPM B;  2ZCC A;  3PZ7 A;  3PZ8 A;  3L13 A;  4XDD A;  1XXG A;  2CR5 A;  2KTF A;  4P1C C;  1K8R B;  1ISN A;  3AXC A;  1H4R A;  1UBI A;  1ZXH A;  2LRU A;  5FK9 C;  1SIJ A;  2JWZ A;  2V9H A;  4PT5 A;  2JT4 B;  5CTR C;  4IUM B;  1F0Z A;  3PVL A;  1ZDX A;  1WJN A;  1OQY A;  2QEJ C;  5JHB A;  4YWG G;  2DZI A;  3W5V B;  3NVY A;  4KIK A;  4A9A A;  1FNW A;  4W9H A;  2LGI A;  2LUE A;  1WX7 A;  1GC7 A;  4BZA A;  2MRP A;  2INN E;  1WH3 A;  4F1S A;  5DPR A;  2KX3 A;  1D5X C;  2HJ1 A;  4W9K A;  2IGD A;  1BT0 A;  4ZRK A;  1WE6 A;  1PQS A;  4LNN A;  3NS8 A;  4FN2 A;  2JXX A;  3AED B;  2WXR A;  2R61 A;  2RPV A;  1C4A A;  1L4D B;  1NEK B;  4KZC A;  2V0G A;  2Y5B B;  1V5O A;  1ET9 A;  3RZF A;  1FO4 A;  1KH0 A;  3NRZ A;  2XNA C;  5G5H A;  1C9F A;  1TGZ B;  1L7Y A;  4DDI D;  1KRH A;  2B3A A;  4LNO A;  2NCN A;  3PO0 A;  2FCS A;  4WQO B;  2N7D A;  1FIQ A;  3A33 B;  1NEN B;  3H7S A;  3VR9 B;  4IOI E;  1YN4 A;  1XT9 B;  3PPA A;  4RMA A;  2Z59 B;  3X0W A;  3QWZ B;  2L52 A;  4NAW B;  4A20 A;  2JRH A;  2RPQ A;  3J9C A;  3V6C B;  2IO0 B;  2BYE A;  1XD3 B;  2K22 A;  4F7Z A;  3ZXV A;  3SEB A;  2ZJD A;  1WY8 A;  2ZZP B;  1ESF A;  1WXS A;  2N4F A;  2EMT A;  2KDI A;  1YIW A;  2O2V B;  2VH2 A;  4II2 B;  4OVU A;  1XF5 L;  2D3B A;  4MH0 E;  1TJE A;  4WWM A;  2KWV B;  4WWP A;  3ZJU A;  1UGJ A;  4HVB A;  4ACF A;  2MX2 A;  3AE5 B;  4WWO A;  2PE6 B;  3ZQ4 A;  4RGN A;  3A9K A;  3WAL A;  3VHT C;  1MVK A;  2KHW B;  3ZNH B;  2IDY A;  1QOB A;  4RNA A;  4K7U A;  1SE3 A;  3VQI A;  1F9J A;  4LTU A;  4MEL A;  3AEG B;  2C7N B;  2E6X A;  4RGT A;  1JWM D;  1WWT A;  4CO7 A;  3NY5 A;  1NVI D;  4N6E B;  4K3B A;  2IY1 B;  4HPP A;  2WXO A;  1C1Y B;  2HE7 A;  2AL3 A;  4B6W A;  2NMQ A;  2FCQ A;  4GU2 A;  3UGB B;  4RM9 A;  1GOZ A;  2VH1 A;  3ZLZ A;  2MWS B;  4AWJ A;  2WP9 B;  2EKE C;  3PRP B;  1RFK A;  3Q3J A;  3RPF C;  1IPG A;  3HUI A;  2AL6 A;  1UZX B;  2FCN A;  2IND C;  2Y3A A;  4P1B C;  4EEW A;  2ZNV B;  2PIA A;  4BAX A;  3A1Q A;  5BO4 B;  2JYT A;  5T8I A;  2MCN B;  4GDK A;  3BK2 A;  2JZZ A;  2RD0 A;  3I57 A;  1D3Z A;  1NDD A;  1N62 A;  2UYZ B;  4M00 A;  1T6B X;  3RNA C;  4CQN A;  1RLF A;  1B1Z A;  3DVG X;  1SF0 A;  2K6D B;  1ET6 A;  4KGR A;  2WXI A;  3WCQ A;  3VUW A;  4KGT A;  2SAK A;  4WJQ A;  3K9P B;  3ZVV A;  2K39 A;  4L23 A;  4AP4 C;  1JWS D;  4USA A;  4US8 A;  4WAF A;  5AZF A;  3AE7 B;  3DBS A;  3A1Q B;  1JAL A;  4HWI B;  4NAW A;  4XGA B;  3ABV B;  2WWZ A;  1V80 A;  3IVF A;  3TEZ A;  1WM2 A;  3W9C B;  3PRE A;  3ML9 A;  5IA7 A;  1ZKH A;  2DZM A;  3LXF A;  1EF1 A;  2NR2 A;  1ZPS A;  3OWE B;  4KDI C;  1H8C A;  1WF9 A;  2ZVN A;  2BS4 B;  2MBB B;  2Y5P A;  2JWU A;  1RWS A;  3IAS 1;  1IGC A;  5E6O A;  1WMH A;  3B9J A;  5HHD G;  2CU3 A;  4JIO U;  2BYF A;  3Q3F A;  2JF5 A;  2PE9 A;  3ML8 A;  4FHK A;  2M8S A;  2O6V D;  4ZRJ A;  4AJW A;  3IT4 B;  2FID A;  3HVZ A;  1FRD A;  2D10 A;  5DPW A;  2MBO A;  1I4G A;  3M63 B;  2C9W B;  2JUO A;  3W1Y A;  3ZXR A;  3EGR A;  1E7P B;  1WGH A;  2L0F A;  3CSF A;  3MJ5 A;  2LZ6 A;  3RI7 C;  5AUI A;  3NVV A;  5EDS A;  3JVZ X;  5MPO A;  1MHH E;  3QX1 A;  1FRR A;  2DWQ A;  3ZIM A;  2BWF A;  1Z5S B;  5CHF A;  4RM8 A;  1QOF A;  1TIF A;  2JXT A;  3VDZ A;  3TEY A;  4FAD A;  2LGS A;  4TV3 A;  1L5P A;  2CU1 A;  2LGD A;  2KT7 A;  4DHJ B;  1R4N I;  3IXS A;  3AUL A;  1E8X A;  1WGR A;  1DGJ A;  2FBW B;  1OQR A;  4KV2 A;  3FIL B;  3UIN B;  2PPH A;  3IFW B;  1N5X A;  3KWV A;  2QHO A;  1EWC A;  1DOX A;  2J53 A;  1FNU A;  1GC6 A;  1IBX A;  1JQ4 A;  4YSZ B;  5DCN A;  4FJZ A;  2V3S A;  3MHZ A;  2KYW A;  3Q3N C;  3R2I A;  2LXC A;  1M94 A;  2W3S A;  1YJJ A;  5HI1 A;  4DK5 A;  2KWC A;  3E56 A;  3RUL A;  1PGX A;  1YNT E;  1SE4 A;  4KSL C;  2J42 A;  3DVG Y;  2LGX A;  1F77 A;  4BKS A;  3TEW A;  3BYT B;  2FAZ A;  1UF0 A;  4FXC A;  3AMZ A;  1E8Z A;  4AQ7 A;  2JZP A;  1V5T A;  3KUZ A;  1K50 A;  2IJ0 A;  2KK8 A;  1MPE A;  4A3P A;  4I6P A;  2IO1 B;  1ENF A;  2J52 A;  1JRU A;  1S3S G;  3HIZ A;  5C1Z A;  4HLE A;  1HTQ A;  1E8W A;  1TS3 A;  1STE A;  4WJP A;  1CJE A;  4PS3 A;  3L16 A;  4KIK B;  4C80 A;  4GB9 A;  3MC8 A;  3TEX A;  2ZNV C;  2KJ6 A;  4BOZ B;  5J17 A;  1HTO A;  2BKF A;  5KHQ A;  2KDE B;  3P4Q B;  2PLP A;  5DPS A;  4LNI A;  1YN3 A;  5IO9 A;  4ZYS A;  5BYS A;  1F2R I;  4KZ0 A;  3KW5 B;  4BOS C;  3L4P A;  2WDV B;  3ECI A;  2N7J A;  3ZNI D;  4J3O D;  4YTM B;  1WZ3 A;  3UIO B;  1RRB A;  2PEA A;  3DWG C;  3DOW A;  1VZ6 A;  3QJZ A;  5E6N A;  4LLG M;  2G1E A;  2B76 B;  4DWF A;  3UQB A;  5LLI A;  3V61 A;  2RMM A;  2NTT A;  2L76 A;  3RFZ B;  4HDO A;  2EEL A;  2HTH A;  4LCD E;  1KM7 A;  1VCB A;  2V3P A;  3KH0 A;  1I4H A;  3T3O A;  2KAJ A;  3SFE B;  2HDE A;  1D5Z C;  3AH7 A;  3E9S A;  2DAF A;  2CHW A;  1L4Z B;  4GMV A;  4EZL A;  5AEK B;  1FXT B;  2PKO A;  2DHZ A;  4GGQ A;  4UDU C;  1WXQ A;  1E5W A;  4JX1 C;  1VD2 A;  1FFV A;  1VJK A;  5L95 C;  4NY0 A;  4DQO C;  1T0Y A;  2HD5 B;  1BML C;  2N1W A;  3ZUN A;  1C78 A;  1ZOY B;  1WR6 E;  3N1Y C;  4C4V A;  5EE9 A;  1FPY A;  2H88 B;  3NOB A;  3V62 A;  2N0S B;  5GXG B;  3V05 A;  1YN5 A;  1MG8 A;  2XBB C;  4JGH B;  3FIL A;  3H8H A;  2REX A;  1FEH A;  1ZGU B;  3AEC B;  1JW9 D;  1TYG B;  2BS2 B;  2WXP A;  1RM6 C;  1TBE A;  2LFI A;  1T0Q C;  3H6N A;  3W1S C;  4HPL B;  3AI5 A;  4JWU C;  2KQ7 A;  5HKH A;  1WR1 A;  2KJR A;  3B08 A;  1E90 A;  4GDL A;  2MQJ A;  3PRZ A;  2K1F A;  2OED A;  4P16 A;  3P4S B;  3SU8 X;  1WYG A;  4OZC A;  2M4N A;  2GRI A;  3BK1 A;  1Q5W B;  1WFY A;  2DNF A;  3KQ4 A;  3ZRC A;  1WRI A;  2WYQ A;  2GLS A;  1GAQ B;  3U52 E;  4G11 A;  1PUT A;  1V81 A;  2D3A A;  4KSK C;  3GE8 C;  4BBN F;  4NJ6 A;  5CHW A;  4MH8 A;  3Q3O C;  2UWQ A;  1T0R C;  1FXI A;  1LFD A;  4I6L B;  4M0W A;  4MGZ E;  5BMH A;  3ZRF A;  3TJP A;  2J7Q B;  1DOY A;  2WXM A;  4W9C A;  3AE8 B;  4P6V F;  2I1K A;  5C23 A;  2D3C A;  3RUI B;  3JW0 X;  2FCM A;  2KJH B;  4P7I A;  3DBR B;  2JYE A;  1GB1 A;  2RSU A;  3EEC A;  3VH4 B;  2MP2 B;  4W9L A;  3VVW B;  4M02 A;  1RYJ A;  4MM3 B;  1UGM A;  4W9E A;  3A9J A;  2KXJ A;  1P0R A;  2NBW B;  2KFK B;  1HQR D;  2RGF A;  4FBJ B;  4JE3 B;  2W3R A;  2KDF B;  4G3X B;  2GBM A;  2JVC A;  2J0J A;  5AZG A;  2KAN A;  3AV8 A;  2GBN A;  1FD6 A;  1TTN A;  4LNK A;  1FCC C;  2K8C A;  2EMS A;  1TKE A;  2KOX A;  4WAA A;  4GLS C;  4LNF A;  3ZJV A;  3DVN U;  1IUE A;  3ZGZ A;  1Y56 A;  3AEB B;  3TIX A;  1TS2 A;  1SXT A;  1UBQ A;  4DXA B;  2L32 A;  3OJ4 B;  1WJ4 A;  2MBE A;  1I4Q A;  1MI0 A;  3OLM D;  1KLG D;  1V2Y A;  4JQW C;  5BMI A;  4HKZ E;  3QA8 A;  4NQL B;  2OJW A;  1Y8R C;  3N20 C;  5LXI B;  4JLC A;  1WMH B;  4PYU A;  3KUD B;  2LD9 A;  2PTL A;  4MGY E;  1C4P A;  4YTP B;  4DXF A;  3CWI A;  3T8M A;  2QSD A;  4KVG B;  3BY4 B;  1YJ1 A;  2ON8 A;  4IM0 A;  4JWS C;  2LVO A;  1J7C A;  1MFW A;  3FC4 A;  3N30 A;  3WAO A;  2GBR A;  1L6U A;  2YVC A;  1VR9 A;  3SD5 A;  4NAM A;  1C3T A;  4M0W B;  2QIE B;  3DHG C;  2MJE A;  2QIL A;  2WXF A;  2Z8L A;  2JSV X;  2KD0 A;  4LK0 M;  2NPT B;  5JH5 C;  2BB6 A;  3NZU A;  2BKR B;  2YLM A;  4O1N A;  3PZD A;  1TY0 A;  2JY6 A;  1TS4 A;  1P9D U;  3JSV B;  2K25 A;  3QCA A;  4RGO S;  2WXJ A;  3AB5 A;  3C8Y A;  4JPS A;  4YTN B;  2WXK A;  1GUA B;  1SEB D;  3KLS X;  4LDT B;  1SB3 C;  3P4P B;  1RAX A;  1XLO A;  4TUU A;  4FLH A;  1SE2 A;  4BFR A;  2KVR A;  2M0X A;  1NI3 A;  5IN7 A;  3AE6 B;  3GOE A;  4AJY B;  3UF8 A;  3TSS A;  4KDL B;  3APD A;  5D2M B;  3R3M A;  1N61 A;  1JWB D;  3AE3 B;  1NYR A;  3ZTC A;  3AE1 B;  3LB8 C;  3PSE B;  3MC9 A;  4C56 C;  2IGG A;  1KFY B;  2I2Y A;  2M17 A;  1M4V A;  2L1A A;  3ZNZ B;  1ZXI A;  4E71 A;  1YJI A;  1GB4 A;  2GBK A;  2WNM A;  2GOW A;  2M1M A;  3QAR A;  4WJO A;  1I7H A;  1GNU A;  1UD7 A;  1SIF A;  1EO6 A;  3GZN B;  3Q3M C;  4BKG A;  3MC0 B;  4F8C B;  5H8Y E;  1S1Q B;  2O6V B;  3VTU A;  1C79 A;  2FNJ B;  4TSS A;  2QJL A;  4MDK E;  2JRI B;  3R8B A;  1L0V B;  1V9J A;  1WXA A;  2I38 A;  2KC2 A;  2XN9 C;  2MJD A;  3U7Z A;  2LJI A;  2XK5 A;  2PVG C;  2D3G A;  4WIP A;  3ONS A;  1TZ1 A;  5JXV A;  3RD2 A;  3V6E B;  3BII D;  3VH3 B;  2L00 B;  1K52 A;  1X1M A;  3A4S C;  3TUO A;  2BGF A;  2K9X A;  3LYY A;  2KDB A;  4MSM B;  3QQ8 B;  3AEA B;  3RCZ A;  3QIJ A;  1UWX A;  3Q14 C;  2C7M B;  1KLV A;  1JWA D;  2K6Q A;  3GZN I;  1ZDV A;  4KGS A;  4YSY B;  3PLV A;  4XWT A;  3I3T B;  3NVZ A;  4ICU A;  1J19 A;  2L83 A;  2LWP A;  1MG4 A;  5G55 A;  3EUB 2;  3GS2 A;  1N6Z A;  4ITK A;  3PS6 A;  3QHT A;  2DZK A;  2BWE S;  3DHI C;  2OJR A;  3FKY A;  4URK A;  2ZW1 A;  4EZK A;  3DBL I;  4PS8 A;  5C3J B;  2WXN A;  3NHE B;  1D6E C;  3ENE A;  4M8N A;  2V1Y A;  2WLB A;  2WX1 A;  2BB5 A;  2LHE A;  1P7F A;  3O65 B;  3AE4 B;  3UI3 A;  1C76 A;  4K1R B;  4DXG A;  3BVG A;  4KKJ A;  2LI5 A;  2MP2 A;  1K51 A;  2VRR B;  3L0W B;  4L2Y A;  3RNF C;  3DBL B;  3AM9 A;  4EE2 A;  4K81 A;  4XZ4 A;  4MJS B;  2D2Q A;  2Y5C A;  1QLB B;  4GIV A;  1V1O A;  4GN1 A;  1IP9 A;  2DZJ A;  1ZE3 D;  4W9G A;  1WGY A;  3L08 A;  1CK1 A;  2OOB B;  3PRM B;  4AUQ C;  5EE3 A;  1JCK B;  1OEY J;  1QIL A;  2WDT B;  2G3Q B;  3NVW A;  2LUM A;  4FUL A;  3ZDT A;  2N1V A;  3KYC D;  2X38 A;  2ZEQ A;  4GDK B;  3DQV A;  1U4A A;  4CYE A;  1F52 A;  4MT5 A;  3B0A A;  1PGA A;  4OHJ A;  3QC8 B;  3MP9 A;  4M8M A;  5IAA C;  3MTN B;  1G6J A;  4IKG A;  4C4V B;  4ZDV A;  2AWT A;  1WRD B;  2N7E A;  1NI2 A;  5DPT A;  3ZJT A;  2D11 A;  3U8Z A;  3ALB A;  2GI9 A;  1IGD A;  3VUY A;  2PW9 A;  5TSS A;  2KLC A;  2YEP F;  4HJG E;  3RZW C;  3APF A;  2ICI A;  4C7Z A;  4C7Y A;  5C2T B;  4E3C A;  4WWN A;  4IG7 B;  3K9O B;  2AQ2 B;  4MJS A;  3VTV A;  3BWU D;  3HK0 A;  3UQA A;  2WHI A;  1MHX A;  2KVZ A;  1ACC A;  1P3Q U;  5JZE B;  5LNK 1;  3P42 A;  3Q8E A;  5JHA A;  2KMC A;  2NPT A;  2M19 A;  2KWD A;  2DEN B;  2Z0E B;  2NTS A;  3M62 B;  4DHZ E;  2PVO D;  3P2B A;  2L0T A;  1V8C A;  4PYZ A;  3AE2 B;  4HKQ A;  1D5M C;  1F1H A;  3EA6 A;  3PGE A;  2CHZ A;  5HFY A;  2KTR B;  2W54 A;  5CHV C;  3FAH A;  2ASQ A;  2KZR A;  2NBU A;  1V49 A;  4B0M A;  3D32 A;  1L6V A;  3RN9 C;  3TCA A;  4IM2 A;  4D2K A;  3PTF C;  4MAC A;  4ASW C;  1VZ8 A;  1CZP A;  1HEZ E;  3T3N A;  3DBR I;  3HM3 A;  3BVM A;  3VRA B;  1FXA A;  1AN8 A;  1P7E A;  2C60 A;  2G4D B;  3VUX A;  4BVU C;  1JML A;  2BF8 B;  1AAR A;  2WXG A;  2WXL A;  4RF1 A;  3VR8 B;  1P1A A;  3N1X C;  1FFU A;  3M95 A;  4N59 A;  1I35 A;  2DYB A;  1SSN A;  2A5U A;  2SEB D;  1WJ6 A;  2O2V A;  4E74 A;  1EUV B;  2RDH A;  1R4M I;  3RNB C;  1GG3 A;  2CS4 A;  1QOA A;  4OVV A;  3ETR A;  2ZCB A;  2WU5 B;  3VAW A;  4ZRQ A;  2MBH A;  5EE0 A;  1MJD A;  2KTR A;  3NG0 A;  1P98 A;  1UEL A;  1WYW B;  1OFF A;  3AN1 A;  5D6J B;  4KKI A;  3VXW A;  1ZP0 B;  2QDF A;  1Q1O A;  2MEK A;  1Q10 A;  3V3X A;  4YXD B;  3RNG C;  2PMV A;  2LEK A;  1GPX A;  1OEY A;  4WQM A;  3I9V 1;  1LQB A;  2NBV B;  3NZS A;  4HCP B;  4L1B A;  3RNC C;  2KLG A;  4FJY A;  3C19 A;  2FUH B;  1N63 A;  4B0E A;  2DYM A;  2JX5 A;  3KYD D;  2BW2 A;  2IY0 B;  4YL8 A;  1KJT A;  1J0G A;  2DAJ A;  3APC A;  2IYD B;  2WDR B;  2HTM E;  4HK2 A;  5CX3 A;  3IG3 A;  1PFD A;  4LJO B;  1WXM A;  1N5W A;  5D7G A;  4DHJ D;  1D4B A;  3KWL A;  2IO2 B;  4II3 B;  2AX5 A;  4OVZ A;  1ROE A;  3Q69 A;  4PK1 A;  2OHF A;  2UU7 A;  4RGM A;  2A4Z A;  5EE1 A;  3W5U B;  3VRB B;  3AE9 B;  3L17 A;  2BT6 A;  2KFJ A;  4XDC A;  2VZK B;  2XEW A;  3CIR B;  4BKT A;  2EKI A;  1HZ6 A;  2L05 A;  1WGG A;  4MM3 A;  4NPN A;  4HRS A;  4YT0 B;  5TR5 A;  2N9L A;  1VZ7 A;  5G5G A;  1LO5 D;  2C5L C;  1WJU A;  1WGK A;  1TZO A;  3N9Y C;  1IYF A;  2RDB C;  4S0R A;  3AU5 A;  3SR6 A;  1BUI C;  1JWU D;  4ARI A;  2K8H A;  2JPH A;  3DVN V;  3JSV A;  2X8X X;  3IT6 B;  1DOI A;  2WS3 B;  1YQ4 B;  2W55 A;  3R7R A;  1DYQ A;  3ZO5 B;  3BVZ A;  2BS3 B;  1I4P A;  2BPS A;  2KMA A;  2CJO A;  3MHS D;  2ZPY A;  5BMG A;  1XLQ A;  1A70 A;  3Q8B A;  4MGI E;  5IP4 D;  2G4S A;  3OJ3 A;  4RCO A;  2FE8 A;  3RT3 B;  4ANV A;  2D07 B;  4B9K A;  3TMP B;  1E9M A;  3MFG A;  2DLB A;  4NQK E;  3QK0 A;  1T0S C;  2CJN A;  2D5G A;  1V86 A;  4S17 A;  1WI0 A;  3HRD D;  3ZNG C;  1OQQ A;  2K3U A;  3LJ3 A;  3P4R B;  1XO3 A;  1PGB A;  4AS1 A;  1I42 A;  3U2S C;  4YSX B;  1PYW D;  4A90 A;  2ACZ B;  3O13 A;  3DDC B;  3IBE A;  1SJH D;  3B2G A;  3W1S A;  4I6N B;  4EFO A;  5BYQ A;  3I63 C;  5L83 A;  2N9X A;  5H92 C;  3U7D A;  4RH6 A;  4FJV B;  1SE9 A;  3AEF B;  3Q8A A;  3TL5 A;  4US9 A;  3JYU A;  2KNB A;  4ANX A;  4ICV A;  1UWM A;  4ANU A;  2M0A A;  1WX8 A;  1N60 A;  1V97 A;  3NS1 A;  4REZ A;  5HG2 A;  4EZJ A;  4W9I A;  1WIA A;  1SJE D;  2IZV B;  3P63 A;  1AWD A;  2GB1 A;  4H2A A;  5GMV A;  4M01 A;  2IGH A;  2KWU B;  2KC1 A;  1K53 A;  4GOC A;  2NS5 A;  2E3T A;  4N58 A;  2CHX A;  4WJN A;  4NNJ B;  4IWP A;  1AW7 A;  1ZUD 2;  3Q2A C;  1T5X D;  5D3D A;  1R4N B;  1VDV A;  2MA9 B;  4MEM A;  1EU4 A;  1JRP A;  1J7B A;  1Z2M A;  3WAP A;  1L0X B;  3Q8F A;  2KN5 A;  2AQ1 B;  4ZYN A;  3B2F A;  3OAW A;  3Q6B A;  4K7W A;  1WSP A;  3U30 A;  2WQY B;  4CHK A;  1QOG A;  3U4E G;  2WDQ B;  2L8J A;  3WAN A;  1Q0W B;  1LXD A;  1KTK A;  2KMM A;  4WUR A;  1XEE A;  2MH7 A;  5J18 A;  1R4M B;  2N9K A;  1QZE A;  1QQR A;  4RFB A;  3EFC A;  3H9D A;  4EUT A;  1V6E A;  2LXA A;  2C7H A;  1WM3 A;  1HA5 A;  1R7S A;  4ZRI A;  1TT5 B;  4XWW A;  2LVQ A;  3AU4 A;  1KOT A;  4OZB A;  3N1Z C;  3NUH B;  3C0R B;  2CKH B;  4QAY A;  1XLP A;  4GDL B;  2G9H D;  3MJW A;  1XCT L;  3T9L A;  4XC2 A;  4A3O A;  2IPK D;  1J8C A;  2KO3 A;  3P1M A;  2KX0 A;  1BXT A;  1OGW A;  2WXQ A;  1L2N A;  2NVU I;  5AUK A;  4FA6 A;  1RFA A;  2W9N A;  2BBC A;  2QC8 A;  5FKA C;  4IM3 A;  2K8B A;  1I4R A;  2QMT A;  2JU6 X;  3PV1 A;  1NBF C;  1KF6 B;  1OTR B;  1V1P A;  3L54 A;  1C4C A;  2ZVO A;  1J7A A;  3SFD B;  1XQQ A;  1HXY D;  2MJ3 A;  2MHJ A;  2N9P C;  4IWO A;  5KHO A;  1AYF A;  2Q5W D; 
#chains in the Genus database with same CATH homology
 4LTU A;  1WYG A;  3AEG B;  4OZC A;  2GRI A;  3BK1 A;  2NTS A;  1IBX B;  2PVO D;  2E6X A;  4RGT A;  3KQ4 A;  1JWM D;  1WWT A;  1V8C A;  3AE2 B;  1WRI A;  3DWM A;  1NVI D;  2JQR B;  1JRO A;  4N6E B;  4HKQ A;  1NYQ A;  1GAQ B;  3U52 E;  1D5M C;  2WXO A;  3EA6 A;  3HVD A;  1PUT A;  5HFY A;  2W82 A;  2W54 A;  3GB1 A;  3ZYY X;  3FAH A;  2NMQ A;  1CQV A;  1GOZ A;  1EWY C;  4B0M A;  2WU2 B;  4MH8 A;  4OZA A;  3BZD B;  1FXI A;  1L6V A;  5BMH A;  4M0W A;  3NZ3 A;  2WP9 B;  4D2K A;  1DOY A;  1RFK A;  3RPF C;  2WXM A;  4MAC A;  1VZ8 A;  3AE8 B;  1QF6 A;  4P6V F;  2WXH A;  1CZP A;  1F2R C;  1HEZ E;  3HUI A;  1SBB B;  3T3N A;  3BVM A;  3VRA B;  1EU3 A;  1KLU D;  2Y3A A;  2JYE A;  1GB1 A;  1FXA A;  2PIA A;  1AN8 A;  1P7E A;  2K5P A;  2JYT A;  4HEA 1;  5T8I A;  1FMA D;  1JML A;  2LMC A;  2BYT A;  2KAC A;  3BK2 A;  3I57 A;  4ZRP A;  2WXG A;  3VR8 B;  2WXL A;  4RF1 A;  1N62 A;  2ZW0 A;  1RYJ A;  2YEP B;  4MM3 B;  1FFU A;  1T6B X;  4N59 A;  1YQ3 B;  4CQN A;  3IAM 1;  1B1Z A;  1SF0 A;  1SSN A;  1ET6 A;  4KGR A;  2WXI A;  3WCQ A;  4ZHO A;  2SEB D;  4KGT A;  2SAK A;  3BYY B;  1HQR D;  2VZK D;  1HZ5 A;  2ONQ A;  2W3R A;  4JE3 B;  4L23 A;  1JWS D;  4USA A;  4US8 A;  4WAF A;  2RDH A;  3AV8 A;  1FD6 A;  1TKG A;  3AE7 B;  1FCC C;  4IDI A;  1TKE A;  1QOA A;  1JAL A;  2LHD A;  1EM7 A;  4GLS C;  3ETR A;  2WU5 B;  3ZJV A;  3ABV B;  4ZRQ A;  1IUE A;  3ZGZ A;  1L0Y B;  1Y56 A;  1V1P B;  3AEB B;  5I4D A;  3TEZ A;  1FCL A;  1TS2 A;  3W9C B;  1UUP A;  5EE0 A;  4HRO A;  2TSS A;  1SXT A;  1TKY A;  2L32 A;  3LXF A;  1OFF A;  3AN1 A;  4KKI A;  1ZP0 B;  1I4Q A;  2V4I B;  3GP7 A;  4ZOH C;  2MEK A;  1Q10 A;  2KDM A;  1ZPS A;  3V3X A;  1MI0 A;  3OWE B;  1VRA B;  2PMV A;  4YXD B;  1KLG D;  2LEK A;  1GPX A;  3W2D A;  2BS4 B;  4WQM A;  3I9V 1;  5BMI A;  2Y5P A;  2JWU A;  1RWS A;  4HKZ E;  3IAS 1;  1IGC A;  3B9J A;  5HHD G;  4L1B A;  3AEE B;  1E0Z A;  2CU3 A;  2PTL A;  1C4P A;  4YTP B;  1N63 A;  4DXF A;  4B0E A;  3CWI A;  2DYM A;  2JX5 A;  2QSD A;  2KQ4 X;  2BW2 A;  3IT4 B;  2ON8 A;  4JWS C;  3HVZ A;  1FNV A;  1J7C A;  1QT9 A;  1FRD A;  2WDR B;  3FC4 A;  1FM0 D;  2HTM E;  2RDG A;  1UNS A;  1L6U A;  1VR9 A;  4NAM A;  1I4G A;  1PFD A;  4A6Q A;  1QKZ A;  3EGR A;  4R3D A;  2QIE B;  1E7P B;  2MJE A;  4NZL B;  1N5W A;  2QIL A;  2WXF A;  3MJ5 A;  2Z8L A;  5D7G A;  3URY A;  2JSV X;  1D4B A;  1XLN A;  3KWL A;  4LK0 M;  5AUI A;  2AX5 A;  2BB6 A;  3NVV A;  4OVZ A;  1ROE A;  3Q69 A;  4O1N A;  4TQ1 A;  1TY0 A;  2OHF A;  5MPO A;  1MHH E;  1TS4 A;  4RGM A;  2AQ3 B;  5BYR A;  1FRR A;  2DWQ A;  5D3I B;  5E6J A;  1E6E B;  4RGO S;  5EE1 A;  3W5U B;  3VRB B;  3AE9 B;  2WXJ A;  3AB5 A;  3C8Y A;  4JPS A;  2INP E;  2BT6 A;  4TMA B;  4RF0 A;  4YTN B;  2WXK A;  1SEB D;  4XDC A;  3KLS X;  1QOF A;  2VZK B;  1PDX A;  1SB3 C;  3P4P B;  4XE0 A;  2JXT A;  3R2T A;  1XLO A;  2KN4 A;  3CIR B;  2EKI A;  4A55 A;  1HZ6 A;  3TEY A;  2K0P A;  1SE2 A;  1L5P A;  1NI3 A;  3AE6 B;  3IXS A;  1TS5 A;  4HRS A;  4YT0 B;  2N9L A;  4OW0 A;  3TSS A;  1VZ7 A;  2M56 B;  5G5G A;  1DGJ A;  2FBW B;  2J4X A;  1LO5 D;  4KX6 B;  1OQR A;  3FIL B;  1WGK A;  1N61 A;  1TZO A;  1JWB D;  2V3N A;  1I4X A;  3N9Y C;  1N5X A;  3AE3 B;  1NYR A;  3AE1 B;  3KWV A;  3LB8 C;  3SR6 A;  1DOX A;  1EWC A;  1BUI C;  1JWU D;  1T3Q A;  2IGG A;  1FNU A;  1KFY B;  2J53 A;  3Q8C A;  4A8X C;  4C56 C;  2DBY A;  2H89 B;  2I2Y A;  4ARI A;  1M4V A;  2L1A A;  4ZHP A;  1JQ4 A;  3IT6 B;  1DOI A;  2WS3 B;  1C77 A;  4YSZ B;  1YQ4 B;  2W55 A;  3MHZ A;  1DYQ A;  1ZXI A;  3BVZ A;  2BS3 B;  1YJI A;  1YMH E;  1I4P A;  2CJO A;  4Q2J A;  1GB4 A;  3R2I A;  2WNM A;  2DYO A;  2W3S A;  1YJJ A;  5HI1 A;  5BMG A;  1I7H A;  1XLQ A;  1A70 A;  3Q8B A;  3MC0 B;  2FE8 A;  4RCO A;  4ARC A;  4NJC A;  1E9M A;  3E56 A;  5H8Y E;  1PGX A;  1YNT E;  3MFG A;  1SE4 A;  2DLB A;  1C79 A;  4TSS A;  2FUG 1;  2QJL A;  2J42 A;  2CJN A;  2D5G A;  1F77 A;  3R8B A;  1L0V B;  3TEW A;  3BYT B;  2I38 A;  3HRD D;  2XN9 C;  2MJD A;  1OQQ A;  2K3U A;  3AMZ A;  4FXC A;  2LJI A;  3U7Z A;  3P4R B;  1XO3 A;  1PGB A;  4AS1 A;  2PVG C;  4WIP A;  3U2S C;  4AQ7 A;  4YSX B;  2JZP A;  1PYW D;  4A90 A;  4TQ0 A;  4WH4 A;  1K50 A;  2ACZ B;  5JXV A;  2IJ0 A;  3O13 A;  1MPE A;  3BII D;  1VLB A;  1SJH D;  3B2G A;  1ENF A;  3W1S A;  1XCQ L;  1K52 A;  2J52 A;  5BYQ A;  5H92 C;  3TUO A;  1E10 A;  2K9X A;  1TY2 A;  3LYY A;  5FR3 A;  1B9R A;  4RH6 A;  1TS3 A;  1STE A;  2BTE A;  3AEF B;  3Q8A A;  1CJE A;  3AEA B;  3PZ7 A;  3PZ8 A;  4US9 A;  1UWX A;  4XDD A;  4C80 A;  1XXG A;  1UWM A;  1JWA D;  3TEX A;  1ZDV A;  4KGS A;  4YSY B;  2M0A A;  4XWT A;  3NVZ A;  1N60 A;  1V97 A;  3NS1 A;  2L83 A;  4REZ A;  5HG2 A;  1ZXH A;  3P4Q B;  2PLP A;  3EUB 2;  3GS2 A;  1SJE D;  4ITK A;  5FK9 C;  3P63 A;  1YN3 A;  1AWD A;  1SIJ A;  2GB1 A;  4H2A A;  4ZYS A;  5BYS A;  1F2R I;  2IGH A;  4PT5 A;  1F0Z A;  1K53 A;  2ZW1 A;  3L4P A;  2E3T A;  2WDV B;  1ZDX A;  4N58 A;  2N7J A;  5C3J B;  2WXN A;  1D6E C;  4J3O D;  4YTM B;  2QEJ C;  4YWG G;  3W5V B;  3NVY A;  1AW7 A;  1ZUD 2;  2WLB A;  1T5X D;  4A9A A;  1FNW A;  2BB5 A;  2LHE A;  5D3D A;  2LGI A;  3DWG C;  1P7F A;  2INN E;  3AE4 B;  1VDV A;  3UI3 A;  1C76 A;  1VZ6 A;  1D5X C;  4DXG A;  3BVG A;  2IGD A;  4KKJ A;  4LLG M;  2G1E A;  2B76 B;  1EU4 A;  1K51 A;  1JRP A;  4L2Y A;  1J7B A;  3AM9 A;  3AED B;  2WXR A;  2RMM A;  1L0X B;  2NTT A;  4EE2 A;  2R61 A;  3Q8F A;  2RPV A;  1C4A A;  3RFZ B;  1L4D B;  2AQ1 B;  2EEL A;  3B2F A;  2Y5C A;  1QLB B;  1NEK B;  2V3P A;  1V1O A;  3T3O A;  1I4H A;  1WSP A;  2V0G A;  2WQY B;  1ZE3 D;  1QOG A;  1ET9 A;  2KAJ A;  3SFE B;  1FO4 A;  2HDE A;  1D5Z C;  1KH0 A;  3NRZ A;  1CK1 A;  2XNA C;  2WDQ B;  3AH7 A;  5G5H A;  3U4E G;  3E9S A;  1KTK A;  1L4Z B;  5EE3 A;  1C9F A;  2KMM A;  4WUR A;  2PKO A;  1XEE A;  4UDU C;  1JCK B;  1QIL A;  1WXQ A;  2MH7 A;  4JX1 C;  1KRH A;  1FFV A;  1VJK A;  2N9K A;  1QQR A;  4DQO C;  4RFB A;  3NVW A;  2LUM A;  3PO0 A;  1FIQ A;  2X38 A;  1HA5 A;  1R7S A;  4GDK B;  1BML C;  1NEN B;  4XWW A;  4OZB A;  4MT5 A;  3VR9 B;  3NUH B;  1C78 A;  1ZOY B;  4IOI E;  1YN4 A;  1PGA A;  4OHJ A;  1XLP A;  3MP9 A;  4GDL B;  2G9H D;  5EE9 A;  2H88 B;  4IKG A;  2L52 A;  1IBX A;  1XCT L;  2N0S B;  4NAW B;  5GXG B;  3V05 A;  1YN5 A;  2IPK D;  3J9C A;  3FIL A;  3H8H A;  1FEH A;  2K22 A;  3AEC B;  3ZJT A;  1JW9 D;  1TYG B;  3SEB A;  2BS2 B;  2GI9 A;  1IGD A;  3P1M A;  2PW9 A;  5TSS A;  2WXP A;  1BXT A;  1ESF A;  2WXQ A;  2YEP F;  1RM6 C;  5AUK A;  4HJG E;  1XF5 L;  2LFI A;  2ICI A;  4C7Z A;  2BBC A;  5C2T B;  4C7Y A;  1TJE A;  5FKA C;  4WWM A;  2QMT A;  1I4R A;  3ZJU A;  1UGJ A;  2JU6 X;  2AQ2 B;  4JWU C;  1KF6 B;  1V1P A;  3AE5 B;  3BWU D;  1C4C A;  3ZQ4 A;  1J7A A;  1MHX A;  4RGN A;  3SFD B;  1ACC A;  1MVK A;  1HXY D;  5LNK 1;  2IDY A;  2MJ3 A;  2OED A;  3P42 A;  3Q8E A;  1QOB A;  4RNA A;  1SE3 A;  4P16 A;  1AYF A;  3VQI A;  2Q5W D;  3P4S B;  2M19 A;  2KWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...