2PTLA

Three-dimensional solution structure of an immunoglobulin light chain-binding domain of protein l. comparison with the igg-binding domains of protein g
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
78
structure length
78
Chain Sequence
ENKEETPETPETDSEEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEYTVDVADKGYTLNIKFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN L
publication title Three-dimensional solution structure of an immunoglobulin light chain-binding domain of protein L. Comparison with the IgG-binding domains of protein G.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Binding protein(immunoglobulin l chain)
total genus 8
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 1994-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ptlA00
4MACA 1P7FA 2I2YA 4OZCA 4HJGE 2PTLA 1IGDA 1KH0A 1C9FA 2KACA 1JMLA 1HEZE 1HZ6A 1K53A 2QMTA 3V3XA 2J53A 1PGBA 2NMQA 2IGGA 2IGHA 2N7JA 2EELA 2QSDA 1IBXB 4GLSC 5HFYA 3FILA 1K52A 2GI9A 1XCTL 2IGDA 2J52A 1IBXA 1YNTE 2KN4A 1FCLA 2ZW1A 2JZPA 1MHXA 1QKZA 4IOIE 1ZXHA 5JXVA 1EM7A 2I38A 3UI3A 1IGCA 4D2KA 2ZW0A 4WH4A 2OEDA 3MP9A 1FCCC 1MI0A 2KDMA 1F2RC 2GB1A 2RMMA 2JSVX 2JWUA 2JXTA 1K50A 1GB4A 4IKGA 2N9KA 1XCQL 5HG2A 1XF5L 2JU6X 5BMIA 5HI1A 2KWDA 1D4BA 1MVKA 1UWXA 4KGSA 1K51A 2PLPA 2LUMA 1P7EA 4KGRA 5BMHA 2N9LA 2PW9A 1Q10A 5BMGA 2LHDA 1YMHE 1GB1A 1PGXA 1MHHE 2RPVA 2KQ4X 2ON8A 5HHDG 2LHEA 1FD6A 4HKZE 2ONQA 3GB1A 2K0PA 1MPEA 4OZBA 4OZAA 3FILB 4KGTA 2LGIA 1F2RI 1PGAA 1HZ5A
chains in the Genus database with same CATH superfamily
3APDA 2M1MA 4ZDVA 1UBIA 2QC8A 1Q5WB 3U7DA 2KWVB 1JWUD 3AEDB 4BOSC 2HJ8A 3TIXA 2QMTA 4PT5A 3ZNGC 3BVGA 4IWPA 3DVGY 4ASWC 4MT5A 3I63C 2BB5A 2LUEA 2FIDA 4M0WB 1UF0A 1VRAB 3SR6A 1QLBB 2KN4A 1JROA 1FCLA 4JX1C 2G1EA 3IG3A 4US9A 1UNSA 4IOIE 1MJDA 1QOFA 3IXSA 1R4MI 1WXMA 1V5OA 2VRRB 5AZHA 3AULA 3IBEA 3VTUA 4W9JA 1WR6E 3Q69A 2KFKB 5EE0A 2QHOA 2K8HA 2RMMA 4ZRKA 2ASQA 3IAS1 4HDOA 4EZLA 1L6UA 4FN2A 2WGSA 2C7MB 4K3BA 3L13A 2HTHA 1P0RA 2KZRA 3IHPC 1KRHA 2WYQA 4FLHA 4GDLB 4RF1A 1BMLC 4XX5A 1WRDB 1I4HA 3U30A 1BUIC 3DVNV 4ANVA 2K8CA 4DQOC 2GOWA 3APFA 5D3IB 4II2B 3MHSD 2BTEA 5FR3A 3AI5A 2LGXA 4P7IA 5E6PA 2JRHA 3LJ3A 2BYTA 3AB5A 1ZGUB 2KTRB 4KX6B 1WXQA 5H92C 4KDLB 4ZHOA 4W9DA 4EZKA 4AJWA 2DYMA 2UYZB 2D11A 3N32A 4ZYNA 4FA6A 1JMLA 1T0RC 2KFJA 3OJ4B 2V1YA 5C2TB 1XD3B 2PVOD 2D3BA 2ZCCA 3NHEB 3MC8A 2K3UA 3URYA 4IWQA 2MA9B 2WP9B 1FEHA 2ZW1A 2WNMA 3C8YA 1ZPSA 3CIRB 4MGYE 3TCAA 4KSLC 2K39A 3HVDA 1NENB 2MHJA 4WJNA 4C7YA 2MJEA 2WXGA 2OJWA 2BQQA 1F2RC 3DBLI 2M8SA 1KF6B 1K50A 4O1NA 1ENFA 2M19A 2L1AA 4NQLB 5EDSA 5G2NA 2BKRB 2DZKA 2KDBA 1WWTA 2WXIA 2RGFA 5HG2A 3SEBA 3SFDB 4LLGM 1E8XA 2BYFA 3FAHA 1U4AA 1EF1A 3OWEB 1C4AA 1RAXA 1L0VB 2WDTB 4N59A 2A4ZA 1TS2A 2WX0A 1OEYJ 4GDKB 1YN4A 3VR8B 2L76A 2FIFA 2ZPNA 4JLCA 4URKA 2GMIC 3VUWA 3OG5A 1MHHE 2KN5A 1QOAA 1WGDA 3EFCA 1L0YB 3SDLC 3TBLD 2LHEA 3PRMB 2JYEA 3ONSA 1N62A 4OZBA 1YQ4B 1XXGA 2M0XA 4OW0A 1EU4A 1WGHA 3MC9A 2FUG1 5BYQA 3DVNU 1KM7A 1WJUA 2LVOA 1DOYA 1SGHA 5AUKA 1Y8RC 1L0XB 1WX7A 4HDQA 1FNVA 3PHWB 2NTTA 2INPE 3AE3B 2LRUA 2KX0A 2L05A 1JW9D 4BAXA 3IT4B 5KHQA 3AE4B 1L7YA 4ICVA 3DBRI 1PDXA 4XWWA 3LXFA 1AW7A 2YLMA 2JT4B 1C78A 3IFWB 4JQWC 1T3QA 1YQBA 3L08A 1J7CA 2CJNA 4GMVA 2L00B 4WWPA 1VJKA 3V62A 2WXQA 2LMCA 4GXBA 1ROEA 3ZXRA 4A20A 2KXJA 5L83A 1PQSA 3Q8CA 4M02A 2O6VB 3QC8B 1G6JA 3ENEA 5FK9C 3JSVB 4LDTD 2N1WA 2WWZA 1TKGA 3N30A 3DHHC 3PTFC 4YTNB 2KMMA 1WGGA 4P1CC 2KQSA 2N0SB 1X1MA 4FBJB 3RZWC 5KHOA 2Y5BB 4N58A 4HXDA 1L2NA 2KC1A 3QX1A 4REZA 2HTME 3ML8A 2JY6A 1R4NB 1WZ3A 3VAWA 3U52E 2D2QA 4HKZE 4BOZB 4MH0E 2KJRA 2KVRA 1GNUA 4TSSA 4B95A 2C7NB 3GP7A 1UD7A 4ARCA 2PPHA 4DHJB 2C9WB 2PTLA 1FM0D 4A55A 3PV1A 1KFYB 4LJPB 1TYGB 3FKYA 3UGBB 2WXJA 2JPHA 1ESFA 2WXFA 3ZW3A 3QIJA 1I7HA 2CHWA 2N7JA 4XZ4A 3HRDD 1XCTL 2IGDA 2L8JA 3AV8A 3AE5B 2CU1A 3KH0A 1FO4A 3KVFB 4LDTB 3A1QB 2NBWB 2I38A 3GE8C 4PYUA 4F1SA 3UI3A 4D2KA 3Q2AC 4RH6A 3O65B 3DQVA 5EE3A 2D3CA 4JIOU 1HXYD 3AMZA 1UH6A 3EA6A 3RYTA 1RYJA 4EOYA 1SE9A 2JXTA 1YIWA 1LFDA 1VDVA 4MJSA 4FXCA 1WYWB 4NJ6A 3EECA 1WM2A 1GUAB 4W9GA 1YOVB 1HTQA 1NYQA 1V86A 4CHKA 1RRBA 4HPMB 1ZDXA 3L54A 3GZNB 4PYZA 1T0SC 2IO0B 2DAFA 2L52A 2H88B 1J19A 1MFWA 2PE6B 4A90A 3QQ8B 4XE0A 5CHFA 2CR5A 2AQ3B 1J0GA 3VH4B 3ZUNA 1T6BX 1V1PB 4USAA 3L17A 2J4XA 3AECB 5CX3A 4XDDA 2HD5B 3P2BA 2R61A 1V9JA 5AEKB 1FXTB 1QOGA 3C0RB 1NVID 1HZ6A 5JH5C 2XN9C 1YX6B 2LWPA 2V0GA 3CF6E 2LJ5A 2NBUA 4IWOA 5LXHA 2MLBA 4RCOA 4TKNA 1YN3A 2QDFA 3W1SC 2V4IB 4FULA 4W9HA 2LVPA 3SU8X 3Q8EA 4DXAB 1S3SG 4ZHPA 4FJYA 4LTUA 4DHZB 1WMHB 4WQMA 4C00A 2J0MA 1SEBD 2KDMA 3VHTC 2JQRB 2KMCA 4MGZE 4K81A 2MX2A 1GB4A 2K9XA 4IKGA 3BINA 3ZNHB 3Q8AA 2GRIA 3NVWA 2MCNB 2NCNA 4KSKC 1WM3A 3AEFB 1VR9A 2LGYA 3PRPB 1OGWA 1K51A 4S0RA 3AE1B 3RUIB 2LJIA 4EEWA 4G50A 2CS4A 4ZRIA 2KJHB 3R66C 1I4PA 2L32A 3Q6BA 4GSWA 2G3QB 2J42A 4L23A 2KD0A 1Q0WB 3P4RB 1MPEA 3NS8A 1WSPA 4TUUA 2RD0A 2LGIA 3T3NA 4GU2A 3MJWA 3EC8A 1E90A 2VH1A 3TEZA 3SFEB 4YSXB 1CQVA 4GGQA 1KH0A 2KACA 2ZCBA 4FJZA 2CU3A 1Y56A 2J53A 4RGOS 3KLSX 4EKUA 3HHMA 3NG0A 1E0ZA 4S17A 4DWFA 1PYWD 2IGHA 1E6EB 2IO1B 1N63A 2QSDA 1IBXB 4GN1A 3HK0A 4WJOA 1VLBA 2W54A 4F7ZA 4MM3A 3PPAA 2VZKD 1HTOA 2LD9A 2JZPA 1F9JA 5IA7A 2A5UA 1JWBD 3BZDB 2IJ0A 3R7QA 3VR9B 3P63A 5FR6A 1CK1A 3VQIA 5JXVA 2KJ6A 3N1YC 1IP9A 3WAMA 5DCNA 4BKSA 3RZFA 4W9FA 2L83A 4EE2A 5J18A 3QAQA 1NI3A 1VZ6A 2WXPA 1SB3C 2JF5A 1L4ZB 3RMKC 2K6QA 1C76A 3DHIC 5MPOA 4CQNA 1FNWA 2RDHA 2AEHA 4EZJA 2MP2B 4PS7A 1GPXA 3R2IA 3K9PB 1VD2A 2NPTB 4C80A 1DGJA 3RNAC 3ZJVA 3ZIMA 3RD2A 2RSUA 1WJ4A 3KYDD 1B9RA 2K22A 1ZKHA 1LGRA 1I42A 3HIZA 2LHDA 4IW0A 2FUHB 2KQ4X 4E74A 2ONQA 3Q8BA 2GBJA 2RPQA 1TIFA 3JVZX 1E8WA 4K7WA 2VZKB 2L0FA 1P98A 2YEPB 1CMXB 4AOFA 2EMTA 2AWTA 4AUQC 1M4VA 2WS3B 4DK5A 2KLCA 2UWQA 1QZEA 3DWGC 2ZVNA 1STEA 2DX5B 1R7SA 3A9KB 4NAMA 4JPSA 1HA5A 2MBEA 1QT9A 1QKZA 2WDQB 2INNE 1TKEA 4W9IA 1HE8A 3GE3C 2WXMA 1I35A 2FAZA 2QIEB 2ZW0A 3N3KB 4BKSD 4C4VB 4JWUC 4TQ0A 4IM2A 1JALA 4HCPB 5EE9A 1RLFA 2JRIB 4HWIB 4B6WA 4G3XB 3QCAA 4I6PA 3AXCA 3UF8A 2IYDB 1CJEA 3M62B 1V6EA 2W82A 1SIFA 4P16A 2ZEQA 1XF5L 4IC7B 4P6VF 4WJPA 3NRZA 5G5HA 1YJIA 4ZYSA 1UWXA 2IDYA 1SJHD 1UGJA 1XLPA 4K1RB 2V4LA 5IKCM 5JZEB 3TMPB 3NVYA 3NZSA 3LB8C 2WXLA 1V97A 2PW9A 3PGEA 4H2AA 4IM0A 2MH7A 4ACFA 2PEAA 4WJQA 5LNK1 4WQOB 1WJ6A 2D07B 1ZOYB 4KZCA 3PLVA 2W3RA 1JWAD 2KMAA 3VUXA 4NJCA 1EO6A 3W5UB 4MACA 2WLBA 2Z8LA 3AU5A 4BZAA 3ZTCA 3I5JC 1JQ4A 1PGBA 1RFKA 2BF8B 1SBBB 2VH2A 3MFGA 2I1JA 2BS4B 3ZJTA 3NZ3A 4WAFA 1P1AA 1JRPA 2XK5A 2AL3A 3I9V1 2LASA 3JW0X 2AX5A 3T3OA 5IN7A 3GOEA 1L4DB 3V6EB 3GZNI 2QILA 1FIQA 3NUHB 4IDIA 2BGFA 2ZZPB 5JHBA 1E5WA 1WGYA 4A9AA 3W2DA 4WWOA 2AL6A 1NI2A 1F52A 3KWVA 3V61A 2RDBC 1ET6A 3VFKA 4J6IA 1JWSD 1HQRD 2KK8A 1FFUA 2JU6X 1T0YA 2KWDA 2MBBB 2M0AA 3VTWA 1P7EA 3PSEB 3NOBA 3W5VB 4TQ1A 2M56B 2L7RA 3AE2B 5D7GA 2O2VA 1QOBA 5IAAC 4MSQB 5EE1A 2ON8A 1TS4A 1KTKA 2K0PA 4KVGB 1XO3A 2ACZB 4AQ7A 2GLSA 1I4GA 1UWMA 1HZ5A 1GC7A 1P7FA 1E9MA 1EU3A 3Q3FA 4RGTA 2BKFA 4I6NB 2N1VA 5E6JA 3A9JA 2IY1B 1F1HA 3PZ8A 1SXTA 3BYTB 3UIOB 1D3ZA 1FPYA 2LEKA 5G5GA 1SF0A 5G55A 4BFRA 5TR5A 3X0WA 3FILA 2JVCA 4B0MA 3Q8FA 2GI9A 2ZNVB 4ANXA 3V60A 4C7ZA 3ETRA 3SHQA 4QAYA 3AEBB 2TSSA 3H7PA 2L3ZA 2MJDA 2KO3A 1FNUA 1EM7A 4YXDB 2C60A 1BT0A 4WIPA 3W1YA 1AN8A 3ZGZA 1FCCC 3BVMA 3QHTA 5DPWA 2Y5CA 3ZXVA 2DZJA 4HKQA 3PZ7A 2N9EB 3KYCD 4GOCA 4XC2A 3DOWA 4LNOA 3RN9C 1C4CA 5DPRA 4E3CA 3AU4A 3PREA 4IUMB 2BWES 4J3OD 5H8YE 4NY0A 4TV3A 2JX5A 3N1XC 1RWSA 4RGNA 4LJOB 2KDFB 5IO9A 4KIKA 1J8CA 3PS6A 3DCGA 3TL5A 2BYEA 2LFIA 1J7AA 2WXHA 3J9CA 4DHZE 2CHXA 3OLMD 3NVZA 1ZW7A 4PK1A 4OZCA 3P1MA 1DYQA 3GS2A 4R3DA 4ICUA 2DAJA 3H9DA 4DDID 1IGDA 2LZ6A 1Z2MA 4NNJB 4A3PA 4A8XC 1GOZA 3P4QB 2DZMA 2N9PC 1WY8A 3ZRCA 3DBHB 3TUOA 2EKEC 3IT6B 2JUOA 1V8CA 1ZXIA 2NR2A 1WI0A 1XLQA 1EWCA 4M0WA 3EGRA 1C1YB 2KWUB 3W9CB 1XLNA 4Q2JA 3PRZA 2N7DA 2GBRA 3HM3A 3L16A 3B2GA 1B1ZA 2ZJDA 1ET9A 1T5XD 4LK0M 1D5XC 4XDCA 1PUTA 2GBMA 3RCZA 1E10A 3N1ZC 3AN1A 4DDGD 2M17A 2D5GA 1CZPA 4DXGA 1D5ZC 2RDGA 3N9YC 3KW5B 5GMVA 1FMAD 2IY0B 2KKCA 1TTNA 3KUCB 4RGMA 4JWSC 4RM9A 1AARA 1L5PA 3A33B 1SE2A 4LNNA 4MEMA 3M3JA 1FFVA 1WF9A 5BMHA 4US8A 2B3AA 1AYFA 3TSSA 1I4RA 3AE7B 4B9KA 1E8ZA 1KLGD 2RPVA 5CTRC 2DBYA 1NEKB 3QJZA 2IO2B 3GB1A 3FILB 2DENB 2INCC 2SAKA 3CSFA 4XWTA 1I4QA 2KTRA 4BVUC 3BYYB 2BBCA 3EFUA 4M8MA 1P3QU 2M4NA 1LO5D 2PE9A 4FJVB 3TEYA 4IM3A 2KYWA 4UDUC 2EKIA 1LM8B 2PKOA 3M63B 3QK0A 4YWGG 1EWYC 3QWZB 3CWIA 1QF6A 4YSYB 2MRPA 2FBWB 2X8XX 5BO4B 3R3MA 4MSMB 3IAM1 2HDEA 2J7QB 4YL8A 1WXAA 2RR9A 3E9SA 1IYFA 1EF5A 4HVBA 5DPTA 3DBSA 2N7EA 1D6EC 1MI0A 3U7ZA 2GB1A 2Z59B 3QA8A 5J2RA 1XLOA 3DHGC 4DXFA 1KLUD 1I4XA 4MJSB 1OQRA 4N6EB 4JE3B 4M8NA 3Q14C 4KIKB 2C7HA 3JYUA 2N9KA 1GAQB 3BK1A 5D2MB 2WU2B 1GJZA 2QCZA 3TJPA 5HI1A 3MTNB 2LI5A 2WXOA 3V6CB 1TKYA 3BVZA 2C5LC 2LXCA 2QEJC 2Z0DB 1WJNA 2GBNA 2N9LA 1C77A 3U8ZA 3WAPA 4GDKA 3RNFC 1YMHE 2PMVA 1OFFA 3U4EG 4JL9A 1ISNA 3M95A 4AS1A 4WWNA 1KLVA 4EUTA 4WWMA 3B08A 4KZ0A 1WGRA 1PGAA 2E3TA 3Q3OC 4HJKA 3LYYA 3KQ4A 4HJGE 2V9HA 2BS3B 2BPSA 3VVWB 1C4PA 1XQQA 2LXAA 3VRBB 1V2YA 4GB9A 1QQRA 3H7SA 2IGGA 3K9OB 3WALA 3LDZE 3Q3MC 5D94A 2PJHA 2J52A 1TS3A 4LNIA 4M00A 2Q5WD 2K25A 4L2YA 3MC0B 4G11A 2Y3AA 1JWMD 1V81A 3R7RA 2JWZA 1TT5B 1N5XA 3BK2A 1YJ1A 4ITKA 1TZOA 2DYBA 1H8CA 1YD8U 1E8YA 3EUB2 4WH4A 1YX5B 2BW2A 2CHZA 4C56C 2JWUA 1J7BA 2DNFA 3WCQA 3RT3B 4ZRJA 3ZQ4A 1F77A 2QJLA 2BVCA 2LRWA 2WDRB 3BWUD 4OVZA 2O6VA 5C1ZA 3DDCB 3JSVA 2G4DB 1WX9A 4II3B 1E7UA 4LNFA 4YT0B 5BMIA 2MBHA 2W9NA 3T8MA 1WYGA 4KV2A 2LUMA 3H1UA 1N60A 2K8BA 2KX3A 1IUEA 4HROA 1VZ7A 1MG4A 4I6LB 1R4NI 2WXNA 3RFZB 2LGDA 3R2TA 1OTRB 3ZDMC 3VRAB 4AWJA 2MEKA 4A3OA 2DZIA 5C3JB 2W3SA 4OVUA 1ZP0B 3N20C 2KTFA 3OJ3A 1V5TA 3P4PB 4P1BC 1FXIA 2D10A 4OVVA 3ML9A 4YTMB 3B0AA 4X57B 2KNBA 3PT2B 3KUDB 4RMAA 1TGZB 2J0KA 4XGAB 3BIID 3VUYA 1HEZE 1M94A 4PS8A 2NMQA 1WIAA 3PZDA 2V3NA 4LNKA 4W9LA 2EMSA 5D3DA 5TSSA 2BS2B 4MM3B 1YNTE 4LCDE 3ZRFA 2KLGA 3NZUA 5I4DA 2CJOA 1WFYA 3AEGB 4RFBA 3WAOA 1TJEA 3P42A 3A1QA 3W1SA 2MSED 2WXKA 3KUZA 1H4RA 2KHWB 5JHAA 4HRSA 2HE7A 3L4PA 1EUVB 3Q3NC 4FHJA 2GBKA 3RULA 3P4SB 2DHZA 2DYOA 2KWCA 5L95C 2JXXA 1WX8A 3CSTA 4N9F4 3AM9A 3ZLZA 1TBEA 3HUIA 1R4MB 2MWSB 2O6VD 1XCQL 3ZDTA 4WAAA 3E56A 3DPDA 1TS5A 3S2AA 2V3SA 2PLPA 3IVFA 1Q1OA 3ABVB 4DBGA 1GC6A 4RF0A 2X38A 2KDIA 4NZLB 2KQ7A 5DPSA 1GB1A 3ZO5B 1WGKA 4KKIA 3AE8B 2W55A 3DBHI 1ACCA 1OQYA 2B76B 5D6JB 4IG7B 1XEEA 1V1PA 3VTVA 4AJYB 3AE9B 4FADA 2KANA 3ECIA 3C19A 3UIPB 1KJTA 4K3CA 4DHJD 2FCSA 3WA0A 2K6DB 4A6QA 2FCNA 2NVUI 2XNAC 1K8RB 2REXA 3RPFC 1WRIA 3UQAA 1IPGA 1UBQA 1ZUD2 3V3XA 2G45B 2JZZA 2DWQA 5J17A 2G4SA 4W9KA 1KOTA 2WU5B 4NAWA 2R2QA 2WHIA 4HLEA 5AZFA 1TY2A 3PO0A 3TEXA 1NBFC 2SEBD 1UZXB 2BYVE 3B9JA 4JGHB 5IOIA 3D32A 3UINB 1MHXA 2NBVB 1SE4A 3HVZA 3X23A 3L0WB 2ZVOA 4XYCA 4GIVA 4EFOA 1AWDA 2OEDA 2WXRA 3MP9A 1FXAA 3VXWA 1WMHA 4RNAA 3CMMB 2JSVX 1VCBA 2NTSA 3ZNID 5T8IA 2NS5A 2N9XA 1N61A 4WURA 5GXGB 2PVGC 4G0NB 3RNEC 4BBNC 2Y5PA 1UGMA 2KVZA 4ZRPA 3KWLA 3RNBC 4AP4C 2JZ3B 3A4RA 3ZYYX 1D4BA 5HKHA 3I3TB 2K5PA 2WQYB 3AEEB 1WE7A 1FRDA 3DBLB 3U2SC 5LXIB 3ZJUA 4ZOHC 2YEPF 4ZRQA 1Q10A 5BMGA 3DWMA 1WH3A 2WX1A 2KAJA 1N5WA 2XEWA 4YSZB 2OJRA 1YQ3B 3OAWA 4NPNA 2L0TA 3UQBA 4OZAA 5C23A 2BB6A 1UELA 2AQ1B 3MHZA 2BWFA 2IZVB 3WANA 1YJJA 2KOXA 1K53A 3A4SC 3ALBA 3ZVVA 1NDDA 1JCKB 2D3GA 2OHFA 4MDKE 5FKAC 1T0QC 2EELA 5HFYA 4NQKE 2FNJB 1IBXA 5E6OA 2Z0EB 2KC2A 3V05A 4YTPB 1LXDA 1SIJA 2YVCA 2XK5B 4L1BA 1TZ1A 2AQ2B 4RM8A 1DOXA 4PS3A 2PIAA 1TY0A 1GG3A 4M01A 3FC4A 2MJ3A 2J0JA 1IGCA 1A5RA 3VH3B 3PLUA 3WIMA 2INDC 2KT7A 2ZNVC 3B2FA 4MELA 2IBIB 1JRUA 2LGSA 4KKJA 3AE6B 3H6NA 4HEA1 1SE3A 1C79A 1QILA 3APCA 3DBRB 4MGKE 3T9LA 2LVQA 1RM6C 1C3TA 3DVGX 1DOIA 1WXSA 1OQQA 2KDEB 2UU7A 4TMAB 2ICIA 1MG8A 3EHVA 2KFKA 1FRRA 1N6ZA 4KGSA 2MP2A 1WXVA 4F8CB 2NPTA 3RI7C 2FE8A 3BY4B 4CYEA 4KGRA 3QARA 2AYOB 2O2VB 3O13A 3PVLA 2DLBA 3VDZA 3ZKJC 4MH8A 1UUPA 2K1FA 5AUIA 3I57A 3MJ5A 4NAWB 5HHDG 4HPLB 1F0ZA 5BYRA 1WE6A 2JYTA 4HPPA 2I1KA 1F2RI 2MW5A 4ANWA 3HM6X 4GDLA 3H8HA 2I2YA 1SSNA 3A9JB 1OEYA 3NS1A 1C9FA 2FCQA 2G9HD 4K7SA 4ARIA 4BBNF 1V1OA 2WDVB 2MBOA 1S1QB 3RNGC 1E7VA 1PFDA 4GLSC 1K52A 3A9KA 2XBBC 5BYSA 5E6NA 4W9CA 3ZNZB 1WZ0A 3B1LX 2MQJA 4HK2A 3H7PB 3R8BA 2OOBB 4NJ7A 1WR1A 2IO3B 4HCNB 2E6XA 1ZXHA 5CHVC 5IP4D 3SD5A 5LLIA 4ANUA 2IPKD 4BKTA 1A70A 3NJTA 4C4VA 2MBQA 4OHJA 2ZPYA 3Q3JA 1P9DU 2FCMA 2N4FA 3AEAB 3L10B 1D5MC 1V49A 3NY5A 5CHWA 2V3PA 1NYRA 1E7PB 3PHXB 4E71A 3AH7A 2D3AA 1XT9B 5AZGA 1MVKA 2H89B 3ZTDA 4MGIE 1BXTA 2CKHB 4K7UA 4KDIC 1RFAA 1ZDVA 4W9EA 2R2OA 1PGXA 4CO7A 4FHKA 1YN5A 1LQBA 1SJED 2HJ1A 2BT6A 1FD6A 1Z5SB 3TEWA 3NVVA 4KGTA 1V80A 1L6VA 1VZ8A 3RNCC 4BKGA 4B0EA 1ZE3D
chains in the Genus database with same CATH topology
1P7FA 1E9MA 4XDDA 1EU3A 4RGTA 2R61A 3BIID 5E6JA 1JWUD 1QOGA 3AEDB 1NVID 1HEZE 1HZ6A 2QMTA 1SXTA 3PZ8A 4PT5A 3BYTB 3BVGA 2NMQA 2LEKA 2XN9C 4MT5A 5G5GA 1SF0A 2BB5A 2V0GA 2V3NA 1VRAB 3FILA 4RCOA 5D3DA 3Q8FA 2GI9A 5TSSA 2BS2B 3SR6A 4B0MA 4MM3B 1QLBB 1YNTE 4C7ZA 2KN4A 1JROA 1FCLA 1YN3A 4JX1C 2G1EA 3ETRA 4US9A 5I4DA 1UNSA 4IOIE 1QOFA 3AEBB 2TSSA 3IXSA 2V4IB 2CJOA 3AEGB 4RFBA 2MJDA 1TJEA 3P42A 1FNUA 1EM7A 3W1SA 4YXDB 2WXKA 3Q8EA 3Q69A 4ZHPA 4WIPA 4LTUA 5EE0A 1AN8A 4WQMA 4HRSA 3ZGZA 1FCCC 3L4PA 1SEBD 2KDMA 2RMMA 2JQRB 3BVMA 3P4SB 2Y5CA 2DYOA 3IAS1 1L6UA 1GB4A 2K9XA 4IKGA 3AM9A 3Q8AA 2GRIA 4HKQA 3PZ7A 3HUIA 3AECB 3NVWA 1XCQL 3E56A 1KRHA 1C4CA 3AEFB 1TS5A 1VR9A 1K51A 3AE1B 2LJIA 4GDLB 2PLPA 4J3OD 3ABVB 4RF1A 5H8YE 1BMLC 1I4HA 1BUIC 2JX5A 4RF0A 1I4PA 2X38A 2L32A 4DQOC 1RWSA 5D3IB 4RGNA 4NZLB 1GB1A 2BTEA 5FR3A 1WGKA 4KKIA 2J42A 3AE8B 2W55A 4L23A 3P4RB 1MPEA 1ACCA 2BYTA 2B76B 1WSPA 3AB5A 1XEEA 1V1PA 2LFIA 1J7AA 2LGIA 2WXHA 3J9CA 3AE9B 4KX6B 3T3NA 1WXQA 5H92C 3TEZA 3NVZA 4ZHOA 3SFEB 4YSXB 1CQVA 4OZCA 3P1MA 1DYQA 2DYMA 3GS2A 4A6QA 4R3DA 2XNAC 1IGDA 1KH0A 3RPFC 1WRIA 2KACA 4A8XC 1JMLA 1GOZA 3P4QB 1ZUD2 1Y56A 2CU3A 3V3XA 5C2TB 2J53A 4RGOS 2PVOD 3KLSX 2DWQA 1E0ZA 2WU5B 3TUOA 1PYWD 3IT6B 2IGHA 1E6EB 1V8CA 1ZXIA 1N63A 2K3UA 2QSDA 1XLQA 3URYA 1EWCA 4M0WA 1IBXB 1TY2A 3EGRA 2WP9B 3PO0A 3TEXA 3W9CB 1XLNA 1VLBA 2SEBD 2W54A 4Q2JA 1FEHA 2VZKD 2ZW1A 2WNMA 3B9JA 2JZPA 3C8YA 1MHXA 1ZPSA 3CIRB 1SE4A 1JWBD 3BZDB 2IJ0A 3HVZA 3HVDA 1NENB 3P63A 3VR9B 1CK1A 3VQIA 5JXVA 4C7YA 3B2GA 1B1ZA 1AWDA 1ET9A 1T5XD 2MJEA 2OEDA 2WXRA 2WXGA 2L83A 4EE2A 3MP9A 1FXAA 1NI3A 1F2RC 4LK0M 1D5XC 4RNAA 4XDCA 1PUTA 1VZ6A 2JSVX 1E10A 2NTSA 3AN1A 1KF6B 2WXPA 5T8IA 1K50A 4O1NA 2D5GA 1CZPA 4DXGA 1ENFA 1SB3C 1L4ZB 1D5ZC 1N61A 2RDGA 2M19A 3N9YC 4WURA 5GXGB 2L1AA 2PVGC 2Y5PA 1FMAD 1C76A 4RGMA 2WXIA 1WWTA 4JWSC 3KWLA 4ZRPA 5HG2A 3SEBA 3SFDB 5MPOA 4CQNA 1FNWA 2RDHA 4LLGM 1L5PA 3ZYYX 1GPXA 1D4BA 3FAHA 3R2IA 3OWEB 1C4AA 1SE2A 4C80A 1DGJA 1L0VB 3ZJVA 2K5PA 2WQYB 4N59A 1TS2A 3AEEB 1FRDA 1FFVA 3U2SC 5BMHA 4US8A 3ZJUA 4ZOHC 1B9RA 4GDKB 2YEPF 1AYFA 2K22A 4ZRQA 1Q10A 1YN4A 1I4RA 3TSSA 5BMGA 3VR8B 2LHDA 3AE7B 3DWMA 2KAJA 1KLGD 1MHHE 1N5WA 2RPVA 1QOAA 2KQ4X 4YSZB 1L0YB 2DBYA 1NEKB 2LHEA 1YQ3B 2ONQA 2JYEA 3Q8BA 3GB1A 1N62A 4OZBA 1YQ4B 3FILB 4OZAA 1XXGA 4OW0A 2BB6A 2SAKA 2AQ1B 1EU4A 3MHZA 4XWTA 1I4QA 2VZKB 2FUG1 3BYYB 5BYQA 2BBCA 2YEPB 1LO5D 1DOYA 1M4VA 5AUKA 2WS3B 1L0XB 3TEYA 1YJJA 1FNVA 1K53A 3DWGC 1STEA 2NTTA 2INPE 4UDUC 3AE3B 2EKIA 4YWGG 2PKOA 1EWYC 1JCKB 2OHFA 1JW9D 5FKAC 1R7SA 3IT4B 3CWIA 2EELA 1QF6A 4YSYB 5HFYA 2FBWB 3AE4B 4NAMA 1IBXA 4JPSA 1PDXA 1HA5A 4XWWA 3V05A 3LXFA 1QT9A 1QKZA 2WDQB 4YTPB 1AW7A 1SIJA 3IAM1 1C78A 4L1BA 2INNE 2AQ2B 1T3QA 1TKEA 2HDEA 1DOXA 2PIAA 1TY0A 3FC4A 2WXMA 3E9SA 1J7CA 2CJNA 2MJ3A 1IGCA 2QIEB 2ZW0A 1D6EC 4JWUC 4TQ0A 1VJKA 1JALA 1MI0A 3U7ZA 3B2FA 2GB1A 2WXQA 4KKJA 1XLOA 2LMCA 1ROEA 5EE9A 3AE6B 4HEA1 1SE3A 4DXFA 1KLUD 1C79A 1QILA 1I4XA 3Q8CA 1OQRA 4N6EB 4JE3B 1CJEA 2N9KA 5FK9C 1RM6C 1GAQB 2W82A 3BK1A 4P16A 1XF5L 4P6VF 1TKGA 3NRZA 1DOIA 2WU2B 4YTNB 5G5HA 1OQQA 4TMAB 1YJIA 2ICIA 5HI1A 2KMMA 4ZYSA 1FRRA 1UWXA 2IDYA 2WXOA 4KGSA 2N0SB 1TKYA 3BVZA 1SJHD 1UGJA 1XLPA 2QEJC 2FE8A 4N58A 3NVYA 4KGRA 3LB8C 2N9LA 2WXLA 1V97A 2PW9A 1C77A 3O13A 4H2AA 4REZA 2DLBA 2HTME 2MH7A 1UUPA 1YMHE 4MH8A 2PMVA 1OFFA 5AUIA 3I57A 3U4EG 3MJ5A 5LNK1 3U52E 4NAWB 5HHDG 4HKZE 4AS1A 1ZOYB 1F0ZA 5BYRA 4WWMA 2JYTA 2W3RA 4TSSA 1JWAD 1F2RI 3GP7A 4NJCA 4ARCA 1PGAA 2E3TA 3W5UB 4MACA 3H8HA 3LYYA 2I2YA 1SSNA 2WLBA 3KQ4A 2Z8LA 4HJGE 2BS3B 2PTLA 1FM0D 4A55A 3NS1A 1C4PA 1KFYB 1C9FA 2G9HD 1TYGB 3VRBB 2WXJA 1JQ4A 4ARIA 1PGBA 1QQRA 1V1OA 2WDVB 1ESFA 1RFKA 2IGGA 2WXFA 1I7HA 2N7JA 1PFDA 1SBBB 3HRDD 4GLSC 1K52A 1XCTL 2IGDA 2J52A 3MFGA 3AV8A 1TS3A 5BYSA 3AE5B 2Q5WD 2BS4B 4L2YA 3MC0B 3ZJTA 2Y3AA 1JWMD 3NZ3A 3R8BA 1N5XA 3BK2A 4WAFA 1FO4A 4ITKA 1TZOA 1JRPA 2E6XA 1ZXHA 3I9V1 2AX5A 2IPKD 2I38A 3T3OA 3UI3A 3EUB2 4D2KA 1L4DB 4RH6A 4WH4A 2BW2A 1A70A 5EE3A 2QILA 1FIQA 1HXYD 4OHJA 3AMZA 3EA6A 3NUHB 4IDIA 1RYJA 4C56C 2JWUA 1J7BA 3AEAB 2JXTA 3WCQA 1D5MC 4A9AA 3W2DA 1VDVA 4FXCA 3ZQ4A 1F77A 3KWVA 2QJLA 2WDRB 3BWUD 4OVZA 1ET6A 2V3PA 1NYRA 1E7PB 1JWSD 1HQRD 1NYQA 1FFUA 2JU6X 4YT0B 5BMIA 3AH7A 2KWDA 1ZDXA 1MVKA 2H89B 1WYGA 2M0AA 2LUMA 1P7EA 1BXTA 1N60A 2L52A 2H88B 3W5VB 4TQ1A 1IUEA 4HROA 1VZ7A 2M56B 3AE2B 5D7GA 1ZDVA 1QOBA 2WXNA 1PGXA 4A90A 3RFZB 3R2TA 1YN5A 4XE0A 3VRAB 1SJED 2MEKA 5EE1A 2ON8A 1TS4A 5C3JB 2W3SA 1KTKA 1ZP0B 2AQ3B 2BT6A 1FD6A 2K0PA 3P4PB 3TEWA 1T6BX 1V1PB 1XO3A 1FXIA 3NVVA 4KGTA 2J4XA 4USAA 4YTMB 1L6VA 1VZ8A 2ACZB 4AQ7A 4B0EA 1ZE3D 1I4GA 1UWMA 1HZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MAC A;  1P7F A;  2I2Y A;  4OZC A;  4HJG E;  2PTL A;  1IGD A;  1KH0 A;  1C9F A;  2KAC A;  1JML A;  1HEZ E;  1HZ6 A;  1K53 A;  2QMT A;  3V3X A;  2J53 A;  1PGB A;  2NMQ A;  2IGG A;  2IGH A;  2N7J A;  2EEL A;  2QSD A;  1IBX B;  4GLS C;  5HFY A;  3FIL A;  1K52 A;  2GI9 A;  1XCT L;  2IGD A;  2J52 A;  1IBX A;  1YNT E;  2KN4 A;  1FCL A;  2ZW1 A;  2JZP A;  1MHX A;  1QKZ A;  4IOI E;  1ZXH A;  5JXV A;  1EM7 A;  2I38 A;  3UI3 A;  1IGC A;  4D2K A;  2ZW0 A;  4WH4 A;  2OED A;  3MP9 A;  1FCC C;  1MI0 A;  2KDM A;  1F2R C;  2GB1 A;  2RMM A;  2JSV X;  2JWU A;  2JXT A;  1K50 A;  1GB4 A;  4IKG A;  2N9K A;  1XCQ L;  5HG2 A;  1XF5 L;  2JU6 X;  5BMI A;  5HI1 A;  2KWD A;  1D4B A;  1MVK A;  1UWX A;  4KGS A;  1K51 A;  2PLP A;  2LUM A;  1P7E A;  4KGR A;  5BMH A;  2N9L A;  2PW9 A;  1Q10 A;  5BMG A;  2LHD A;  1YMH E;  1GB1 A;  1PGX A;  1MHH E;  2RPV A;  2KQ4 X;  2ON8 A;  5HHD G;  2LHE A;  1FD6 A;  4HKZ E;  2ONQ A;  3GB1 A;  2K0P A;  1MPE A;  4OZB A;  4OZA A;  3FIL B;  4KGT A;  2LGI A;  1F2R I;  1PGA A;  1HZ5 A; 
#chains in the Genus database with same CATH topology
 3APD A;  2M1M A;  4ZDV A;  1UBI A;  2QC8 A;  1Q5W B;  3U7D A;  2KWV B;  1JWU D;  3AED B;  4BOS C;  2HJ8 A;  3TIX A;  2QMT A;  4PT5 A;  3ZNG C;  3BVG A;  4IWP A;  3DVG Y;  4ASW C;  4MT5 A;  3I63 C;  2BB5 A;  2LUE A;  2FID A;  4M0W B;  1UF0 A;  1VRA B;  3SR6 A;  1QLB B;  2KN4 A;  1JRO A;  1FCL A;  4JX1 C;  2G1E A;  3IG3 A;  4US9 A;  1UNS A;  4IOI E;  1MJD A;  1QOF A;  3IXS A;  1R4M I;  1WXM A;  1V5O A;  2VRR B;  5AZH A;  3AUL A;  3IBE A;  3VTU A;  4W9J A;  1WR6 E;  3Q69 A;  2KFK B;  5EE0 A;  2QHO A;  2K8H A;  2RMM A;  4ZRK A;  2ASQ A;  3IAS 1;  4HDO A;  4EZL A;  1L6U A;  4FN2 A;  2WGS A;  2C7M B;  4K3B A;  3L13 A;  2HTH A;  1P0R A;  2KZR A;  3IHP C;  1KRH A;  2WYQ A;  4FLH A;  4GDL B;  4RF1 A;  1BML C;  4XX5 A;  1WRD B;  1I4H A;  3U30 A;  1BUI C;  3DVN V;  4ANV A;  2K8C A;  4DQO C;  2GOW A;  3APF A;  5D3I B;  4II2 B;  3MHS D;  2BTE A;  5FR3 A;  3AI5 A;  2LGX A;  4P7I A;  5E6P A;  2JRH A;  3LJ3 A;  2BYT A;  3AB5 A;  1ZGU B;  2KTR B;  4KX6 B;  1WXQ A;  5H92 C;  4KDL B;  4ZHO A;  4W9D A;  4EZK A;  4AJW A;  2DYM A;  2UYZ B;  2D11 A;  3N32 A;  4ZYN A;  4FA6 A;  1JML A;  1T0R C;  2KFJ A;  3OJ4 B;  2V1Y A;  5C2T B;  1XD3 B;  2PVO D;  2D3B A;  2ZCC A;  3NHE B;  3MC8 A;  2K3U A;  3URY A;  4IWQ A;  2MA9 B;  2WP9 B;  1FEH A;  2ZW1 A;  2WNM A;  3C8Y A;  1ZPS A;  3CIR B;  4MGY E;  3TCA A;  4KSL C;  2K39 A;  3HVD A;  1NEN B;  2MHJ A;  4WJN A;  4C7Y A;  2MJE A;  2WXG A;  2OJW A;  2BQQ A;  1F2R C;  3DBL I;  2M8S A;  1KF6 B;  1K50 A;  4O1N A;  1ENF A;  2M19 A;  2L1A A;  4NQL B;  5EDS A;  5G2N A;  2BKR B;  2DZK A;  2KDB A;  1WWT A;  2WXI A;  2RGF A;  5HG2 A;  3SEB A;  3SFD B;  4LLG M;  1E8X A;  2BYF A;  3FAH A;  1U4A A;  1EF1 A;  3OWE B;  1C4A A;  1RAX A;  1L0V B;  2WDT B;  4N59 A;  2A4Z A;  1TS2 A;  2WX0 A;  1OEY J;  4GDK B;  1YN4 A;  3VR8 B;  2L76 A;  2FIF A;  2ZPN A;  4JLC A;  4URK A;  2GMI C;  3VUW A;  3OG5 A;  1MHH E;  2KN5 A;  1QOA A;  1WGD A;  3EFC A;  1L0Y B;  3SDL C;  3TBL D;  2LHE A;  3PRM B;  2JYE A;  3ONS A;  1N62 A;  4OZB A;  1YQ4 B;  1XXG A;  2M0X A;  4OW0 A;  1EU4 A;  1WGH A;  3MC9 A;  2FUG 1;  5BYQ A;  3DVN U;  1KM7 A;  1WJU A;  2LVO A;  1DOY A;  1SGH A;  5AUK A;  1Y8R C;  1L0X B;  1WX7 A;  4HDQ A;  1FNV A;  3PHW B;  2NTT A;  2INP E;  3AE3 B;  2LRU A;  2KX0 A;  2L05 A;  1JW9 D;  4BAX A;  3IT4 B;  5KHQ A;  3AE4 B;  1L7Y A;  4ICV A;  3DBR I;  1PDX A;  4XWW A;  3LXF A;  1AW7 A;  2YLM A;  2JT4 B;  1C78 A;  3IFW B;  4JQW C;  1T3Q A;  1YQB A;  3L08 A;  1J7C A;  2CJN A;  4GMV A;  2L00 B;  4WWP A;  1VJK A;  3V62 A;  2WXQ A;  2LMC A;  4GXB A;  1ROE A;  3ZXR A;  4A20 A;  2KXJ A;  5L83 A;  1PQS A;  3Q8C A;  4M02 A;  2O6V B;  3QC8 B;  1G6J A;  3ENE A;  5FK9 C;  3JSV B;  4LDT D;  2N1W A;  2WWZ A;  1TKG A;  3N30 A;  3DHH C;  3PTF C;  4YTN B;  2KMM A;  1WGG A;  4P1C C;  2KQS A;  2N0S B;  1X1M A;  4FBJ B;  3RZW C;  5KHO A;  2Y5B B;  4N58 A;  4HXD A;  1L2N A;  2KC1 A;  3QX1 A;  4REZ A;  2HTM E;  3ML8 A;  2JY6 A;  1R4N B;  1WZ3 A;  3VAW A;  3U52 E;  2D2Q A;  4HKZ E;  4BOZ B;  4MH0 E;  2KJR A;  2KVR A;  1GNU A;  4TSS A;  4B95 A;  2C7N B;  3GP7 A;  1UD7 A;  4ARC A;  2PPH A;  4DHJ B;  2C9W B;  2PTL A;  1FM0 D;  4A55 A;  3PV1 A;  1KFY B;  4LJP B;  1TYG B;  3FKY A;  3UGB B;  2WXJ A;  2JPH A;  1ESF A;  2WXF A;  3ZW3 A;  3QIJ A;  1I7H A;  2CHW A;  2N7J A;  4XZ4 A;  3HRD D;  1XCT L;  2IGD A;  2L8J A;  3AV8 A;  3AE5 B;  2CU1 A;  3KH0 A;  1FO4 A;  3KVF B;  4LDT B;  3A1Q B;  2NBW B;  2I38 A;  3GE8 C;  4PYU A;  4F1S A;  3UI3 A;  4D2K A;  3Q2A C;  4RH6 A;  3O65 B;  3DQV A;  5EE3 A;  2D3C A;  4JIO U;  1HXY D;  3AMZ A;  1UH6 A;  3EA6 A;  3RYT A;  1RYJ A;  4EOY A;  1SE9 A;  2JXT A;  1YIW A;  1LFD A;  1VDV A;  4MJS A;  4FXC A;  1WYW B;  4NJ6 A;  3EEC A;  1WM2 A;  1GUA B;  4W9G A;  1YOV B;  1HTQ A;  1NYQ A;  1V86 A;  4CHK A;  1RRB A;  4HPM B;  1ZDX A;  3L54 A;  3GZN B;  4PYZ A;  1T0S C;  2IO0 B;  2DAF A;  2L52 A;  2H88 B;  1J19 A;  1MFW A;  2PE6 B;  4A90 A;  3QQ8 B;  4XE0 A;  5CHF A;  2CR5 A;  2AQ3 B;  1J0G A;  3VH4 B;  3ZUN A;  1T6B X;  1V1P B;  4USA A;  3L17 A;  2J4X A;  3AEC B;  5CX3 A;  4XDD A;  2HD5 B;  3P2B A;  2R61 A;  1V9J A;  5AEK B;  1FXT B;  1QOG A;  3C0R B;  1NVI D;  1HZ6 A;  5JH5 C;  2XN9 C;  1YX6 B;  2LWP A;  2V0G A;  3CF6 E;  2LJ5 A;  2NBU A;  4IWO A;  5LXH A;  2MLB A;  4RCO A;  4TKN A;  1YN3 A;  2QDF A;  3W1S C;  2V4I B;  4FUL A;  4W9H A;  2LVP A;  3SU8 X;  3Q8E A;  4DXA B;  1S3S G;  4ZHP A;  4FJY A;  4LTU A;  4DHZ B;  1WMH B;  4WQM A;  4C00 A;  2J0M A;  1SEB D;  2KDM A;  3VHT C;  2JQR B;  2KMC A;  4MGZ E;  4K81 A;  2MX2 A;  1GB4 A;  2K9X A;  4IKG A;  3BIN A;  3ZNH B;  3Q8A A;  2GRI A;  3NVW A;  2MCN B;  2NCN A;  4KSK C;  1WM3 A;  3AEF B;  1VR9 A;  2LGY A;  3PRP B;  1OGW A;  1K51 A;  4S0R A;  3AE1 B;  3RUI B;  2LJI A;  4EEW A;  4G50 A;  2CS4 A;  4ZRI A;  2KJH B;  3R66 C;  1I4P A;  2L32 A;  3Q6B A;  4GSW A;  2G3Q B;  2J42 A;  4L23 A;  2KD0 A;  1Q0W B;  3P4R B;  1MPE A;  3NS8 A;  1WSP A;  4TUU A;  2RD0 A;  2LGI A;  3T3N A;  4GU2 A;  3MJW A;  3EC8 A;  1E90 A;  2VH1 A;  3TEZ A;  3SFE B;  4YSX B;  1CQV A;  4GGQ A;  1KH0 A;  2KAC A;  2ZCB A;  4FJZ A;  2CU3 A;  1Y56 A;  2J53 A;  4RGO S;  3KLS X;  4EKU A;  3HHM A;  3NG0 A;  1E0Z A;  4S17 A;  4DWF A;  1PYW D;  2IGH A;  1E6E B;  2IO1 B;  1N63 A;  2QSD A;  1IBX B;  4GN1 A;  3HK0 A;  4WJO A;  1VLB A;  2W54 A;  4F7Z A;  4MM3 A;  3PPA A;  2VZK D;  1HTO A;  2LD9 A;  2JZP A;  1F9J A;  5IA7 A;  2A5U A;  1JWB D;  3BZD B;  2IJ0 A;  3R7Q A;  3VR9 B;  3P63 A;  5FR6 A;  1CK1 A;  3VQI A;  5JXV A;  2KJ6 A;  3N1Y C;  1IP9 A;  3WAM A;  5DCN A;  4BKS A;  3RZF A;  4W9F A;  2L83 A;  4EE2 A;  5J18 A;  3QAQ A;  1NI3 A;  1VZ6 A;  2WXP A;  1SB3 C;  2JF5 A;  1L4Z B;  3RMK C;  2K6Q A;  1C76 A;  3DHI C;  5MPO A;  4CQN A;  1FNW A;  2RDH A;  2AEH A;  4EZJ A;  2MP2 B;  4PS7 A;  1GPX A;  3R2I A;  3K9P B;  1VD2 A;  2NPT B;  4C80 A;  1DGJ A;  3RNA C;  3ZJV A;  3ZIM A;  3RD2 A;  2RSU A;  1WJ4 A;  3KYD D;  1B9R A;  2K22 A;  1ZKH A;  1LGR A;  1I42 A;  3HIZ A;  2LHD A;  4IW0 A;  2FUH B;  2KQ4 X;  4E74 A;  2ONQ A;  3Q8B A;  2GBJ A;  2RPQ A;  1TIF A;  3JVZ X;  1E8W A;  4K7W A;  2VZK B;  2L0F A;  1P98 A;  2YEP B;  1CMX B;  4AOF A;  2EMT A;  2AWT A;  4AUQ C;  1M4V A;  2WS3 B;  4DK5 A;  2KLC A;  2UWQ A;  1QZE A;  3DWG C;  2ZVN A;  1STE A;  2DX5 B;  1R7S A;  3A9K B;  4NAM A;  4JPS A;  1HA5 A;  2MBE A;  1QT9 A;  1QKZ A;  2WDQ B;  2INN E;  1TKE A;  4W9I A;  1HE8 A;  3GE3 C;  2WXM A;  1I35 A;  2FAZ A;  2QIE B;  2ZW0 A;  3N3K B;  4BKS D;  4C4V B;  4JWU C;  4TQ0 A;  4IM2 A;  1JAL A;  4HCP B;  5EE9 A;  1RLF A;  2JRI B;  4HWI B;  4B6W A;  4G3X B;  3QCA A;  4I6P A;  3AXC A;  3UF8 A;  2IYD B;  1CJE A;  3M62 B;  1V6E A;  2W82 A;  1SIF A;  4P16 A;  2ZEQ A;  1XF5 L;  4IC7 B;  4P6V F;  4WJP A;  3NRZ A;  5G5H A;  1YJI A;  4ZYS A;  1UWX A;  2IDY A;  1SJH D;  1UGJ A;  1XLP A;  4K1R B;  2V4L A;  5IKC M;  5JZE B;  3TMP B;  3NVY A;  3NZS A;  3LB8 C;  2WXL A;  1V97 A;  2PW9 A;  3PGE A;  4H2A A;  4IM0 A;  2MH7 A;  4ACF A;  2PEA A;  4WJQ A;  5LNK 1;  4WQO B;  1WJ6 A;  2D07 B;  1ZOY B;  4KZC A;  3PLV A;  2W3R A;  1JWA D;  2KMA A;  3VUX A;  4NJC A;  1EO6 A;  3W5U B;  4MAC A;  2WLB A;  2Z8L A;  3AU5 A;  4BZA A;  3ZTC A;  3I5J C;  1JQ4 A;  1PGB A;  1RFK A;  2BF8 B;  1SBB B;  2VH2 A;  3MFG A;  2I1J A;  2BS4 B;  3ZJT A;  3NZ3 A;  4WAF A;  1P1A A;  1JRP A;  2XK5 A;  2AL3 A;  3I9V 1;  2LAS A;  3JW0 X;  2AX5 A;  3T3O A;  5IN7 A;  3GOE A;  1L4D B;  3V6E B;  3GZN I;  2QIL A;  1FIQ A;  3NUH B;  4IDI A;  2BGF A;  2ZZP B;  5JHB A;  1E5W A;  1WGY A;  4A9A A;  3W2D A;  4WWO A;  2AL6 A;  1NI2 A;  1F52 A;  3KWV A;  3V61 A;  2RDB C;  1ET6 A;  3VFK A;  4J6I A;  1JWS D;  1HQR D;  2KK8 A;  1FFU A;  2JU6 X;  1T0Y A;  2KWD A;  2MBB B;  2M0A A;  3VTW A;  1P7E A;  3PSE B;  3NOB A;  3W5V B;  4TQ1 A;  2M56 B;  2L7R A;  3AE2 B;  5D7G A;  2O2V A;  1QOB A;  5IAA C;  4MSQ B;  5EE1 A;  2ON8 A;  1TS4 A;  1KTK A;  2K0P A;  4KVG B;  1XO3 A;  2ACZ B;  4AQ7 A;  2GLS A;  1I4G A;  1UWM A;  1HZ5 A;  1GC7 A;  1P7F A;  1E9M A;  1EU3 A;  3Q3F A;  4RGT A;  2BKF A;  4I6N B;  2N1V A;  5E6J A;  3A9J A;  2IY1 B;  1F1H A;  3PZ8 A;  1SXT A;  3BYT B;  3UIO B;  1D3Z A;  1FPY A;  2LEK A;  5G5G A;  1SF0 A;  5G55 A;  4BFR A;  5TR5 A;  3X0W A;  3FIL A;  2JVC A;  4B0M A;  3Q8F A;  2GI9 A;  2ZNV B;  4ANX A;  3V60 A;  4C7Z A;  3ETR A;  3SHQ A;  4QAY A;  3AEB B;  2TSS A;  3H7P A;  2L3Z A;  2MJD A;  2KO3 A;  1FNU A;  1EM7 A;  4YXD B;  2C60 A;  1BT0 A;  4WIP A;  3W1Y A;  1AN8 A;  3ZGZ A;  1FCC C;  3BVM A;  3QHT A;  5DPW A;  2Y5C A;  3ZXV A;  2DZJ A;  4HKQ A;  3PZ7 A;  2N9E B;  3KYC D;  4GOC A;  4XC2 A;  3DOW A;  4LNO A;  3RN9 C;  1C4C A;  5DPR A;  4E3C A;  3AU4 A;  3PRE A;  4IUM B;  2BWE S;  4J3O D;  5H8Y E;  4NY0 A;  4TV3 A;  2JX5 A;  3N1X C;  1RWS A;  4RGN A;  4LJO B;  2KDF B;  5IO9 A;  4KIK A;  1J8C A;  3PS6 A;  3DCG A;  3TL5 A;  2BYE A;  2LFI A;  1J7A A;  2WXH A;  3J9C A;  4DHZ E;  2CHX A;  3OLM D;  3NVZ A;  1ZW7 A;  4PK1 A;  4OZC A;  3P1M A;  1DYQ A;  3GS2 A;  4R3D A;  4ICU A;  2DAJ A;  3H9D A;  4DDI D;  1IGD A;  2LZ6 A;  1Z2M A;  4NNJ B;  4A3P A;  4A8X C;  1GOZ A;  3P4Q B;  2DZM A;  2N9P C;  1WY8 A;  3ZRC A;  3DBH B;  3TUO A;  2EKE C;  3IT6 B;  2JUO A;  1V8C A;  1ZXI A;  2NR2 A;  1WI0 A;  1XLQ A;  1EWC A;  4M0W A;  3EGR A;  1C1Y B;  2KWU B;  3W9C B;  1XLN A;  4Q2J A;  3PRZ A;  2N7D A;  2GBR A;  3HM3 A;  3L16 A;  3B2G A;  1B1Z A;  2ZJD A;  1ET9 A;  1T5X D;  4LK0 M;  1D5X C;  4XDC A;  1PUT A;  2GBM A;  3RCZ A;  1E10 A;  3N1Z C;  3AN1 A;  4DDG D;  2M17 A;  2D5G A;  1CZP A;  4DXG A;  1D5Z C;  2RDG A;  3N9Y C;  3KW5 B;  5GMV A;  1FMA D;  2IY0 B;  2KKC A;  1TTN A;  3KUC B;  4RGM A;  4JWS C;  4RM9 A;  1AAR A;  1L5P A;  3A33 B;  1SE2 A;  4LNN A;  4MEM A;  3M3J A;  1FFV A;  1WF9 A;  5BMH A;  4US8 A;  2B3A A;  1AYF A;  3TSS A;  1I4R A;  3AE7 B;  4B9K A;  1E8Z A;  1KLG D;  2RPV A;  5CTR C;  2DBY A;  1NEK B;  3QJZ A;  2IO2 B;  3GB1 A;  3FIL B;  2DEN B;  2INC C;  2SAK A;  3CSF A;  4XWT A;  1I4Q A;  2KTR A;  4BVU C;  3BYY B;  2BBC A;  3EFU A;  4M8M A;  1P3Q U;  2M4N A;  1LO5 D;  2PE9 A;  4FJV B;  3TEY A;  4IM3 A;  2KYW A;  4UDU C;  2EKI A;  1LM8 B;  2PKO A;  3M63 B;  3QK0 A;  4YWG G;  1EWY C;  3QWZ B;  3CWI A;  1QF6 A;  4YSY B;  2MRP A;  2FBW B;  2X8X X;  5BO4 B;  3R3M A;  4MSM B;  3IAM 1;  2HDE A;  2J7Q B;  4YL8 A;  1WXA A;  2RR9 A;  3E9S A;  1IYF A;  1EF5 A;  4HVB A;  5DPT A;  3DBS A;  2N7E A;  1D6E C;  1MI0 A;  3U7Z A;  2GB1 A;  2Z59 B;  3QA8 A;  5J2R A;  1XLO A;  3DHG C;  4DXF A;  1KLU D;  1I4X A;  4MJS B;  1OQR A;  4N6E B;  4JE3 B;  4M8N A;  3Q14 C;  4KIK B;  2C7H A;  3JYU A;  2N9K A;  1GAQ B;  3BK1 A;  5D2M B;  2WU2 B;  1GJZ A;  2QCZ A;  3TJP A;  5HI1 A;  3MTN B;  2LI5 A;  2WXO A;  3V6C B;  1TKY A;  3BVZ A;  2C5L C;  2LXC A;  2QEJ C;  2Z0D B;  1WJN A;  2GBN A;  2N9L A;  1C77 A;  3U8Z A;  3WAP A;  4GDK A;  3RNF C;  1YMH E;  2PMV A;  1OFF A;  3U4E G;  4JL9 A;  1ISN A;  3M95 A;  4AS1 A;  4WWN A;  1KLV A;  4EUT A;  4WWM A;  3B08 A;  4KZ0 A;  1WGR A;  1PGA A;  2E3T A;  3Q3O C;  4HJK A;  3LYY A;  3KQ4 A;  4HJG E;  2V9H A;  2BS3 B;  2BPS A;  3VVW B;  1C4P A;  1XQQ A;  2LXA A;  3VRB B;  1V2Y A;  4GB9 A;  1QQR A;  3H7S A;  2IGG A;  3K9O B;  3WAL A;  3LDZ E;  3Q3M C;  5D94 A;  2PJH A;  2J52 A;  1TS3 A;  4LNI A;  4M00 A;  2Q5W D;  2K25 A;  4L2Y A;  3MC0 B;  4G11 A;  2Y3A A;  1JWM D;  1V81 A;  3R7R A;  2JWZ A;  1TT5 B;  1N5X A;  3BK2 A;  1YJ1 A;  4ITK A;  1TZO A;  2DYB A;  1H8C A;  1YD8 U;  1E8Y A;  3EUB 2;  4WH4 A;  1YX5 B;  2BW2 A;  2CHZ A;  4C56 C;  2JWU A;  1J7B A;  2DNF A;  3WCQ A;  3RT3 B;  4ZRJ A;  3ZQ4 A;  1F77 A;  2QJL A;  2BVC A;  2LRW A;  2WDR B;  3BWU D;  4OVZ A;  2O6V A;  5C1Z A;  3DDC B;  3JSV A;  2G4D B;  1WX9 A;  4II3 B;  1E7U A;  4LNF A;  4YT0 B;  5BMI A;  2MBH A;  2W9N A;  3T8M A;  1WYG A;  4KV2 A;  2LUM A;  3H1U A;  1N60 A;  2K8B A;  2KX3 A;  1IUE A;  4HRO A;  1VZ7 A;  1MG4 A;  4I6L B;  1R4N I;  2WXN A;  3RFZ B;  2LGD A;  3R2T A;  1OTR B;  3ZDM C;  3VRA B;  4AWJ A;  2MEK A;  4A3O A;  2DZI A;  5C3J B;  2W3S A;  4OVU A;  1ZP0 B;  3N20 C;  2KTF A;  3OJ3 A;  1V5T A;  3P4P B;  4P1B C;  1FXI A;  2D10 A;  4OVV A;  3ML9 A;  4YTM B;  3B0A A;  4X57 B;  2KNB A;  3PT2 B;  3KUD B;  4RMA A;  1TGZ B;  2J0K A;  4XGA B;  3BII D;  3VUY A;  1HEZ E;  1M94 A;  4PS8 A;  2NMQ A;  1WIA A;  3PZD A;  2V3N A;  4LNK A;  4W9L A;  2EMS A;  5D3D A;  5TSS A;  2BS2 B;  4MM3 B;  1YNT E;  4LCD E;  3ZRF A;  2KLG A;  3NZU A;  5I4D A;  2CJO A;  1WFY A;  3AEG B;  4RFB A;  3WAO A;  1TJE A;  3P42 A;  3A1Q A;  3W1S A;  2MSE D;  2WXK A;  3KUZ A;  1H4R A;  2KHW B;  5JHA A;  4HRS A;  2HE7 A;  3L4P A;  1EUV B;  3Q3N C;  4FHJ A;  2GBK A;  3RUL A;  3P4S B;  2DHZ A;  2DYO A;  2KWC A;  5L95 C;  2JXX A;  1WX8 A;  3CST A;  4N9F 4;  3AM9 A;  3ZLZ A;  1TBE A;  3HUI A;  1R4M B;  2MWS B;  2O6V D;  1XCQ L;  3ZDT A;  4WAA A;  3E56 A;  3DPD A;  1TS5 A;  3S2A A;  2V3S A;  2PLP A;  3IVF A;  1Q1O A;  3ABV B;  4DBG A;  1GC6 A;  4RF0 A;  2X38 A;  2KDI A;  4NZL B;  2KQ7 A;  5DPS A;  1GB1 A;  3ZO5 B;  1WGK A;  4KKI A;  3AE8 B;  2W55 A;  3DBH I;  1ACC A;  1OQY A;  2B76 B;  5D6J B;  4IG7 B;  1XEE A;  1V1P A;  3VTV A;  4AJY B;  3AE9 B;  4FAD A;  2KAN A;  3ECI A;  3C19 A;  3UIP B;  1KJT A;  4K3C A;  4DHJ D;  2FCS A;  3WA0 A;  2K6D B;  4A6Q A;  2FCN A;  2NVU I;  2XNA C;  1K8R B;  2REX A;  3RPF C;  1WRI A;  3UQA A;  1IPG A;  1UBQ A;  1ZUD 2;  3V3X A;  2G45 B;  2JZZ A;  2DWQ A;  5J17 A;  2G4S A;  4W9K A;  1KOT A;  2WU5 B;  4NAW A;  2R2Q A;  2WHI A;  4HLE A;  5AZF A;  1TY2 A;  3PO0 A;  3TEX A;  1NBF C;  2SEB D;  1UZX B;  2BYV E;  3B9J A;  4JGH B;  5IOI A;  3D32 A;  3UIN B;  1MHX A;  2NBV B;  1SE4 A;  3HVZ A;  3X23 A;  3L0W B;  2ZVO A;  4XYC A;  4GIV A;  4EFO A;  1AWD A;  2OED A;  2WXR A;  3MP9 A;  1FXA A;  3VXW A;  1WMH A;  4RNA A;  3CMM B;  2JSV X;  1VCB A;  2NTS A;  3ZNI D;  5T8I A;  2NS5 A;  2N9X A;  1N61 A;  4WUR A;  5GXG B;  2PVG C;  4G0N B;  3RNE C;  4BBN C;  2Y5P A;  1UGM A;  2KVZ A;  4ZRP A;  3KWL A;  3RNB C;  4AP4 C;  2JZ3 B;  3A4R A;  3ZYY X;  1D4B A;  5HKH A;  3I3T B;  2K5P A;  2WQY B;  3AEE B;  1WE7 A;  1FRD A;  3DBL B;  3U2S C;  5LXI B;  3ZJU A;  4ZOH C;  2YEP F;  4ZRQ A;  1Q10 A;  5BMG A;  3DWM A;  1WH3 A;  2WX1 A;  2KAJ A;  1N5W A;  2XEW A;  4YSZ B;  2OJR A;  1YQ3 B;  3OAW A;  4NPN A;  2L0T A;  3UQB A;  4OZA A;  5C23 A;  2BB6 A;  1UEL A;  2AQ1 B;  3MHZ A;  2BWF A;  2IZV B;  3WAN A;  1YJJ A;  2KOX A;  1K53 A;  3A4S C;  3ALB A;  3ZVV A;  1NDD A;  1JCK B;  2D3G A;  2OHF A;  4MDK E;  5FKA C;  1T0Q C;  2EEL A;  5HFY A;  4NQK E;  2FNJ B;  1IBX A;  5E6O A;  2Z0E B;  2KC2 A;  3V05 A;  4YTP B;  1LXD A;  1SIJ A;  2YVC A;  2XK5 B;  4L1B A;  1TZ1 A;  2AQ2 B;  4RM8 A;  1DOX A;  4PS3 A;  2PIA A;  1TY0 A;  1GG3 A;  4M01 A;  3FC4 A;  2MJ3 A;  2J0J A;  1IGC A;  1A5R A;  3VH3 B;  3PLU A;  3WIM A;  2IND C;  2KT7 A;  2ZNV C;  3B2F A;  4MEL A;  2IBI B;  1JRU A;  2LGS A;  4KKJ A;  3AE6 B;  3H6N A;  4HEA 1;  1SE3 A;  1C79 A;  1QIL A;  3APC A;  3DBR B;  4MGK E;  3T9L A;  2LVQ A;  1RM6 C;  1C3T A;  3DVG X;  1DOI A;  1WXS A;  1OQQ A;  2KDE B;  2UU7 A;  4TMA B;  2ICI A;  1MG8 A;  3EHV A;  2KFK A;  1FRR A;  1N6Z A;  4KGS A;  2MP2 A;  1WXV A;  4F8C B;  2NPT A;  3RI7 C;  2FE8 A;  3BY4 B;  4CYE A;  4KGR A;  3QAR A;  2AYO B;  2O2V B;  3O13 A;  3PVL A;  2DLB A;  3VDZ A;  3ZKJ C;  4MH8 A;  1UUP A;  2K1F A;  5AUI A;  3I57 A;  3MJ5 A;  4NAW B;  5HHD G;  4HPL B;  1F0Z A;  5BYR A;  1WE6 A;  2JYT A;  4HPP A;  2I1K A;  1F2R I;  2MW5 A;  4ANW A;  3HM6 X;  4GDL A;  3H8H A;  2I2Y A;  1SSN A;  3A9J B;  1OEY A;  3NS1 A;  1C9F A;  2FCQ A;  2G9H D;  4K7S A;  4ARI A;  4BBN F;  1V1O A;  2WDV B;  2MBO A;  1S1Q B;  3RNG C;  1E7V A;  1PFD A;  4GLS C;  1K52 A;  3A9K A;  2XBB C;  5BYS A;  5E6N A;  4W9C A;  3ZNZ B;  1WZ0 A;  3B1L X;  2MQJ A;  4HK2 A;  3H7P B;  3R8B A;  2OOB B;  4NJ7 A;  1WR1 A;  2IO3 B;  4HCN B;  2E6X A;  1ZXH A;  5CHV C;  5IP4 D;  3SD5 A;  5LLI A;  4ANU A;  2IPK D;  4BKT A;  1A70 A;  3NJT A;  4C4V A;  2MBQ A;  4OHJ A;  2ZPY A;  3Q3J A;  1P9D U;  2FCM A;  2N4F A;  3AEA B;  3L10 B;  1D5M C;  1V49 A;  3NY5 A;  5CHW A;  2V3P A;  1NYR A;  1E7P B;  3PHX B;  4E71 A;  3AH7 A;  2D3A A;  1XT9 B;  5AZG A;  1MVK A;  2H89 B;  3ZTD A;  4MGI E;  1BXT A;  2CKH B;  4K7U A;  4KDI C;  1RFA A;  1ZDV A;  4W9E A;  2R2O A;  1PGX A;  4CO7 A;  4FHK A;  1YN5 A;  1LQB A;  1SJE D;  2HJ1 A;  2BT6 A;  1FD6 A;  1Z5S B;  3TEW A;  3NVV A;  4KGT A;  1V80 A;  1L6V A;  1VZ8 A;  3RNC C;  4BKG A;  4B0E A;  1ZE3 D; 
#chains in the Genus database with same CATH homology
 1P7F A;  1E9M A;  4XDD A;  1EU3 A;  4RGT A;  2R61 A;  3BII D;  5E6J A;  1JWU D;  1QOG A;  3AED B;  1NVI D;  1HEZ E;  1HZ6 A;  2QMT A;  1SXT A;  3PZ8 A;  4PT5 A;  3BYT B;  3BVG A;  2NMQ A;  2LEK A;  2XN9 C;  4MT5 A;  5G5G A;  1SF0 A;  2BB5 A;  2V0G A;  2V3N A;  1VRA B;  3FIL A;  4RCO A;  5D3D A;  3Q8F A;  2GI9 A;  5TSS A;  2BS2 B;  3SR6 A;  4B0M A;  4MM3 B;  1QLB B;  1YNT E;  4C7Z A;  2KN4 A;  1JRO A;  1FCL A;  1YN3 A;  4JX1 C;  2G1E A;  3ETR A;  4US9 A;  5I4D A;  1UNS A;  4IOI E;  1QOF A;  3AEB B;  2TSS A;  3IXS A;  2V4I B;  2CJO A;  3AEG B;  4RFB A;  2MJD A;  1TJE A;  3P42 A;  1FNU A;  1EM7 A;  3W1S A;  4YXD B;  2WXK A;  3Q8E A;  3Q69 A;  4ZHP A;  4WIP A;  4LTU A;  5EE0 A;  1AN8 A;  4WQM A;  4HRS A;  3ZGZ A;  1FCC C;  3L4P A;  1SEB D;  2KDM A;  2RMM A;  2JQR B;  3BVM A;  3P4S B;  2Y5C A;  2DYO A;  3IAS 1;  1L6U A;  1GB4 A;  2K9X A;  4IKG A;  3AM9 A;  3Q8A A;  2GRI A;  4HKQ A;  3PZ7 A;  3HUI A;  3AEC B;  3NVW A;  1XCQ L;  3E56 A;  1KRH A;  1C4C A;  3AEF B;  1TS5 A;  1VR9 A;  1K51 A;  3AE1 B;  2LJI A;  4GDL B;  2PLP A;  4J3O D;  3ABV B;  4RF1 A;  5H8Y E;  1BML C;  1I4H A;  1BUI C;  2JX5 A;  4RF0 A;  1I4P A;  2X38 A;  2L32 A;  4DQO C;  1RWS A;  5D3I B;  4RGN A;  4NZL B;  1GB1 A;  2BTE A;  5FR3 A;  1WGK A;  4KKI A;  2J42 A;  3AE8 B;  2W55 A;  4L23 A;  3P4R B;  1MPE A;  1ACC A;  2BYT A;  2B76 B;  1WSP A;  3AB5 A;  1XEE A;  1V1P A;  2LFI A;  1J7A A;  2LGI A;  2WXH A;  3J9C A;  3AE9 B;  4KX6 B;  3T3N A;  1WXQ A;  5H92 C;  3TEZ A;  3NVZ A;  4ZHO A;  3SFE B;  4YSX B;  1CQV A;  4OZC A;  3P1M A;  1DYQ A;  2DYM A;  3GS2 A;  4A6Q A;  4R3D A;  2XNA C;  1IGD A;  1KH0 A;  3RPF C;  1WRI A;  2KAC A;  4A8X C;  1JML A;  1GOZ A;  3P4Q B;  1ZUD 2;  1Y56 A;  2CU3 A;  3V3X A;  5C2T B;  2J53 A;  4RGO S;  2PVO D;  3KLS X;  2DWQ A;  1E0Z A;  2WU5 B;  3TUO A;  1PYW D;  3IT6 B;  2IGH A;  1E6E B;  1V8C A;  1ZXI A;  1N63 A;  2K3U A;  2QSD A;  1XLQ A;  3URY A;  1EWC A;  4M0W A;  1IBX B;  1TY2 A;  3EGR A;  2WP9 B;  3PO0 A;  3TEX A;  3W9C B;  1XLN A;  1VLB A;  2SEB D;  2W54 A;  4Q2J A;  1FEH A;  2VZK D;  2ZW1 A;  2WNM A;  3B9J A;  2JZP A;  3C8Y A;  1MHX A;  1ZPS A;  3CIR B;  1SE4 A;  1JWB D;  3BZD B;  2IJ0 A;  3HVZ A;  3HVD A;  1NEN B;  3P63 A;  3VR9 B;  1CK1 A;  3VQI A;  5JXV A;  4C7Y A;  3B2G A;  1B1Z A;  1AWD A;  1ET9 A;  1T5X D;  2MJE A;  2OED A;  2WXR A;  2WXG A;  2L83 A;  4EE2 A;  3MP9 A;  1FXA A;  1NI3 A;  1F2R C;  4LK0 M;  1D5X C;  4RNA A;  4XDC A;  1PUT A;  1VZ6 A;  2JSV X;  1E10 A;  2NTS A;  3AN1 A;  1KF6 B;  2WXP A;  5T8I A;  1K50 A;  4O1N A;  2D5G A;  1CZP A;  4DXG A;  1ENF A;  1SB3 C;  1L4Z B;  1D5Z C;  1N61 A;  2RDG A;  2M19 A;  3N9Y C;  4WUR A;  5GXG B;  2L1A A;  2PVG C;  2Y5P A;  1FMA D;  1C76 A;  4RGM A;  2WXI A;  1WWT A;  4JWS C;  3KWL A;  4ZRP A;  5HG2 A;  3SEB A;  3SFD B;  5MPO A;  4CQN A;  1FNW A;  2RDH A;  4LLG M;  1L5P A;  3ZYY X;  1GPX A;  1D4B A;  3FAH A;  3R2I A;  3OWE B;  1C4A A;  1SE2 A;  4C80 A;  1DGJ A;  1L0V B;  3ZJV A;  2K5P A;  2WQY B;  4N59 A;  1TS2 A;  3AEE B;  1FRD A;  1FFV A;  3U2S C;  5BMH A;  4US8 A;  3ZJU A;  4ZOH C;  1B9R A;  4GDK B;  2YEP F;  1AYF A;  2K22 A;  4ZRQ A;  1Q10 A;  1YN4 A;  1I4R A;  3TSS A;  5BMG A;  3VR8 B;  2LHD A;  3AE7 B;  3DWM A;  2KAJ A;  1KLG D;  1MHH E;  1N5W A;  2RPV A;  1QOA A;  2KQ4 X;  4YSZ B;  1L0Y B;  2DBY A;  1NEK B;  2LHE A;  1YQ3 B;  2ONQ A;  2JYE A;  3Q8B A;  3GB1 A;  1N62 A;  4OZB A;  1YQ4 B;  3FIL B;  4OZA A;  1XXG A;  4OW0 A;  2BB6 A;  2SAK A;  2AQ1 B;  1EU4 A;  3MHZ A;  4XWT A;  1I4Q A;  2VZK B;  2FUG 1;  3BYY B;  5BYQ A;  2BBC A;  2YEP B;  1LO5 D;  1DOY A;  1M4V A;  5AUK A;  2WS3 B;  1L0X B;  3TEY A;  1YJJ A;  1FNV A;  1K53 A;  3DWG C;  1STE A;  2NTT A;  2INP E;  4UDU C;  3AE3 B;  2EKI A;  4YWG G;  2PKO A;  1EWY C;  1JCK B;  2OHF A;  1JW9 D;  5FKA C;  1R7S A;  3IT4 B;  3CWI A;  2EEL A;  1QF6 A;  4YSY B;  5HFY A;  2FBW B;  3AE4 B;  4NAM A;  1IBX A;  4JPS A;  1PDX A;  1HA5 A;  4XWW A;  3V05 A;  3LXF A;  1QT9 A;  1QKZ A;  2WDQ B;  4YTP B;  1AW7 A;  1SIJ A;  3IAM 1;  1C78 A;  4L1B A;  2INN E;  2AQ2 B;  1T3Q A;  1TKE A;  2HDE A;  1DOX A;  2PIA A;  1TY0 A;  3FC4 A;  2WXM A;  3E9S A;  1J7C A;  2CJN A;  2MJ3 A;  1IGC A;  2QIE B;  2ZW0 A;  1D6E C;  4JWU C;  4TQ0 A;  1VJK A;  1JAL A;  1MI0 A;  3U7Z A;  3B2F A;  2GB1 A;  2WXQ A;  4KKJ A;  1XLO A;  2LMC A;  1ROE A;  5EE9 A;  3AE6 B;  4HEA 1;  1SE3 A;  4DXF A;  1KLU D;  1C79 A;  1QIL A;  1I4X A;  3Q8C A;  1OQR A;  4N6E B;  4JE3 B;  1CJE A;  2N9K A;  5FK9 C;  1RM6 C;  1GAQ B;  2W82 A;  3BK1 A;  4P16 A;  1XF5 L;  4P6V F;  1TKG A;  3NRZ A;  1DOI A;  2WU2 B;  4YTN B;  5G5H A;  1OQQ A;  4TMA B;  1YJI A;  2ICI A;  5HI1 A;  2KMM A;  4ZYS A;  1FRR A;  1UWX A;  2IDY A;  2WXO A;  4KGS A;  2N0S B;  1TKY A;  3BVZ A;  1SJH D;  1UGJ A;  1XLP A;  2QEJ C;  2FE8 A;  4N58 A;  3NVY A;  4KGR A;  3LB8 C;  2N9L A;  2WXL A;  1V97 A;  2PW9 A;  1C77 A;  3O13 A;  4H2A A;  4REZ A;  2DLB A;  2HTM E;  2MH7 A;  1UUP A;  1YMH E;  4MH8 A;  2PMV A;  1OFF A;  5AUI A;  3I57 A;  3U4E G;  3MJ5 A;  5LNK 1;  3U52 E;  4NAW B;  5HHD G;  4HKZ E;  4AS1 A;  1ZOY B;  1F0Z A;  5BYR A;  4WWM A;  2JYT A;  2W3R A;  4TSS A;  1JWA D;  1F2R I;  3GP7 A;  4NJC A;  4ARC A;  1PGA A;  2E3T A;  3W5U B;  4MAC A;  3H8H A;  3LYY A;  2I2Y A;  1SSN A;  2WLB A;  3KQ4 A;  2Z8L A;  4HJG E;  2BS3 B;  2PTL A;  1FM0 D;  4A55 A;  3NS1 A;  1C4P A;  1KFY B;  1C9F A;  2G9H D;  1TYG B;  3VRB B;  2WXJ A;  1JQ4 A;  4ARI A;  1PGB A;  1QQR A;  1V1O A;  2WDV B;  1ESF A;  1RFK A;  2IGG A;  2WXF A;  1I7H A;  2N7J A;  1PFD A;  1SBB B;  3HRD D;  4GLS C;  1K52 A;  1XCT L;  2IGD A;  2J52 A;  3MFG A;  3AV8 A;  1TS3 A;  5BYS A;  3AE5 B;  2Q5W D;  2BS4 B;  4L2Y A;  3MC0 B;  3ZJT A;  2Y3A A;  1JWM D;  3NZ3 A;  3R8B A;  1N5X A;  3BK2 A;  4WAF A;  1FO4 A;  4ITK A;  1TZO A;  1JRP A;  2E6X A;  1ZXH A;  3I9V 1;  2AX5 A;  2IPK D;  2I38 A;  3T3O A;  3UI3 A;  3EUB 2;  4D2K A;  1L4D B;  4RH6 A;  4WH4 A;  2BW2 A;  1A70 A;  5EE3 A;  2QIL A;  1FIQ A;  1HXY D;  4OHJ A;  3AMZ A;  3EA6 A;  3NUH B;  4IDI A;  1RYJ A;  4C56 C;  2JWU A;  1J7B A;  3AEA B;  2JXT A;  3WCQ A;  1D5M C;  4A9A A;  3W2D A;  1VDV A;  4FXC A;  3ZQ4 A;  1F77 A;  3KWV A;  2QJL A;  2WDR B;  3BWU D;  4OVZ A;  1ET6 A;  2V3P A;  1NYR A;  1E7P B;  1JWS D;  1HQR D;  1NYQ A;  1FFU A;  2JU6 X;  4YT0 B;  5BMI A;  3AH7 A;  2KWD A;  1ZDX A;  1MVK A;  2H89 B;  1WYG A;  2M0A A;  2LUM A;  1P7E A;  1BXT A;  1N60 A;  2L52 A;  2H88 B;  3W5V B;  4TQ1 A;  1IUE A;  4HRO A;  1VZ7 A;  2M56 B;  3AE2 B;  5D7G A;  1ZDV A;  1QOB A;  2WXN A;  1PGX A;  4A90 A;  3RFZ B;  3R2T A;  1YN5 A;  4XE0 A;  3VRA B;  1SJE D;  2MEK A;  5EE1 A;  2ON8 A;  1TS4 A;  5C3J B;  2W3S A;  1KTK A;  1ZP0 B;  2AQ3 B;  2BT6 A;  1FD6 A;  2K0P A;  3P4P B;  3TEW A;  1T6B X;  1V1P B;  1XO3 A;  1FXI A;  3NVV A;  4KGT A;  2J4X A;  4USA A;  4YTM B;  1L6V A;  1VZ8 A;  2ACZ B;  4AQ7 A;  4B0E A;  1ZE3 D;  1I4G A;  1UWM A;  1HZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...