2PTNA

On the disordered activation domain in trypsinogen. chemical labelling and low-temperature crystallography
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title On the Disordered Activation Domain in Trypsinogen. Chemical Labelling and Low-Temperature Crystallography
pubmed rcsb
source organism Bos taurus
molecule tags Hydrolase (serine proteinase)
molecule keywords TRYPSIN
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1981-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ptnA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ptnA02
5EW1H 2IJOB 3BIUH 1ABJH 3HK3B 2OQ5A 1BTYA 2VVVA 1WTHD 2FOGA 1YCPK 3UFAA 4MPVA 3SGQE 1V3XA 2BD8A 1K9OE 4BXWA 3MO3A 3NXPA 3QN7A 4WH6A 1T32A 1O2QA 2ZDKA 1HUTH 3P8GA 1O3BA 1ZLRA 1JBUH 3S9AA 1A1RA 3C27B 3PTBA 1GHVH 1C4U2 2PUXB 3BTWE 2J2UA 4IBLH 1LHFH 1ZMNA 1O3OA 3LT3A 2ZC9H 1LKBA 2OUAA 1Y3UA 1UJ1A 2FOEA 1S0QA 5HGGA 2DE8A 1SSXA 2W3IA 1C2HA 3GY6A 3SU6A 3MNCA 3U69H 1K21H 3A8CA 1SGIB 3UQVA 1XKAC 1C5XB 2I6QA 4ABEA 3RXUA 3ZZBA 2C8XB 1CT2E 1MKXK 2B8OH 3Q3KA 3RU4T 1K22H 1UVSH 1H9LB 2QYIA 2VIQA 3I77A 4YLUA 1SLXB 1NU9A 3ZZ3A 1V2LT 1RIWC 1HIAB 3BTKE 2WV4A 1IQHA 2GCHF 1K28D 3SU4A 1TX6A 1TQ7B 3M5OA 1G3BA 1N1LA 3KQBA 1A2CH 1Z7KA 1SHYA 3TVJB 3ENSB 3LGVA 1O2SA 4ZKRU 3M35A 1FZZA 2A2XH 1A5GH 1P01A 2ZGJA 6LPRA 1L0ZA 1A0LA 3DHKH 1C9PA 1IQFA 1P2QA 1TGNA 3DFJA 4X6OA 2VIPA 1JRSA 1P2NA 1GJ8B 1AD8H 1P3CA 3OSYA 2QXJA 3MU8A 1DX5M 3UTUH 2SNVA 3MHWU 1TOCB 3HKIB 1Y8TA 1CVWH 3M7UA 3QLPH 1H4WA 4F4OC 3GCOA 4BAHB 3K9XB 4KKDA 2G5VA 5DPAA 2P3FH 1A0JA 5DP7A 3A85A 4OGYA 3MMGA 1GBEA 3SJIA 1CBWC 2JH6D 2A0QB 3LGUA 3SBKA 1CGHA 4K69A 3ZZ9A 1BTZA 1YKTA 3UWJH 4E06H 2GX4A 2W3KA 1K1PA 2HNTE 5A0CA 4XFQA 3NUMA 3E1XB 5C1XA 4IMQA 2H9TH 5JB8S 5FBEA 1HV7A 1P8VC 2WPIS 1HPGA 4JYUH 1C1QA 5FAHA 1MD7A 1TONA 1UK4A 3CENA 5E2OA 4I8GA 1SQAA 4HI3A 2QF0A 1KXFA 1OYQA 2FX4A 2O8UA 2XYAA 2RDLA 1PQ8A 4TWYA 1NFYA 1HGTH 2GKVE 3SV7A 4O97A 2VJ1A 1TA6A 3EAJA 1C1NA 1O2UA 1W14U 4BANB 2O8TA 1UMAH 4NWLA 3SU5A 7ESTE 1FY3A 4AYYB 4FU8A 2ZI2H 4Z0KA 2BX3A 1GBDA 1EXFA 1P10A 2C4FH 2ZU4A 3GCTG 2OP9A 1WQSA 1DWCH 3F9HA 3P95A 4MDSA 4ESTE 1O32A 3R3GB 1HIAA 1NN6A 1GI4A 3RXCA 3U8OH 1HAYB 2R3YA 8GCHG 3S7HB 3CP7A 1SHHB 3S0NA 1ELEE 5F8XA 1E0FD 1JWTA 3ODFA 3U1JB 1SFQB 2JETB 1DWDH 2AGGX 4BTUB 1OXGA 4FUFA 1BMMH 5C1YA 3T2NA 3ZVCA 1UCYK 3UNQA 1LCYA 2BHGA 5AHGH 1XKBC 2QY0B 3LC5A 1MTNB 4CRGA 4SGAE 1TWXB 1GDNA 4OGXA 3SU1A 1GJDB 4ABBA 1Y3VA 5A8YA 1X7AC 1TPPA 1ELVA 1A61H 3VB7A 2FOAA 1RGQA 2ODPA 1NRQH 1T8MA 2BZ6H 1PQAA 2OC0A 3TNTA 5PTPA 1VITG 1FIZA 1Z1JA 2P8OC 1UTKA 3A8BA 4AFSA 4CR5A 3KEEA 3NWUA 1QQ4A 2XBWA 1DFPA 2AMDA 4MG3A 4SGBE 3A7WA 3ZVBA 4X2YA 1FJSA 4IN2A 3M5NA 3ZZ4A 2ZP0H 2GGVB 1HXEH 3SQHE 1SOZA 4KTSA 3MH7A 4A6LA 2O9QA 2C90B 1LKAA 5GDSH 3V7TA 1TNKA 4YO9A 1AB9B 1YPGH 1FN8A 1O2VA 1B5GH 3PWBA 1RIWB 4XOJA 1KTSB 3ZZAA 3AW0A 1DT2A 3RXGA 4NA8A 2QGRA 1LMWB 3MOCA 3V12A 1MKWH 1UHBA 3KQCA 4RKJB 1E35B 4GCHF 5F8ZA 4BTIB 4CHAB 2PGQB 5A0AE 3QDZB 3AVZA 1NESE 1S82A 3H7OA 4FU7A 1S5SA 2ZQ2A 1UK2A 1FPCH 1IQGA 3F9FA 3FP7E 3BTGE 1PYTC 3BTDE 1C5ZB 4XBBA 1IAUA 1NFWA 2UUJB 4WMFA 5DP3A 1OPHB 1KXDA 1Y5UT 2XW9A 1Y3XA 4B74A 1TABE 1W8BH 4IW4E 4FUJA 4Y0YE 1C2LA 2IPHA 2H5CA 4UFFH 2GDDA 1G32B 4ABAA 3ZZ6A 1BRUP 1KLIH 3MU4A 1B0EA 3OY5U 1O2JA 4FUDA 2H9EH 1IQIA 1AE5A 1C2IA 3KF2A 4CH8B 1MKWK 1V2ST 2QAAA 2UWOA 4ZKNU 3KIDU 1TRNA 2BXTH 1MCTA 1C2GA 4BAMB 3KL6A 3SV9A 3BG8A 3ZZCA 2NU3E 1QL9A 1QJ6B 5ESTE 4OS7A 6GCHG 2GV6A 3SJ9A 3RXEA 4NCYA 1GG6C 3A89A 4AG1A 2EI6A 1O34A 1UO6A 1AIXH 2RG3A 4B1TA 3QO6A 3PTNA 4AFQA 2GP9B 4U32A 4U30A 1DPOA 3GY5A 4DVAU 3H7TA 1XVOA 5C5NA 4J1YA 3TJVA 1C1UH 3LKWA 3RMNH 4K5ZA 2BLWA 2PSXA 1KDQB 2VWLA 1ZGIA 4MNVA 4MTBA 1O2HA 5DK1A 1O31A 3BTHE 2VGCB 2GZ7A 5LPEA 3KN2A 1UVUH 4WJG2 1H8IH 3IITA 1UTNA 3M5MA 1A0HB 1LQDB 1Y5AT 4H6TA 4NWKA 3LC3A 3RMOH 1J9CH 3BIVH 1SVPA 2Z3EA 3NKKA 1A5IA 1ANCA 1K2I1 1QCPA 1FY1A 1HDTH 3A7VA 3RC4A 3ELAH 1Y5BT 3P6ZB 1SGPE 2ZCLP 2SGQE 1GJ6A 1ARCA 3KQEA 2PTNA 1DWBH 4ISOA 5FHTA 3SJKA 4A5TS 2BY7X 1CHOG 2GT8A 1V2VT 2UUFB 1FDPA 1SGDE 1FY5A 2G4UA 3MWIU 1ZPBA 4JZFH 4CR9A 1J8AA 5HM9A 1ETSH 3C1KA 1CBWB 2FWWA 1BQYA 1AVGH 2STBE 4X8UH 5I25A 4YOIA 1ESTA 5JBCS 2WPLS 1FAXA 4DGJA 1TRMA 4NIVA 3E0PB 3KCGH 1O2YA 3F9EA 3A7YA 3SHCH 5C1UA 3TH4H 3V13A 3LJOA 1UTPA 1L4DA 1SI5H 4BAQB 2VIDA 3MU5A 1QQUA 1TALA 3MH5A 3B23B 4D76A 2C8WB 2SGEE 4NFFA 1GBAA 1D3DB 5HYOA 1EKBB 3TJUA 3NZIA 2CHAB 2GZ8A 1QRZA 2AMQA 4NSYA 1L1JA 3MH6A 2ZNKH 1ANEA 1TOMH 4K3JA 1W0YH 3UR6A 1GI2A 3ATKA 2A7HA 1QA0A 3TK6A 1EB2A 2HWLB 5GCHF 3SNBA 3S9BA 1ELCA 2PTCE 2VH0A 2EI8A 2F9UA 2KAIB 1IHTH 3T25A 2H6MA 1BBRK 1BTUA 3VGCB 1K1OA 1O35A 1EZXC 2PR3A 2VWMA 1MBQA 5AFYH 1GBLA 5A2MH 3SQEE 1F5LA 1GI0A 1CE5A 3TK9A 3F6UH 1LDTT 1P2MA 4ZXXH 5ESBA 2A7CA 2BDYA 4I31A 5FX5A 5T6GA 2H1UA 2BDIA 1EOLA 2HLCA 4ASHA 1MU6B 4BTTB 3IWMA 5IDKA 2G51A 3O8RA 1WYKA 1OX1A 4UFDH 4TPIZ 4AX9H 1TGSZ 2OC7A 3K2UA 1BJVA 4GHTA 3PWCA 1JXPA 1MCVA 4B2AA 1CA0B 2ZHQH 4MVNA 4I7YH 2P8OB 1T31A 1EPTB 1NZQH 2WUCA 1T7CA 4Z6AH 1QBVH 3LGYA 1RTFB 4Q2KA 5G4BA 2VGCC 5L2YH 1Z71A 2B0FA 4DG4A 1O2GH 1ABIH 1V2PT 1O3AA 1BOQA 1ZSJA 2FLBH 3A84A 3FP8E 4JK6A 4X8SH 2UUYA 2UUKB 4K1EA 4CRAA 3SO3A 3PROA 2XCNA 2QCYA 4I33A 2ZKSA 2FOCA 2QF3A 5F6MA 2Y81A 3HPTB 1SQOA 1MKXH 3OU0A 3JZ1B 1GBFA 5JB9S 1C5UA 1HJ8A 4MNXA 1TX8A 3TITA 3ZVGA 1LTOA 1DANH 4XBCA 1BDAA 4YOJA 1AMHA 3RXHA 2OC8A 1D3QB 1PJPA 1ESBA 3P8NA 1EP6A 1V2RT 2TIOA 1S85A 1BMAA 1V6DA 3P8OA 1WTGH 2A4QA 3GDSA 5HM2A 1GMHG 2A4OA 1S81A 5GWZA 1ZGVA 3PMHB 3VB4A 4NZQA 5AFZH 2Z7FE 5E0GA 2FOMB 1BTWA 4UD9H 1RTKA 3BN9A 2VU8E 3HK6B 2F9PA 1L2EA 2P3UB 1GVLA 1O3MA 2BZAA 1YF4A 4YLQH 2JH5D 3BEUA 1EP5A 3ZVAA 3TGIE 2G55A 3FFGA 4TYDA 1W0ZU 4A7IB 1CO7E 1THRH 3K65B 5DGJA 1ELDE 8LPRA 2ZDNA 2AEIH 4DW2U 1C5WB 1NY22 2QA9E 4TY7A 4WXIA 3MO9A 4O03A 4NIWA 1O2IA 1PPEE 2G8TA 4X2XA 3RXRA 3PMAB 4B76A 1EOJA 1DSUA 1GDQA 1VCPA 4Y0ZE 3BTTE 3VEQB 4WVPE 2ZTXA 3M7TA 3P8FA 2Z3CA 4MPWA 1GHWH 2ZDAH 2J34A 4CH2B 3BG4C 1WUNH 2ZPSA 1TAWA 2BOKA 1EASA 1TB6H 2XBYA 4Y7AA 4GPGA 1GJ4H 4B75A 1SGFA 1EJMA 9LPRA 1LHDH 2BQ7B 1OP8A 4AGJA 1O2ZA 6GCHF 1C4V2 2GCTB 3SUDA 1E38B 1GCDA 2WPMS 4IGDA 1O3JA 2ZCHP 3E6PH 3E91A 1JIRA 6CHAC 5IYTA 1ETRH 1DY8A 2NU2E 4YT7H 1S83A 2DE9A 3L3TA 1AZ8A 2PGBB 4FUBA 5DP4A 3RXQA 1O0DH 1BCUH 2ZDMA 4JK5A 1MTNC 2VIWA 1YPKH 8KME2 1Z1IA 2ZIQH 1C1MA 1BTHH 2XBVA 3M3TA 3EYDA 2BD9A 4H4FA 1ORFA 3MU1A 1EAXA 4HZHA 3LDXH 1AUJA 1V2TT 4ZHMU 2F91A 5C67A 1OS8A 1W11U 2QC2A 2C8YB 4FUIA 2ODQA 1GHXH 1WOFA 1EPTC 1K1NA 4GVUA 2G4TA 2AMPA 2NWNA 1AFQB 1RTLA 2OBOA 1O30A 1B0FA 1C1OA 2RA0A 3BTEE 3OX7U 1AFQC 4E7RG 4Y76A 2SGAA 1GHAG 1SGEE 1E34B 1QHRB 3W95A 2J4IA 1W7XH 5JBBS 3RXTA 1UTLM 4X1PU 3ZVFA 4YZUA 1VITH 1UCYE 1RD3B 4R0IA 4ZHAA 1KXEA 3RMMH 3RXJA 4D7FA 1KDQA 1G3CA 5EG4A 5L6NH 3VPKA 1ACBE 3LPRA 1TRYA 4K8YA 1TLDA 2BOHB 2ZQ1A 3E90B 1SBWA 1PPHE 4H42U 3F1SB 4JZIA 5GXPA 1E36B 1GI8B 4K2YA 2FI3E 3MYWA 1F0TA 2PHBA 2F3CE 2D26C 4Q80A 1UVTH 2CXVA 1H8DH 3E8LA 2XC5A 3EA7A 1E37B 4I8JA 5CE1A 1SGTA 2YNBA 4AG2A 1YBWA 5EQRA 1P04A 2P16A 1EUFA 5JPMH 1TNHA 3M37A 1PPCE 2NU0E 1SLUB 2FOFA 3TLOA 5J4QA 1BB0B 1V2KT 2BLOA 2XRCA 4UONA 1Z8RA 3UREA 4B73A 3Q3YA 1P9UA 3GY4A 8ESTE 3U8RH 1NTPA 2QXGA 2Z3DA 1MUEB 3GCHB 1OWJA 5EGMA 3VB5A 2J94A 4ISIH 1HJAB 2HNTC 1VCWA 4LZ1H 4Y8XA 1K1JA 2BTCE 3SUFA 1O38A 3UWIA 1CHOF 3P70B 3LONA 3FP6E 1HBTH 2ZHFH 5DKMA 1AB9C 3M5LA 1O5FH 4ABIA 1YGCH 1ZYOA 1M9UA 3SV8A 1TYNA 4MQAA 1QFKH 3Q3XA 3GYMA 2AIQA 1THSH 4JMYA 2EI7A 3ZVEA 1DLEA 1CHGA 1OP0A 4MPUA 4WMEA 2SGFE 1O3NA 3ATLA 1QY6A 5GPIB 5FX6A 1J16A 4AORA 1XUFA 1O3FA 3EA8A 1GJ9B 1N6YA 4DCDA 1WBGB 2PLXA 2BVXH 2QXIA 1CT0E 1ZHRA 3LU9B 2R9PA 2FDAA 4D7GA 2Y7ZA 4BXSA 2Y5GA 3QTOH 1THPB 2PSYA 2VINA 2STAE 5GJ4B 2NU1E 2BDAA 3LIWA 5A8XA 1O2WA 3CS0A 1HXFH 2FESH 1GJ7B 2AIPA 4Y71A 1GGDC 1KLJH 2WPJS 2A4RA 3SUGA 7GCHF 4INLA 1ARBA 4JZDH 1Z6EA 5K7RA 3H5CB 4X6MA 2OD3B 1AUTC 2R2WU 2ZF0H 3UPEA 1DE7H 1VCQA 1FQ3A 4Y8ZA 2YOLA 1GBTA 4ZKSU 3AAVA 2W26A 1HJAC 3L6PA 1C5SA 4Q7YA 3RXPA 2CV3A 2A5AA 2F9NA 2TGAA 4FXGH 3OY6U 4CRFA 4UDWH 2M5TA 3M7QA 4IN1A 1Q31A 4ABDA 2GVFA 3RXVA 1HAPH 1ZOMA 1P09A 4ABFA 4ZXYH 3HGNA 1C5YB 3A81A 4ZHLU 1QURH 3GOVB 3F9GA 1YM0A 7GCHG 2OLGA 1GMDF 3LH3A 1O39A 1O5CB 5T6FA 1D9IA 1ZMLA 4DY7B 4ZUHA 4AFZA 4AN7A 4WH8A 2ZG0H 5A09A 1NS3A 4FUHA 5CHAC 1BHXF 3ZV8A 3ZV9A 3LOXA 1NU7B 1GG6B 2WYJA 2HOBA 2FS9A 1FI8A 1GMDG 1QBNA 1FV9A 1TNGA 5GIBA 4BAKB 1OWDA 2J38A 1OWIA 2IN2A 1PPGE 2H5DA 4ISHH 1KLTA 3QX5H 1D3TB 4K60A 2AGIX 1W13U 4Y11E 1DVAH 2H2ZA 3SZNA 4INHA 2A31A 1HYLA 1IQEA 1C5OH 1XUGA 3MFJA 3P92A 4AOQA 5SGAE 2JETC 2VH6A 3RC5A 1XMNB 4YTAA 1TFXA 1ANDA 1FXYA 3QGJA 3TJOA 3TU7H 2JH0D 1YPLH 1SGYE 2GT7A 3GCHC 1J17T 2Y7XA 3GCNA 2ULLA 1LQEA 1C1RA 3VFEA 2P94A 2ANMH 2ZHWH 4RKOB 1C2KA 3RM0H 1QIXB 2HGTH 4LOYH 2CN0H 2PKAA 1O3KA 1AE8H 1XVMA 4X2VA 1ZPZA 2ZEBA 1N8OB 2PWXA 1QB9A 5DP8A 2FP7B 1GDUA 1NO9H 1AWFH 2C3SA 1DOJA 2JKHA 1KXAA 4J2YB 3GICB 1OP2A 1GCTB 1RJXB 5A0BA 1WQVH 2ODYB 2G00A 2BD5A 1O33A 2BX4A 1EZQA 5EXLA 3DA9B 1ZJDA 1RXPA 2PUQH 1HAGE 5E0JA 1SFIA 3A7XA 2CJIA 1MQ5A 2ALVA 3SI4H 3ATWA 3SV2H 3UOPA 2BDHA 3EGKH 4NIXA 1C1SA 4CBNA 1FY4A 1YYY1 4LXBH 1VJAU 4RN6A 3NK8A 2ZFTA 3U8TH 1GHAF 1Y59T 1MTVA 3RMLH 1T8NA 4I8HA 1NRPH 1LHGH 4NG9H 1GL0E 2PKSC 2ZHDA 2TGDA 3T29A 4H6SB 4X1RU 5E0HA 2F9BH 2BDCA 2R0LA 1C2EA 2CGAA 4KGAA 3SUEA 1QA7A 3A8DA 3TGKE 3A8AA 4HFPB 2I6SA 2ZDLA 3L33A 3MNBA 1NPMA 3URDA 1ELFA 2BD3A 3FANA 1S84A 3Q00A 1C5NH 1O2NA 1WU1A 2NU4E 3OYPA 1CU1A 1XM1A 2Z9GA 1MU8B 1YCPM 1DDJA 1F0UA 1MTSA 2F83A 3OTJE 1YPEH 5EOKA 5EPNA 4OS4A 1ZSLA 2WPKS 1C5PA 1AI8H 4B71A 2FI5E 1NRRH 2FPZA 2ZU1A 1GBBA 1XXDA 2A32A 1FONA 1AVWA 5E2PA 4XE4A 1C5TA 3M3VA 1NROH 1FMGA 2VNTA 1A3BH 1J15A 4NFEA 2AS9A 2FIRH 5DP6A 3PLPA 1LO6A 1CT4E 1VGCC 1BTPA 1MMJN 4K1SA 1GJAB 2LNCA 1QGFA 3SHAH 2PKAB 1MZAA 2D2DA 3TJNA 4MLFB 2AYWA 1C1WH 1D3PB 1P3EA 4THNH 5T6DA 1BRBE 1TQ0B 3DUXH 2CMYA 1QB1A 2V6NA 1IQNA 2V35A 1BBRE 4KELA 1UTQA 2TRMA 6CHAB 5ABWA 1C2MA 1BA8B 2WV5A 4MNWA 1MBMA 1F0SA 3F68H 4JCNA 1O2KA 4B2BA 5JDUB 1DXWA 2ZO3H 2FO9A 1HB0B 1SGRE 2OC1A 1KTTB 3VB3A 1FY8E 3SNDA 1GGDB 1LVMA 5FBIA 2OQUA 2GDEH 4YOGA 1YPMH 1O36A 3SU2A 1ZHPA 1CA0C 4O3UA 2A1DB 1A7SA 2ZFSA 4UFGH 1TA2A 3RDZA 3GY8A 3CS7A 2GZ9A 5DP9A 1A5HA 3LGWA 2A45B 2ZZUH 2FMJA 2RCEA 1IQJA 2XWAA 4FUEA 2WINI 4A1VA 1BUIA 2FOHA 3SU0A 4NSVA 1GJ5H 2AERH 1ELAA 3FZDA 3STIA 2BQ6B 4BOHA 1TX7A 3M3SA 4DT7B 1QB6A 4IMZA 1FUJA 1OSSA 3ATIA 1NRSH 1W2KH 1P12E 1AVXA 4TPYA 1BMNH 2SFAA 1GBCA 5HXFA 3PYHA 1V2JT 4CRBA 4DURA 4X1SU 3EE0B 1QL8A 2GD4B 3RLYH 3DFLA 1Z8IB 4NA9H 1DUEA 1XUJA 2BYAX 2PW8H 5JBTA 5DO4H 4Y79A 3RM2H 1J14A 1P03A 1P57B 3G01A 5K0HA 1D6RA 5TCAA 3S69A 1MZDA 3GYLB 4IC6A 2Z9LA 3BTQE 2ZFQH 1EAIA 1P2OA 3BEFB 2Z94A 1O2LA 1SB1H 4LZ4B 1DITH 1TMTH 4OS1A 4I8LA 1QRXA 1TNIA 1ZRBA 2BQWB 3A86A 1DS2E 2ZHEH 4ZKOU 3SNCA 3HGPA 1P05A 1QTFA 1ZTLA 2VWOA 2FI4E 4X0WU 2ANYA 1ZPCA 2BY9X 1NRNH 5EXMA 4IS5A 2R2MB 3UY9A 1MQ6A 4ISLA 3LGIA 1TGBA 1W7GH 4WY3A 5FCKA 2HVXA 1SC8U 5C2ZA 1NC6A 4JYTA 1GBIA 1CGIE 1K1IA 3PB1E 3MU0A 4E7NA 2FS8A 3RXMA 5TJXA 4TY6A 4X8VH 5C20A 1S0RA 3TH2H 2Y82A 4FU9A 1XUHA 1BT7A 3PLKA 4O3TA 4DIIH 1SQTA 3GDVA 3UR9A 3EDXB 1KXCA 2CHAC 3LH1A 1JMOH 1CQQA 4ZH8A 1G36A 2XTTB 2SNWA 1LPKB 3KGPA 3QZRA 2B9LA 1HRTH 1L1GA 4INKA 3GCTF 2ZECA 1PQ7A 3KNXA 2C93B 1G9IE 2ANKH 1T4VH 2GMTC 5T3HA 1IQLA 1HAOH 3PMJA 2HPQH 3FAOA 1HAVA 4U2WA 1MD8A 1UTMA 2BLQA 3K6YA 5DJ7A 3O8BA 2V0BA 1BJUA 4ZAEA 5L2ZH 1EB1H 2P59A 1C5RA 2FXRA 2K1QA 2Y5HA 1K1LA 5EPYA 1O3GA 1TE0A 1TGCA 5AF9H 2XCFA 1QL7A 5FXLA 3T5FH 5E8EH 3BSQA 3V3MA 3VGCC 2XC4A 1C5VA 3UIRA 1O3CA 1YLDA 2BDBA 2A4GA 1DY9A 3A82A 2W5EA 4CBOA 1O2OA 4KP0A 1IOEA 1P0SH 1EAWA 1N6XA 3QGNB 1EZUC 3ZZ5A 2HNTF 1PPFE 1TPOA 2ESTE 1A46H 4BNRA 4CRDA 3I78A 3M61U 4KTUA 1H1BA 1AO5A 1AWHB 2BM2A 1OWEA 2F9OA 3ESTA 4JYVH 3KQDA 1GBMA 1GPZA 1P11E 4KTCA 1HJ9A 1ELBA 1QJ1B 1W10U 3QUMP 4LK4A 1CGJE 3PO1C 3STJA 1ESAA 2VIOA 1S6FA 3PO1B 1KYNA 3Q77A 3T27A 2OINA 1C5QA 1Q2WA 1MH0A 1C1TA 2J92A 3E3TA 1P2KA 2BXUH 2XC0A 1VJ9U 2G52A 2PFEA 2Z6BD 3S9CA 2XNIA 2WYGA 4DOQA 3AASA 2B5TB 3GISB 1V2OT 2OTVA 1O3LA 2ZPRA 1WSSH 5CHAB 2QN5T 2FEQH 1GI7B 1EZSC 3BG4B 3MI4A 4OS2A 4AFUA 2ILNA 1TGTA 2TBSA 6ESTA 4X6NA 1GVZA 2FOBA 3RXFA 1EX3A 4RSPA 1O5AB 3PM3A 5EQQA 1EJNA 1BRCE 1TBRH 4MNYA 2BB4A 2D1JA 5AVDA 1Z8GA 2Z9KA 4A1XA 1L4ZA 1RS0A 4YESB 1GMCF 3PV4A 1L1NA 2IOTA 1INCA 1PFXC 1CA8B 1LPGB 1FAKH 2BY6X 1GHBF 3R0FA 4X1QU 3A88A 3RXSA 1YLCA 4TWWA 2VVUA 3KHVA 1YC0A 1C2JA 3BF6H 3SNEA 1VR1H 4ZROA 3AW1A 2ZU3A 2BD2A 1UVPA 4FVDA 2OXSA 1BTXA 4F49A 1V2QT 1O3HA 1GMHF 5H4IB 1GJBB 4PROA 1HAZB 1RRKA 3T26A 2V3HH 3SW2B 3ZZDA 5EQSA 2ZFPH 1O3EA 1SGNE 2XXLA 1PPZA 1BZXE 1O2MA 1V2WT 1GWAA 1MAXA 1ETTH 3RU4D 3AAUA 2OCVB 1DXPA 5FCRA 4XBDA 2ZU2A 5CMXH 3SGAE 1EATA 2FTMA 2TPIZ 1LHEH 4WWYA 3SI3H 4XSKU 4Y8YA 2W7UA 1ANBA 2ZGHA 1AY6H 3UNRA 3SORA 2ZDVH 2BY5X 1AKSB 1LVOA 3EQ0H 4XDEA 1A4WH 2RA3A 5FPYA 2Y6TA 1NFXA 2LPRA 3BTFE 1KXBA 1UK3A 1SGQE 3VXFH 2C8ZB 3LJJA 2Z9IA 1FIWA 4FUCA 3D62A 3O8CA 1O37A 2ZFFH 4GUXA 5L30H 3QTVH 3VXEH 1O5DH 3W94A 4WF8A 5FPSA 1GI6A 1HNEE 1V2UT 2GMTB 1VITF 1KIGH 2ZGBH 3E16B 1G37A 4MPXA 3RXKA 2ALPA 1H9IE 1AU8A 1Y3WA 2GTBA 2THFB 3DD2H 1YCPH 1IQMA 3ITIA 1K1MA 4X6PA 3SU3A 4AGKA 4WMDA 1EJAA 1O5BB 2D8WA 3MH4A 2TGPZ 5F03A 2Q6DA 1FPHH 4D9QA 2P3TB 3TPIZ 2J9NA 4CREA 4A1TA 1LHCH 3U98H 2ZPQA 3B8JA 1W3CA 5JBAS 1JRTA 3GY2A 3WY8A 2AFQB 1D4PB 1HAIH 2PV9B 3IG6B 2A7JA 4Y7BA 4UE7H 1F92A 4ABHA 1BITA 2BD7A 1GI3A 3GY7A 3U9AH 1WCZA 2HPPH 3Q76A 5JYIA 1JOUB 3RXIA 1N8OC 2EEKA 3EA9A 1C5MD 8GCHF 1F0RA 2Y5FA 4Q7XA 5BPEA 3T28A 1ZR0A 1BBRH 1TBQH 1Z6JH 4A92A 1ZTKA 3ZZ8A 2QIQA 1LVBA 2P95A 1H9HE 1AN1E 2V3OH 1EQ9A 1C4Y2 2F9VA 1JIMA 1GHBG 3UQOA 1SL3A 4DIHH 4HGCA 3S7KB 3SJOA 4ABJA 1O5GH 2BD4A 4WXVA 1P2JA 1P2IA 1SLWB 3RUOA 1DWEH 4U01A 1ID5H 5C5OA 2ZWLH 4GCHG 1AZZA 3FZZA 5DP5A 1C1PA 3HKJB 4NIYA 2EC9H 1XX9A 1YP9A 4YM9A 4X8TH 2O8MA 5EW2H 2QV1A 1SGFG 1AFEH 1ZSKA 3URCA 1TNLA 1XUIA 2ZFRH 2GV7A 5C3NA 1TPSA 3RXAA 1GBKA 4D9RA 1T8OA 4X2WA 1GBJA 1YPHC 2FM2A 2FODA 4Q7ZA 2SGPE 1ZMJA 1S6HA 3GDUA 1MTWA 3ZVDA 1SPJA 1O3DA 1V2MT 1HCGA 2SGDE 1G3EA 3D49H 4D8NA 1NM6A 2CF9H 3RXOA 3N7OA 1F2SE 1G2LA 1XXFA 3SJ8A 4HTCH 1MAYA 1VZQH 2QXHA 2UWLA 2Y80A 1F5RA 2KAIA 3U1IB 5LGOA 3FVFB 1HAHH 4NGAH 1QR3E 4GHQA 2A5IA 1LVYA 5A8ZA 1HAVB 1T8LA 4CHAC 1GMCG 3A83A 2Q6GA 1ZJKA 3QZQA 2FZZA 1QNJA 3MTYA 1DLKB 3PLBA 4AB8A 1AGJA 4Y6DA 1GHYH 1DICA 1ZZZA 2VWNA 3BEIB 2G81E 5I46H 2XWBI 3NCLA 2XBXA 2ZGXH 4VGCC 2O8LA 1PYTD 2AGEX 1G3DA 3B9FH 3SOSA 3ZYEA 5ETXA 2J95A 1SOTA 1C2FA 2Q1JA 2FYQA 2WPHS 3GY3A 4YT6H 1BHXB 1OYTH 2TGTA 2ZTYA 1DSTA 4GSOA 3D23A 4NA7A 3ATMA 2FX6A 2VB0A 1GJCB 1ELTA 3A7TA 4O9VA 2AH4X 3PMBB 3BTME 1OWKA 1FLEE 2R0KA 2R3UA 4BAOB 2A5KA 1UCYH 5J4SA 1Z8JB 2HRVA 1A3EH 2B7DH 3LGTA 1IQKA 3SGBE 1SMFE 4I32A 3ZZ7A 4DJZB 2ANWA 4M7GA 3RXLA 7KMEH 5EU8A 2WUBA 1PQ5A 1TPAE 3A80A 1ZTJA 2BMGB 2GCHG 1IHSH 3A7ZA 1C2DA 4IC5A 3UOUA 1P9SA 2FTLE 1DM4B 2P93A 4UEHH 3ZYDA 1EPTA 1UTOA 4AB9A 1O2RA 1OWHA 1P02A 3MNSA 1OKXA 1BRAA 1Q3XA 1GHZA 3QK1A 4OS6A 2ZA5A 3I29A 1FNIA 1ZHMA 1ZRKA 2BDGA 5HMAA 3O8DA 3JZ2B 2Q6FA 2ASUB 1AHTH 3MNXA 1HAXB 5DG6A 9ESTA 2W7SA 3TIUA 1G30B 3RC6A 5EXNA 5FPTA 4E05H 4K1TA 1O2TA 7LPRA 1GL1A 4Y10E 1KY9A 2CF8H 2EA3A 4AZ2B 4JZ1A 1W12U 1TBZH 2UWPA 2ZGCA 1MTUA 1XUKA 3SN8A 3TNSA 3VB6A 1ELGA 5BRRE 3UNSA 1WAYB 1V2NT 5GCHG 1KSNA 1BMLA 1F7ZA 2FLRH 1QRWA 1GBHA 1UVOA 5LH8A 2Z9JA 5B6OA 2VIVA 2ZTZA 3HATH 1O3IA 1SLVB 4I8KA 1G2MA 3M36A 1TNJA 4B2CA 1FN6A 1T4UH 4QT8C 3UUZA 5LPRA 1TMUH 3D65E 3RLWH 1SR5C 1U6QA 1YPJH 1AKSA 1GI9B 1TMBH 1Y3YA 1AQ7A 2OBQA 1QJ7B 2YNAA 4ISNA 1SG8B 1NT1A 1HFDA 1QBOA 1RFNA 2ZCKP 1TIOA 3A87A 5EODA 4X1NU 1C1VH 3T62A 3DT0H 4ZMAH 1BIOA 2FYRA 2HALA 2PKSB 3P17H 3RXDA 3RXBA 1PPBH 3SV6A 4GLYA 1O5EH 1EAUA 1WV7H 1D6WA 3MO6A 2BVRH 3QWCH 3ODDA 1YPHE 2BLVA 1UTJA 4NZLA 1DUAA 4GAWA 2DUCA 1GCTC 3BV9B 4UFEH 2A2QH 1CSOE 4CRCA 4AYVB 5LPFA 3RP2A 5F8TA 1UHBB 3TK5A 1C9TA 1HLTH 3E0NB 3SNAA 3K6ZA 1O2XA 3TGJE 3V0XA 1LPZB 2G5NA 4ABGA 4OS5A 2O8WA 2BY8X 1B7XB 1O2PA 1OOKB 4FVBA 4VGCB 2H9HA 2BVSH 1GI1A 2GCTC 3RU4E 3TH3H 1NFUA 3NPSA 1SGCA 4JZEH 1O3PB 1F5KU 4FUGA 2VVCA 1C5LH 5TCCA 1GVKB 4R8TB 2ZU5A 1P06A 4K8BA 1VGCB 1GI5A
chains in the Genus database with same CATH superfamily
5EW1H 2IJOB 3BIUH 1ABJH 3HK3B 2OQ5A 1BTYA 2VVVA 1WTHD 2FOGA 1YCPK 3UFAA 4MPVA 3SGQE 1V3XA 2BD8A 1K9OE 4BXWA 3MO3A 3NXPA 3QN7A 4WH6A 1T32A 1O2QA 2ZDKA 1HUTH 3P8GA 1O3BA 1ZLRA 3DSOA 1JBUH 3S9AA 1A1RA 3C27B 3PTBA 1GHVH 1C4U2 2PUXB 3BTWE 2J2UA 4IBLH 1LHFH 1ZMNA 1O3OA 3LT3A 2ZC9H 1LKBA 2OUAA 1Y3UA 1UJ1A 2FOEA 1S0QA 5HGGA 2DE8A 1SSXA 2W3IA 1C2HA 3GY6A 3SU6A 3MNCA 3U69H 1K21H 3A8CA 1SGIB 3UQVA 1XKAC 1C5XB 2I6QA 4ABEA 3RXUA 3ZZBA 2C8XB 1CT2E 1MKXK 2B8OH 3Q3KA 3RU4T 1K22H 1UVSH 1H9LB 2QYIA 2VIQA 3I77A 4YLUA 1SLXB 4ASUD 1NU9A 3ZZ3A 1V2LT 1RIWC 3UAIC 1HIAB 1SQRA 3BTKE 2WV4A 1IQHA 2GCHF 1K28D 3SU4A 1TX6A 1TQ7B 3M5OA 1G3BA 1N1LA 3KQBA 1A2CH 1Z7KA 1SHYA 3TVJB 3ENSB 3LGVA 1O2SA 4ZKRU 3M35A 1FZZA 2A2XH 1A5GH 1P01A 2ZGJA 6LPRA 1L0ZA 1A0LA 3DHKH 1C9PA 1IQFA 1P2QA 1TGNA 3DFJA 4X6OA 2VIPA 1JRSA 1P2NA 1GJ8B 1AD8H 1P3CA 3OSYA 2QXJA 3MU8A 1DX5M 3UTUH 2SNVA 3MHWU 1TOCB 3HKIB 1Y8TA 1CVWH 3M7UA 3QLPH 1H4WA 4F4OC 3GCOA 4BAHB 3K9XB 3PV2A 4KKDA 2G5VA 5DPAA 2P3FH 1A0JA 5DP7A 3A85A 4OGYA 3MMGA 1GBEA 3SJIA 1CBWC 2JH6D 2A0QB 3LGUA 3SBKA 2V3MA 1CGHA 4K69A 3ZZ9A 1BTZA 1YKTA 1E1RD 3UWJH 4E06H 2GX4A 2W3KA 5KECA 1K1PA 2HNTE 3PRDA 5A0CA 4XFQA 3NUMA 3E1XB 5C1XA 4IMQA 2H9TH 5JB8S 5FBEA 1HV7A 1P8VC 2WPIS 1HPGA 4JYUH 1C1QA 5FAHA 1MD7A 1TONA 1UK4A 3CENA 5E2OA 4I8GA 1SQAA 4HI3A 2QF0A 1KXFA 1OYQA 2FX4A 4FOUC 2O8UA 2XYAA 2RDLA 1PQ8A 4TWYA 1NFYA 1HGTH 2GKVE 3SV7A 4F55A 4O97A 2VJ1A 1TA6A 3EAJA 1C1NA 1O2UA 1W14U 4BANB 2O8TA 1UMAH 4NWLA 2HVYB 3SU5A 7ESTE 1FY3A 4AYYB 4FU8A 2ZI2H 4Z0KA 5T1VA 2K0QA 2BX3A 1GBDA 1EXFA 1P10A 2C4FH 2ZU4A 3GCTG 3PRBA 2V7QD 2OP9A 1WQSA 1DWCH 3F9HA 3P95A 1OHHD 4MDSA 4ESTE 1O32A 3R3GB 1HIAA 1NN6A 1GI4A 3RXCA 1E1QD 1HAYB 2R3YA 3U8OH 8GCHG 1H8HD 3S7HB 3CP7A 1SHHB 3S0NA 1ELEE 5F8XA 1E0FD 1JWTA 2GJGA 3ODFA 3AK5A 3OEHD 3U1JB 1SFQB 2JETB 3GS9A 1DWDH 2AGGX 4BTUB 1OXGA 4FUFA 1BMMH 3ZIAD 5C1YA 3T2NA 3ZVCA 1UCYK 3UNQA 1LCYA 2BHGA 5AHGH 2KZ4A 1XKBC 2QY0B 5EIYA 3LC5A 1MTNB 4CRGA 4SGAE 1TWXB 1GDNA 4OGXA 3N7EA 2KCPA 3SU1A 1GJDB 4ABBA 1Y3VA 5A8YA 1X7AC 1TPPA 1ELVA 1A61H 3VB7A 2FOAA 1RGQA 2ODPA 3OTPA 1NRQH 1T8MA 2BZ6H 1PQAA 2OC0A 3TNTA 5PTPA 2PP6A 1VITG 1FIZA 1Z1JA 2P8OC 1UTKA 2EQNA 3A8BA 4AFSA 4CR5A 3KEEA 3NWUA 1QQ4A 2L6OA 2XBWA 1DFPA 2AMDA 4MG3A 4SGBE 4TT3D 3A7WA 3ZVBA 4X2YA 1FJSA 4IN2A 3M5NA 3ZZ4A 2ZP0H 2GGVB 1HXEH 3SQHE 1SOZA 4KTSA 3MH7A 4A6LA 2O9QA 4ACAA 2C90B 1LKAA 5GDSH 3V7TA 1TNKA 4YO9A 1AB9B 1YPGH 1FN8A 1O2VA 1B5GH 3PWBA 2YMSD 1RIWB 4XOJA 1KTSB 3ZZAA 3AW0A 1DT2A 3RXGA 4NA8A 2QGRA 1LMWB 3MOCA 3V12A 1MKWH 1UHBA 3KQCA 4RKJB 1E35B 4GCHF 5F8ZA 4BTIB 4CHAB 2PGQB 5A0AE 3QDZB 3AVZA 1NESE 1S82A 3H7OA 4FU7A 3WW7A 1S5SA 2ZQ2A 1UK2A 1FPCH 1IQGA 3F9FA 3FP7E 3BTGE 1PYTC 5DSFA 3BTDE 1C5ZB 4XBBA 1IAUA 4Z1MD 1NFWA 2UUJB 4WMFA 3H09A 1OPHB 5DP3A 1KXDA 1Y5UT 2XW9A 1Y3XA 4B74A 5C0UA 1TABE 1W8BH 4IW4E 4FUJA 4Y0YE 1C2LA 2IPHA 2H5CA 4UFFH 2GDDA 1G32B 4ABAA 3ZZ6A 1BRUP 1KLIH 3MU4A 2QF5A 1B0EA 3OY5U 1O2JA 4FUDA 2H9EH 1IQIA 1AE5A 1C2IA 3KF2A 4CH8B 1MKWK 1V2ST 2QAAA 2UWOA 4ZKNU 3KIDU 1TRNA 2BXTH 1MCTA 1C2GA 4BAMB 3KL6A 3SV9A 3BG8A 3ZZCA 2NU3E 1COWD 1QL9A 1QJ6B 3SYJA 5ESTE 4OS7A 6GCHG 2GV6A 3SJ9A 3RXEA 2WPDD 4NCYA 1GG6C 3A89A 4AG1A 1WXRA 2EI6A 1O34A 1UO6A 1AIXH 2RG3A 4B1TA 3QO6A 3PTNA 4AFQA 2GP9B 4U32A 4U30A 1DPOA 3GY5A 4DVAU 3H7TA 1XVOA 5C5NA 4J1YA 3TJVA 1C1UH 3LKWA 3RMNH 4K5ZA 2BLWA 2PSXA 1KDQB 2VWLA 1ZGIA 4MNVA 4MTBA 1O2HA 4Q4LA 4XRNA 5DK1A 1O31A 3BTHE 2VGCB 2GZ7A 2RFKC 5LPEA 3KN2A 1UVUH 1W0JD 4WJG2 1H8IH 2IPQX 3IITA 1UTNA 3M5MA 1A0HB 1LQDB 3F2GA 1Y5AT 4HG6A 4H6TA 4NWKA 2QF4A 3LC3A 3RMOH 1J9CH 5DN6D 3BIVH 1SVPA 2Z3EA 3NKKA 1A5IA 1ANCA 1K2I1 1QCPA 1FY1A 1HDTH 3A7VA 3RC4A 3ELAH 1Y5BT 3P6ZB 1SGPE 2ZCLP 2WZQA 2SGQE 1EFRD 1GJ6A 1ARCA 3KQEA 2PTNA 1DWBH 4ISOA 5FHTA 3SJKA 4A5TS 2BY7X 1CHOG 2GT8A 1V2VT 2UUFB 1FDPA 1SGDE 1FY5A 2G4UA 3MWIU 1ZPBA 2XNDD 4JZFH 4CR9A 1J8AA 5HM9A 1ETSH 3C1KA 1CBWB 2FWWA 1BQYA 1AVGH 2STBE 4X8UH 5I25A 4YOIA 1ESTA 5JBCS 2WPLS 1FAXA 3F2FA 4DGJA 1TRMA 2F4LA 3E0PB 4NIVA 3KCGH 1O2YA 3F9EA 3A7YA 3SHCH 5C1UA 3TH4H 3V13A 3LJOA 1UTPA 1L4DA 1SI5H 4BAQB 2VIDA 3MU5A 1QQUA 1TALA 3MH5A 3B23B 4D76A 2C8WB 2SGEE 4NFFA 1GBAA 1NBME 1YWUA 1D3DB 5HYOA 1EKBB 3TJUA 3NZIA 2CHAB 2GZ8A 1QRZA 2AMQA 4NSYA 1L1JA 3MH6A 2ZNKH 1ANEA 1TOMH 4K3JA 1W0YH 3KYGA 3UR6A 1GI2A 3ATKA 2A7HA 1QA0A 3TK6A 1EB2A 3F3BA 2HWLB 5GCHF 3SNBA 3S9BA 1ELCA 2PTCE 2VH0A 2EI8A 2F9UA 2KAIB 1IHTH 3T25A 2H6MA 5KEDA 2K8IA 1BBRK 1BTUA 3VGCB 4B6FA 1K1OA 1O35A 1EZXC 2PR3A 2VWMA 1MBQA 5AFYH 1GBLA 5A2MH 3SQEE 1F5LA 1GI0A 2HLDD 1CE5A 3TK9A 3F6UH 1LDTT 1P2MA 4ZXXH 5ESBA 2A7CA 2BDYA 4I31A 5FX5A 5T6GA 2H1UA 2BDIA 1EOLA 1UW7A 2HLCA 4ASHA 1MU6B 4BTTB 3IWMA 5IDKA 2G51A 3O8RA 1WYKA 1OX1A 5CDFE 4UFDH 4TPIZ 4AX9H 1TGSZ 2OC7A 3K2UA 1BJVA 4GHTA 3PWCA 2KCAA 1JXPA 1MCVA 4B2AA 1CA0B 2ZHQH 4MVNA 4I7YH 2P8OB 1T31A 1EPTB 1NZQH 2WUCA 1T7CA 4Z6AH 1QBVH 3LGYA 1RTFB 4Q2KA 5G4BA 2VGCC 5L2YH 1Z71A 2B0FA 4DG4A 1O2GH 1ABIH 1V2PT 1O3AA 1BOQA 1FX0B 1ZSJA 2FLBH 3A84A 3FP8E 4JK6A 4X8SH 2UUYA 2UUKB 4K1EA 4CRAA 3SO3A 3PROA 2XCNA 2QCYA 4I33A 2ZKSA 2FOCA 2QF3A 5F6MA 2Y81A 3HPTB 1SQOA 1MKXH 3OU0A 3JZ1B 1GBFA 5JB9S 1C5UA 1HJ8A 4MNXA 1TX8A 3TITA 3ZVGA 1LTOA 1DANH 4XBCA 1BDAA 4YOJA 1AMHA 3RXHA 2OC8A 1D3QB 1PJPA 1ESBA 3P8NA 1EP6A 1V2RT 2TIOA 1S85A 1BMAA 1V6DA 3P8OA 1WTGH 2A4QA 3GDSA 5HM2A 1GMHG 2A4OA 1S81A 5GWZA 1ZGVA 3PMHB 3VB4A 4NZQA 5AFZH 2Z7FE 5E0GA 2FOMB 1BTWA 4UD9H 1RTKA 3BN9A 2VU8E 3HK6B 2F9PA 1L2EA 2P3UB 1GVLA 1O3MA 2BZAA 1YF4A 4YLQH 2JH5D 3BEUA 1EP5A 3ZVAA 3TGIE 2G55A 3FFGA 4TYDA 1W0ZU 4A7IB 1CO7E 1THRH 3K65B 5DGJA 1ELDE 8LPRA 2ZDNA 2AEIH 4DW2U 1C5WB 1NY22 2QA9E 4TY7A 4WXIA 3WWBA 3MO9A 4O03A 4NIWA 1O2IA 1PPEE 2G8TA 4X2XA 3RXRA 3PMAB 4B76A 1EOJA 1DSUA 1GDQA 1VCPA 4Y0ZE 3BTTE 3VEQB 4WVPE 2ZTXA 3M7TA 3P8FA 2Z3CA 4MPWA 1GHWH 2ZDAH 2J34A 4CH2B 3BG4C 2KCOA 1WUNH 2ZPSA 1TAWA 2BOKA 1EASA 1TB6H 2XBYA 4Y7AA 4GPGA 1GJ4H 4RI0A 4B75A 1SGFA 1EJMA 9LPRA 1LHDH 2BQ7B 2L74A 1OP8A 4AGJA 1O2ZA 6GCHF 1C4V2 2GCTB 3VG8A 3SUDA 1E38B 1GCDA 2WPMS 4IGDA 1O3JA 2ZCHP 3E6PH 3E91A 1JIRA 6CHAC 5IYTA 1ETRH 1DY8A 2NU2E 4YT7H 1S83A 2DE9A 3L3TA 1AZ8A 2PGBB 4FUBA 5DP4A 3RXQA 1O0DH 1BCUH 2ZDMA 4JK5A 1MTNC 3EE7A 2VIWA 1YPKH 8KME2 1Z1IA 2ZIQH 1C1MA 1BTHH 2XBVA 3M3TA 3EYDA 2BD9A 4H4FA 1ORFA 1KMHB 1EAXA 3MU1A 4HZHA 3LDXH 1AUJA 2RDEA 1V2TT 4ZHMU 2F91A 5C67A 1OS8A 1W11U 2QC2A 2C8YB 4FUIA 2ODQA 2YMSB 1GHXH 1WOFA 1EPTC 1K1NA 4GVUA 2G4TA 2AMPA 2NWNA 1AFQB 1RTLA 2OBOA 1O30A 1B0FA 1C1OA 2RA0A 3BTEE 3OX7U 1AFQC 4E7RG 2QE7D 4Y76A 2SGAA 1GHAG 1SGEE 1E34B 1QHRB 3W95A 2J4IA 1W7XH 5JBBS 3RXTA 1UTLM 4X1PU 3ZVFA 4YZUA 1VITH 1UCYE 1RD3B 4R0IA 4ZHAA 1KXEA 3RMMH 3RXJA 4D7FA 1KDQA 1G3CA 5EG4A 5L6NH 3VPKA 1ACBE 3LPRA 1TRYA 4K8YA 1TLDA 2BOHB 2ZQ1A 3E90B 1SBWA 1PPHE 4H42U 3F1SB 4JZIA 3FOAA 5GXPA 1E36B 1GI8B 4K2YA 2FI3E 3MYWA 1F0TA 2PHBA 2F3CE 2JJ2D 2D26C 4Q80A 1UVTH 2CXVA 1H8DH 3E8LA 2XC5A 3EA7A 1E37B 4I8JA 5CE1A 1SGTA 2YNBA 4AG2A 1YBWA 5EQRA 1P04A 2P16A 1EUFA 5JPMH 1TNHA 3M37A 1PPCE 2NU0E 1SLUB 2FOFA 3TLOA 5J4QA 1BB0B 1V2KT 2BLOA 2XRCA 4UONA 1Z8RA 3UREA 4B73A 3Q3YA 1P9UA 3GY4A 8ESTE 3U8RH 1NTPA 4OM9A 2QXGA 2Z3DA 1MUEB 3GCHB 1OWJA 5EGMA 3VB5A 2J94A 4ISIH 1HJAB 2HNTC 1VCWA 4LZ1H 4Y8XA 1K1JA 2BTCE 3SUFA 1O38A 3UWIA 1CHOF 3P70B 3LONA 3FP6E 1HBTH 2ZHFH 5DKMA 1AB9C 3M5LA 1O5FH 4ABIA 1YGCH 1ZYOA 1M9UA 2KFWA 3SV8A 3SZEA 1TYNA 4MQAA 1QFKH 3Q3XA 3GYMA 2AIQA 1THSH 4JMYA 2EI7A 3ZVEA 1DLEA 1CHGA 1OP0A 4MPUA 4WMEA 2SGFE 1O3NA 3ATLA 1QY6A 5GPIB 5FX6A 1J16A 4AORA 3F2HA 1XUFA 1O3FA 3EA8A 1GJ9B 1N6YA 4DCDA 1WBGB 2PLXA 2BVXH 2QXIA 5GNDA 1CT0E 1ZHRA 3LU9B 2R9PA 2FDAA 4D7GA 2Y7ZA 4BXSA 2Y5GA 3QTOH 1THPB 2PSYA 2VINA 2STAE 5GJ4B 2NU1E 2BDAA 3LIWA 5A8XA 1O2WA 1WDIA 3CS0A 1HXFH 2FESH 1GJ7B 2AIPA 4Y71A 1GGDC 1KLJH 2WPJS 2A4RA 3SUGA 3WWFA 7GCHF 4INLA 1ARBA 4JZDH 1Z6EA 1VKYA 5K7RA 3H5CB 4X6MA 2OD3B 5HIZA 1AUTC 2R2WU 2ZF0H 3KQ5A 3UPEA 1DE7H 1VCQA 1FQ3A 4Y8ZA 2YOLA 1GBTA 4ZKSU 5EJ1A 3AAVA 2W26A 1HJAC 4I86A 3L6PA 1C5SA 4Q7YA 3RXPA 2CV3A 2A5AA 2F9NA 2TGAA 4FXGH 3OY6U 4CRFA 4UDWH 2M5TA 3M7QA 4IN1A 1Q31A 4ABDA 2GVFA 5C94A 3RXVA 1HAPH 1ZOMA 1P09A 4ABFA 4ZXYH 3HGNA 1C5YB 3A81A 4ZHLU 1QURH 3GOVB 3F9GA 1YM0A 7GCHG 2OLGA 1GMDF 3LH3A 1O39A 1O5CB 5T6FA 1D9IA 1ZMLA 4DY7B 4ZUHA 4AFZA 4AN7A 4WH8A 2ZG0H 5A09A 1NS3A 4FUHA 5CHAC 1BHXF 3ZV8A 3ZV9A 3LOXA 1NU7B 1GG6B 2WYJA 2HOBA 2FS9A 1FI8A 1GMDG 1QBNA 5EJLA 1FV9A 1TNGA 5GIBA 4BAKB 1OWDA 2J38A 1OWIA 2IN2A 1PPGE 2H5DA 5EJZA 4ISHH 1KLTA 3QX5H 1D3TB 4K60A 2AGIX 1W13U 4Y11E 1DVAH 2H2ZA 3SZNA 4INHA 2A31A 2WV9A 1HYLA 1IQEA 1C5OH 1XUGA 3MFJA 3P92A 4AOQA 5SGAE 2JETC 2VH6A 3RC5A 1XMNB 4YTAA 1TFXA 1ANDA 1FXYA 3QGJA 3TJOA 3TU7H 2JH0D 2W6ID 1YPLH 1SGYE 1SKYE 2GT7A 3GCHC 1J17T 2Y7XA 3GCNA 2ULLA 1LQEA 5C17A 1C1RA 3VFEA 2P94A 2ANMH 2ZHWH 4RKOB 1C2KA 3RM0H 1QIXB 2HGTH 4LOYH 2CN0H 2LELA 2PKAA 1O3KA 4RT1A 1AE8H 1XVMA 4X2VA 1ZPZA 2J97A 2ZEBA 1N8OB 2PWXA 1QB9A 5DP8A 2FP7B 1GDUA 3PV5A 1NO9H 1AWFH 2C3SA 1DOJA 2JKHA 1KXAA 4J2YB 3GICB 1OP2A 1GCTB 1RJXB 5A0BA 1WQVH 2ODYB 2G00A 2BD5A 1O33A 2BX4A 1EZQA 5EXLA 3DA9B 2W6JD 1ZJDA 1RXPA 2PUQH 1HAGE 5E0JA 1SFIA 3A7XA 2CJIA 1MQ5A 2ALVA 3SI4H 3ATWA 3SV2H 3UOPA 2BDHA 3EGKH 4NIXA 1C1SA 4CBNA 1FY4A 1YYY1 4LXBH 1VJAU 4RN6A 3NK8A 2ZFTA 3U8TH 1GHAF 1Y59T 1MTVA 3RMLH 1T8NA 4I8HA 3MQKC 1NRPH 1LHGH 4NG9H 1GL0E 2PKSC 2ZHDA 2TGDA 3T29A 4H6SB 4X1RU 5E0HA 2F9BH 2BDCA 2R0LA 1C2EA 2CGAA 4KGAA 3SUEA 1QA7A 2KM0A 3A8DA 4M9FA 3TGKE 3A8AA 4HFPB 2I6SA 2ZDLA 1BMFD 3L33A 3MNBA 1NPMA 3URDA 1ELFA 2BD3A 3FANA 1S84A 3Q00A 1C5NH 1O2NA 1WU1A 2NU4E 3OYPA 1CU1A 1XM1A 2Z9GA 3DCLA 1MU8B 1YCPM 1DDJA 1F0UA 1MTSA 2F83A 3OTJE 1YPEH 5EOKA 5EPNA 2F43B 4OS4A 1ZSLA 2WPKS 1C5PA 1AI8H 4B71A 2FI5E 1NRRH 2FPZA 2ZU1A 1GBBA 1XXDA 2A32A 1FONA 1AVWA 5E2PA 4XE4A 1C5TA 3M3VA 1NROH 1FMGA 2VNTA 1A3BH 1J15A 4NFEA 2AS9A 2FIRH 5DP6A 3PLPA 1LO6A 1CT4E 1VGCC 1BTPA 1MMJN 4K1SA 1GJAB 2LNCA 1QGFA 3SHAH 2PKAB 1MZAA 1YLNA 2D2DA 3TJNA 4MLFB 2AYWA 1C1WH 1D3PB 3W1EA 1P3EA 4THNH 5T6DA 1BRBE 1TQ0B 3DUXH 2CMYA 4RT0A 1QB1A 2V6NA 1IQNA 2V35A 1BBRE 4KELA 1UTQA 2TRMA 6CHAB 5ABWA 1C2MA 1BA8B 2WV5A 4MNWA 1MBMA 1F0SA 3F68H 4JCNA 1O2KA 2JDID 4B2BA 5JDUB 1DXWA 2ZO3H 5B6LA 2FO9A 1HB0B 1SGRE 2OC1A 1KTTB 3VB3A 1FY8E 3SNDA 1GGDB 1LVMA 5FBIA 2OQUA 2GDEH 4YOGA 1YPMH 1O36A 2IJD1 3SU2A 1ZHPA 1CA0C 4O3UA 2A1DB 1A7SA 2ZFSA 4UFGH 1TA2A 3RDZA 3GY8A 3CS7A 2GZ9A 5DP9A 1A5HA 3LGWA 2A45B 2ZZUH 2FMJA 2RCEA 1IQJA 2XWAA 2J98A 2WINI 4FUEA 4A1VA 1BUIA 2FOHA 3SU0A 4NSVA 1GJ5H 2AERH 1ELAA 3FZDA 3STIA 2BQ6B 4BOHA 1TX7A 3M3SA 4DT7B 1QB6A 4IMZA 1FUJA 1OSSA 3ATIA 1NRSH 1W2KH 1P12E 1AVXA 4YXWD 3U28C 4TPYA 1BMNH 2SFAA 1GBCA 5HXFA 3PYHA 1V2JT 4CRBA 4DURA 4X1SU 3EE0B 1QL8A 2GD4B 3RLYH 3DFLA 1Z8IB 3OFND 4NA9H 2AHME 1DUEA 1XUJA 2BYAX 2PW8H 5JBTA 5DO4H 4Y79A 3RM2H 1J14A 1P03A 1P57B 3G01A 5K0HA 1D6RA 5TCAA 3S69A 1MZDA 3GYLB 4IC6A 2Z9LA 3BTQE 2ZFQH 1EAIA 1P2OA 3BEFB 2Z94A 1O2LA 1SB1H 4LZ4B 1DITH 1TMTH 4OS1A 4I8LA 1QRXA 1TNIA 1ZRBA 2BQWB 3A86A 1DS2E 2ZHEH 4ZKOU 3SNCA 3HGPA 1P05A 1QTFA 1ZTLA 2VWOA 2FI4E 4X0WU 2ANYA 1ZPCA 2BY9X 1NRNH 5EXMA 4IS5A 2R2MB 3UY9A 1MQ6A 4ISLA 3LGIA 4AC9A 1TGBA 1W7GH 4WY3A 3CNRA 2HVXA 5FCKA 1SC8U 5C2ZA 4F48B 1NC6A 2WSSD 4JYTA 1GBIA 3F0OA 1CGIE 1K1IA 3PB1E 3MU0A 4E7NA 2FS8A 3RXMA 5TJXA 4TY6A 4X8VH 3FN8A 5C20A 1S0RA 3TH2H 2Y82A 4FU9A 1XUHA 1BT7A 3PLKA 4O3TA 4DIIH 1SQTA 3GDVA 3UR9A 3EDXB 1KXCA 2CHAC 3LH1A 1JMOH 1CQQA 4ZH8A 1G36A 2XTTB 2SNWA 1LPKB 3KGPA 3QZRA 2B9LA 1HRTH 1L1GA 4INKA 3GCTF 2ZECA 1PQ7A 3KNXA 2C93B 1G9IE 2ANKH 1T4VH 2GMTC 5T3HA 1IQLA 1HAOH 3PMJA 2HPQH 3FAOA 1HAVA 4U2WA 1MD8A 1UTMA 2BLQA 3K6YA 5DJ7A 3O8BA 2V0BA 1BJUA 4ZAEA 5L2ZH 1EB1H 2P59A 1C5RA 2FXRA 2K1QA 1YY3A 2WHXA 2Y5HA 1K1LA 5EPYA 1O3GA 1TE0A 1TGCA 5AF9H 2XCFA 1QL7A 5FXLA 3T5FH 1NBMD 5E8EH 3BSQA 3V3MA 3VGCC 2XC4A 1C5VA 4TSFD 3UIRA 1O3CA 1YLDA 2BDBA 2A4GA 1DY9A 3A82A 2W5EA 4CBOA 1O2OA 4KP0A 3UB0A 1IOEA 1P0SH 1EAWA 1N6XA 3QGNB 1EZUC 3ZZ5A 1W0KD 2HNTF 1PPFE 1TPOA 2ESTE 1A46H 4BNRA 4CRDA 3I78A 3M61U 4KTUA 1H1BA 1AO5A 1AWHB 2BM2A 1OWEA 2F9OA 3ESTA 4JYVH 3KQDA 3NRLA 1GBMA 1S6LA 1GPZA 1P11E 4KTCA 1HJ9A 1ELBA 1QJ1B 1W10U 3QUMP 4LK4A 1CGJE 3PO1C 3STJA 1ESAA 2VIOA 1S6FA 3PO1B 2EY4C 1KYNA 3OAAD 3Q77A 3T27A 2OINA 1C5QA 1Q2WA 1MH0A 1C1TA 2J92A 3E3TA 1P2KA 2BXUH 2XC0A 1VJ9U 2G52A 2KCYA 2PFEA 2Z6BD 3S9CA 2XNIA 2WYGA 4DOQA 3AASA 2B5TB 5CHBA 4ZCNA 3GISB 1V2OT 2OTVA 1O3LA 2ZPRA 1WSSH 5CHAB 2QN5T 4ACBA 2FEQH 1EZSC 1GI7B 3BG4B 3F0PA 3MI4A 4OS2A 4AFUA 2ILNA 1TGTA 2TBSA 6ESTA 4X6NA 1GVZA 2FOBA 3RXFA 1EX3A 4RSPA 1O5AB 3PM3A 5EQQA 1EJNA 1BRCE 1TBRH 4MNYA 2BB4A 2D1JA 5AVDA 1Z8GA 2Z9KA 4A1XA 1L4ZA 1RS0A 4YESB 1GMCF 3PV4A 1L1NA 2IOTA 1INCA 1PFXC 1CA8B 1LPGB 1FAKH 2BY6X 1GHBF 3R0FA 4X1QU 3A88A 3RXSA 1YLCA 4TWWA 3FO8D 2VVUA 3KHVA 1YC0A 1C2JA 3BF6H 3SNEA 1VR1H 4ZROA 3AW1A 2ZU3A 2BD2A 1UVPA 4FVDA 2OXSA 1BTXA 4F49A 1V2QT 1O3HA 1GMHF 3KYFA 1GJBB 5H4IB 4PROA 1HAZB 1RRKA 3T26A 2V3HH 3SW2B 3ZZDA 5EQSA 2ZFPH 1O3EA 1SGNE 2XXLA 1PPZA 1BZXE 1O2MA 1V2WT 1GWAA 1MAXA 1ETTH 3RU4D 3AAUA 2OCVB 1DXPA 5FCRA 4XBDA 2ZU2A 5CMXH 3SGAE 1EATA 2FTMA 2TPIZ 1LHEH 4WWYA 3SI3H 4XSKU 4Y8YA 4DT4A 3OE7D 2W7UA 1ANBA 2ZGHA 1AY6H 3UNRA 3SORA 2ZDVH 4B6EA 2BY5X 1AKSB 1LVOA 3EQ0H 4XDEA 1A4WH 2RA3A 5FPYA 2Y6TA 1NFXA 2LPRA 3BTFE 1KXBA 1UK3A 1SGQE 3VXFH 2C8ZB 3LJJA 2Z9IA 1FIWA 4FUCA 3D62A 3O8CA 1O37A 2ZFFH 4GUXA 5L30H 4FETA 3QTVH 3VXEH 1O5DH 3W94A 4WF8A 5FPSA 1GI6A 1HNEE 1V2UT 2GMTB 1VITF 1KIGH 2ZGBH 3E16B 1G37A 4MPXA 3RXKA 2ALPA 1H9IE 1AU8A 1Y3WA 2GTBA 2THFB 3DD2H 1YCPH 1IQMA 3ITIA 1K1MA 4X6PA 3SU3A 4AGKA 4WMDA 1EJAA 1O5BB 2D8WA 3MH4A 2TGPZ 5F03A 2Q6DA 1FPHH 4D9QA 2P3TB 3TPIZ 2J9NA 4CREA 4A1TA 1LHCH 3U98H 2ZPQA 3B8JA 1W3CA 5JBAS 1JRTA 2CK3D 3GY2A 3WY8A 2AFQB 1D4PB 1HAIH 2PV9B 3IG6B 2A7JA 4Y7BA 4UE7H 1F92A 4ABHA 1BITA 2BD7A 1GI3A 2KR7A 3GY7A 3U9AH 1WCZA 2HPPH 3Q76A 5JYIA 1JOUB 3RXIA 5C0TA 1N8OC 2EEKA 3EA9A 1C5MD 8GCHF 1F0RA 2Y5FA 4Q7XA 5BPEA 3T28A 1ZR0A 1BBRH 1TBQH 1Z6JH 4A92A 1ZTKA 3ZZ8A 2QIQA 1LVBA 2P95A 1H9HE 1AN1E 2V3OH 1EQ9A 1C4Y2 2F9VA 1JIMA 1GHBG 3UQOA 1SL3A 4DIHH 2JJ1D 4HGCA 3S7KB 3FKSD 3SJOA 4ABJA 1O5GH 2BD4A 4WXVA 1P2JA 1P2IA 1SLWB 3RUOA 1DWEH 4U01A 1ID5H 5C5OA 2ZWLH 4GCHG 4Q63A 1AZZA 3FZZA 5DP5A 5IK2D 1C1PA 3HKJB 4NIYA 2EC9H 1XX9A 1YP9A 4YM9A 4X8TH 2O8MA 5EW2H 2QV1A 1SGFG 1AFEH 1ZSKA 3URCA 3DSGA 1TNLA 5KGOA 1XUIA 2ZFRH 2GV7A 5C3NA 1TPSA 3N7DA 3RXAA 1GBKA 4D9RA 1T8OA 4X2WA 4XD7D 1GBJA 1YPHC 2FM2A 2FODA 4Q7ZA 2SGPE 1ZMJA 1S6HA 3GDUA 1MTWA 3ZVDA 1SPJA 1O3DA 1V2MT 1HCGA 2SGDE 1G3EA 3D49H 2VBCA 4D8NA 1NM6A 2CF9H 3RXOA 3N7OA 1F2SE 1G2LA 1XXFA 3SJ8A 4HTCH 1MAYA 1VZQH 2QXHA 2UWLA 2Y80A 1F5RA 2KAIA 4P02A 3U1IB 5LGOA 3FVFB 1HAHH 2JIZD 4NGAH 2YMSC 1QR3E 4GHQA 5HKKD 2A5IA 1LVYA 5A8ZA 1HAVB 1T8LA 2OK5A 4CHAC 1GMCG 3A83A 2Q6GA 1ZJKA 3QZQA 2FZZA 1QNJA 3MTYA 1DLKB 3PLBA 4AB8A 1AGJA 4Y6DA 1GHYH 1DICA 4P00A 1ZZZA 2VWNA 3BEIB 2G81E 5I46H 2XWBI 3NCLA 2XBXA 2ZGXH 4VGCC 2O8LA 1PYTD 2AGEX 1G3DA 3B9FH 3SOSA 3ZYEA 5ETXA 2J95A 1SOTA 1C2FA 2Q1JA 2FYQA 2WPHS 3GY3A 4YT6H 1BHXB 1OYTH 2TGTA 2ZTYA 1DSTA 4GSOA 3D23A 4NA7A 3ATMA 2FX6A 2VB0A 1GJCB 1ELTA 3A7TA 4O9VA 1K0HA 2AH4X 3PMBB 3BTME 1OWKA 1FLEE 2R0KA 2R3UA 2J5UA 4BAOB 2A5KA 1UCYH 5J4SA 1Z8JB 2HRVA 1A3EH 2B7DH 3LGTA 1IQKA 3SGBE 1SMFE 4I32A 3ZZ7A 4DJZB 2ANWA 4M7GA 3RXLA 7KMEH 5EU8A 2WUBA 1PQ5A 1TPAE 3A80A 1ZTJA 2BMGB 2GCHG 1IHSH 3A7ZA 1C2DA 2KX4A 4IC5A 3UOUA 1P9SA 2FTLE 1DM4B 2P93A 4UEHH 3ZYDA 1EPTA 1UTOA 4AB9A 5F53A 1O2RA 1OWHA 1P02A 3MNSA 1OKXA 1BRAA 1Q3XA 1GHZA 3QK1A 4OS6A 2ZA5A 3I29A 1FNIA 1ZHMA 1ZRKA 2BDGA 5HMAA 3O8DA 3JZ2B 2Q6FA 2ASUB 1AHTH 3MNXA 1HAXB 5DG6A 9ESTA 2W7SA 3TIUA 1G30B 3RC6A 5EXNA 5FPTA 4E05H 4K1TA 1O2TA 7LPRA 1GL1A 4Y10E 1KY9A 2CF8H 2EA3A 4AZ2B 4JZ1A 1W12U 1TBZH 2UWPA 2ZGCA 1MTUA 1XUKA 2M2AA 3SN8A 3TNSA 3VB6A 1ELGA 5BRRE 3UNSA 1WAYB 1V2NT 5GCHG 1KSNA 1BMLA 1F7ZA 2FLRH 1QRWA 1GBHA 1UVOA 5LH8A 2Z9JA 5B6OA 2VIVA 2J98B 2ZTZA 3HATH 1O3IA 1SLVB 4I8KA 1G2MA 3M36A 1TNJA 4B2CA 1FN6A 1T4UH 4QT8C 3UUZA 5LPRA 1TMUH 3D65E 3RLWH 1SR5C 1U6QA 3DSPA 1YPJH 2LP6A 1AKSA 1GI9B 1TMBH 1Y3YA 1AQ7A 2OBQA 1QJ7B 2YNAA 4ISNA 1SG8B 1QZ8A 1NT1A 1HFDA 1QBOA 1RFNA 2ZCKP 1TIOA 3A87A 5EODA 4X1NU 1C1VH 3T62A 3DT0H 1H8ED 1BIOA 2FYRA 2HALA 2PKSB 4ZMAH 3OEED 3P17H 3RXDA 1E79D 3RXBA 1PPBH 3SV6A 4GLYA 1O5EH 1EAUA 1WV7H 1D6WA 3MO6A 2BVRH 3QWCH 3ODDA 1MABB 1YPHE 3N99A 2BLVA 1UTJA 4NZLA 1DUAA 4GAWA 2DUCA 1GCTC 5HIYA 5FL7D 3BV9B 4UFEH 2A2QH 1CSOE 4CRCA 4AYVB 5LPFA 3RP2A 5F8TA 1UHBB 3TK5A 1C9TA 1HLTH 3E0NB 3SNAA 2XOKD 3K6ZA 1O2XA 3TGJE 3V0XA 1LPZB 2G5NA 4ABGA 4OS5A 2O8WA 2BY8X 1B7XB 1O2PA 1OOKB 4FVBA 4VGCB 2H9HA 2BVSH 1GI1A 2GCTC 3RU4E 3TH3H 1NFUA 3NPSA 1SGCA 4JZEH 1O3PB 1F5KU 4FUGA 2VVCA 1C5LH 5TCCA 1GVKB 4R8TB 2ZU5A 1P06A 4K8BA 1VGCB 1GI5A
chains in the Genus database with same CATH topology
5EW1H 2IJOB 3BIUH 1ABJH 3HK3B 2OQ5A 1BTYA 2VVVA 1WTHD 2FOGA 1YCPK 3UFAA 4MPVA 3SGQE 1V3XA 2BD8A 1K9OE 4BXWA 3MO3A 3NXPA 3QN7A 4WH6A 1T32A 1O2QA 2ZDKA 1HUTH 3P8GA 1O3BA 1ZLRA 1JBUH 3S9AA 1A1RA 3C27B 3PTBA 1GHVH 1C4U2 2PUXB 3BTWE 2J2UA 4IBLH 1LHFH 1ZMNA 1O3OA 3LT3A 2ZC9H 1LKBA 2OUAA 1Y3UA 1UJ1A 2FOEA 1S0QA 5HGGA 2DE8A 1SSXA 2W3IA 1C2HA 3GY6A 3SU6A 3MNCA 3U69H 1K21H 3A8CA 1SGIB 3UQVA 1XKAC 1C5XB 2I6QA 4ABEA 3RXUA 3ZZBA 2C8XB 1CT2E 1MKXK 2B8OH 3Q3KA 3RU4T 1K22H 1UVSH 1H9LB 2QYIA 2VIQA 3I77A 4YLUA 1SLXB 1NU9A 3ZZ3A 1V2LT 1RIWC 1HIAB 3BTKE 2WV4A 1IQHA 2GCHF 1K28D 3SU4A 1TX6A 1TQ7B 3M5OA 1G3BA 1N1LA 3KQBA 1A2CH 1Z7KA 1SHYA 3TVJB 3ENSB 3LGVA 1O2SA 4ZKRU 3M35A 1FZZA 2A2XH 1A5GH 1P01A 2ZGJA 6LPRA 1L0ZA 1A0LA 3DHKH 1C9PA 1IQFA 1P2QA 1TGNA 3DFJA 4X6OA 2VIPA 1JRSA 1P2NA 1GJ8B 1AD8H 1P3CA 3OSYA 2QXJA 3MU8A 1DX5M 3UTUH 2SNVA 3MHWU 1TOCB 3HKIB 1Y8TA 1CVWH 3M7UA 3QLPH 1H4WA 4F4OC 3GCOA 4BAHB 3K9XB 4KKDA 2G5VA 5DPAA 2P3FH 1A0JA 5DP7A 3A85A 4OGYA 3MMGA 1GBEA 3SJIA 1CBWC 2JH6D 2A0QB 3LGUA 3SBKA 1CGHA 4K69A 3ZZ9A 1BTZA 1YKTA 3UWJH 4E06H 2GX4A 2W3KA 1K1PA 2HNTE 5A0CA 4XFQA 3NUMA 3E1XB 5C1XA 4IMQA 2H9TH 5JB8S 5FBEA 1HV7A 1P8VC 2WPIS 1HPGA 4JYUH 1C1QA 5FAHA 1MD7A 1TONA 1UK4A 3CENA 5E2OA 4I8GA 1SQAA 4HI3A 2QF0A 1KXFA 1OYQA 2FX4A 2O8UA 2XYAA 2RDLA 1PQ8A 4TWYA 1NFYA 1HGTH 2GKVE 3SV7A 4O97A 2VJ1A 1TA6A 3EAJA 1C1NA 1O2UA 1W14U 4BANB 2O8TA 1UMAH 4NWLA 3SU5A 7ESTE 1FY3A 4AYYB 4FU8A 2ZI2H 4Z0KA 2BX3A 1GBDA 1EXFA 1P10A 2C4FH 2ZU4A 3GCTG 2OP9A 1WQSA 1DWCH 3F9HA 3P95A 4MDSA 4ESTE 1O32A 3R3GB 1HIAA 1NN6A 1GI4A 3RXCA 3U8OH 1HAYB 2R3YA 8GCHG 3S7HB 3CP7A 1SHHB 3S0NA 1ELEE 5F8XA 1E0FD 1JWTA 3ODFA 3U1JB 1SFQB 2JETB 1DWDH 2AGGX 4BTUB 1OXGA 4FUFA 1BMMH 5C1YA 3T2NA 3ZVCA 1UCYK 3UNQA 1LCYA 2BHGA 5AHGH 1XKBC 2QY0B 3LC5A 1MTNB 4CRGA 4SGAE 1TWXB 1GDNA 4OGXA 3SU1A 1GJDB 4ABBA 1Y3VA 5A8YA 1X7AC 1TPPA 1ELVA 1A61H 3VB7A 2FOAA 1RGQA 2ODPA 1NRQH 1T8MA 2BZ6H 1PQAA 2OC0A 3TNTA 5PTPA 1VITG 1FIZA 1Z1JA 2P8OC 1UTKA 3A8BA 4AFSA 4CR5A 3KEEA 3NWUA 1QQ4A 2XBWA 1DFPA 2AMDA 4MG3A 4SGBE 3A7WA 3ZVBA 4X2YA 1FJSA 4IN2A 3M5NA 3ZZ4A 2ZP0H 2GGVB 1HXEH 3SQHE 1SOZA 4KTSA 3MH7A 4A6LA 2O9QA 2C90B 1LKAA 5GDSH 3V7TA 1TNKA 4YO9A 1AB9B 1YPGH 1FN8A 1O2VA 1B5GH 3PWBA 1RIWB 4XOJA 1KTSB 3ZZAA 3AW0A 1DT2A 3RXGA 4NA8A 2QGRA 1LMWB 3MOCA 3V12A 1MKWH 1UHBA 3KQCA 4RKJB 1E35B 4GCHF 5F8ZA 4BTIB 4CHAB 2PGQB 5A0AE 3QDZB 3AVZA 1NESE 1S82A 3H7OA 4FU7A 1S5SA 2ZQ2A 1UK2A 1FPCH 1IQGA 3F9FA 3FP7E 3BTGE 1PYTC 3BTDE 1C5ZB 4XBBA 1IAUA 1NFWA 2UUJB 4WMFA 5DP3A 1OPHB 1KXDA 1Y5UT 2XW9A 1Y3XA 4B74A 1TABE 1W8BH 4IW4E 4FUJA 4Y0YE 1C2LA 2IPHA 2H5CA 4UFFH 2GDDA 1G32B 4ABAA 3ZZ6A 1BRUP 1KLIH 3MU4A 1B0EA 3OY5U 1O2JA 4FUDA 2H9EH 1IQIA 1AE5A 1C2IA 3KF2A 4CH8B 1MKWK 1V2ST 2QAAA 2UWOA 4ZKNU 3KIDU 1TRNA 2BXTH 1MCTA 1C2GA 4BAMB 3KL6A 3SV9A 3BG8A 3ZZCA 2NU3E 1QL9A 1QJ6B 5ESTE 4OS7A 6GCHG 2GV6A 3SJ9A 3RXEA 4NCYA 1GG6C 3A89A 4AG1A 2EI6A 1O34A 1UO6A 1AIXH 2RG3A 4B1TA 3QO6A 3PTNA 4AFQA 2GP9B 4U32A 4U30A 1DPOA 3GY5A 4DVAU 3H7TA 1XVOA 5C5NA 4J1YA 3TJVA 1C1UH 3LKWA 3RMNH 4K5ZA 2BLWA 2PSXA 1KDQB 2VWLA 1ZGIA 4MNVA 4MTBA 1O2HA 5DK1A 1O31A 3BTHE 2VGCB 2GZ7A 5LPEA 3KN2A 1UVUH 4WJG2 1H8IH 3IITA 1UTNA 3M5MA 1A0HB 1LQDB 1Y5AT 4H6TA 4NWKA 3LC3A 3RMOH 1J9CH 3BIVH 1SVPA 2Z3EA 3NKKA 1A5IA 1ANCA 1K2I1 1QCPA 1FY1A 1HDTH 3A7VA 3RC4A 3ELAH 1Y5BT 3P6ZB 1SGPE 2ZCLP 2SGQE 1GJ6A 1ARCA 3KQEA 2PTNA 1DWBH 4ISOA 5FHTA 3SJKA 4A5TS 2BY7X 1CHOG 2GT8A 1V2VT 2UUFB 1FDPA 1SGDE 1FY5A 2G4UA 3MWIU 1ZPBA 4JZFH 4CR9A 1J8AA 5HM9A 1ETSH 3C1KA 1CBWB 2FWWA 1BQYA 1AVGH 2STBE 4X8UH 5I25A 4YOIA 1ESTA 5JBCS 2WPLS 1FAXA 4DGJA 1TRMA 4NIVA 3E0PB 3KCGH 1O2YA 3F9EA 3A7YA 3SHCH 5C1UA 3TH4H 3V13A 3LJOA 1UTPA 1L4DA 1SI5H 4BAQB 2VIDA 3MU5A 1QQUA 1TALA 3MH5A 3B23B 4D76A 2C8WB 2SGEE 4NFFA 1GBAA 1D3DB 5HYOA 1EKBB 3TJUA 3NZIA 2CHAB 2GZ8A 1QRZA 2AMQA 4NSYA 1L1JA 3MH6A 2ZNKH 1ANEA 1TOMH 4K3JA 1W0YH 3UR6A 1GI2A 3ATKA 2A7HA 1QA0A 3TK6A 1EB2A 2HWLB 5GCHF 3SNBA 3S9BA 1ELCA 2PTCE 2VH0A 2EI8A 2F9UA 2KAIB 1IHTH 3T25A 2H6MA 1BBRK 1BTUA 3VGCB 1K1OA 1O35A 1EZXC 2PR3A 2VWMA 1MBQA 5AFYH 1GBLA 5A2MH 3SQEE 1F5LA 1GI0A 1CE5A 3TK9A 3F6UH 1LDTT 1P2MA 4ZXXH 5ESBA 2A7CA 2BDYA 4I31A 5FX5A 5T6GA 2H1UA 2BDIA 1EOLA 2HLCA 4ASHA 1MU6B 4BTTB 3IWMA 5IDKA 2G51A 3O8RA 1WYKA 1OX1A 4UFDH 4TPIZ 4AX9H 1TGSZ 2OC7A 3K2UA 1BJVA 4GHTA 3PWCA 1JXPA 1MCVA 4B2AA 1CA0B 2ZHQH 4MVNA 4I7YH 2P8OB 1T31A 1EPTB 1NZQH 2WUCA 1T7CA 4Z6AH 1QBVH 3LGYA 1RTFB 4Q2KA 5G4BA 2VGCC 5L2YH 1Z71A 2B0FA 4DG4A 1O2GH 1ABIH 1V2PT 1O3AA 1BOQA 1ZSJA 2FLBH 3A84A 3FP8E 4JK6A 4X8SH 2UUYA 2UUKB 4K1EA 4CRAA 3SO3A 3PROA 2XCNA 2QCYA 4I33A 2ZKSA 2FOCA 2QF3A 5F6MA 2Y81A 3HPTB 1SQOA 1MKXH 3OU0A 3JZ1B 1GBFA 5JB9S 1C5UA 1HJ8A 4MNXA 1TX8A 3TITA 3ZVGA 1LTOA 1DANH 4XBCA 1BDAA 4YOJA 1AMHA 3RXHA 2OC8A 1D3QB 1PJPA 1ESBA 3P8NA 1EP6A 1V2RT 2TIOA 1S85A 1BMAA 1V6DA 3P8OA 1WTGH 2A4QA 3GDSA 5HM2A 1GMHG 2A4OA 1S81A 5GWZA 1ZGVA 3PMHB 3VB4A 4NZQA 5AFZH 2Z7FE 5E0GA 2FOMB 1BTWA 4UD9H 1RTKA 3BN9A 2VU8E 3HK6B 2F9PA 1L2EA 2P3UB 1GVLA 1O3MA 2BZAA 1YF4A 4YLQH 2JH5D 3BEUA 1EP5A 3ZVAA 3TGIE 2G55A 3FFGA 4TYDA 1W0ZU 4A7IB 1CO7E 1THRH 3K65B 5DGJA 1ELDE 8LPRA 2ZDNA 2AEIH 4DW2U 1C5WB 1NY22 2QA9E 4TY7A 4WXIA 3MO9A 4O03A 4NIWA 1O2IA 1PPEE 2G8TA 4X2XA 3RXRA 3PMAB 4B76A 1EOJA 1DSUA 1GDQA 1VCPA 4Y0ZE 3BTTE 3VEQB 4WVPE 2ZTXA 3M7TA 3P8FA 2Z3CA 4MPWA 1GHWH 2ZDAH 2J34A 4CH2B 3BG4C 1WUNH 2ZPSA 1TAWA 2BOKA 1EASA 1TB6H 2XBYA 4Y7AA 4GPGA 1GJ4H 4B75A 1SGFA 1EJMA 9LPRA 1LHDH 2BQ7B 1OP8A 4AGJA 1O2ZA 6GCHF 1C4V2 2GCTB 3SUDA 1E38B 1GCDA 2WPMS 4IGDA 1O3JA 2ZCHP 3E6PH 3E91A 1JIRA 6CHAC 5IYTA 1ETRH 1DY8A 2NU2E 4YT7H 1S83A 2DE9A 3L3TA 1AZ8A 2PGBB 4FUBA 5DP4A 3RXQA 1O0DH 1BCUH 2ZDMA 4JK5A 1MTNC 2VIWA 1YPKH 8KME2 1Z1IA 2ZIQH 1C1MA 1BTHH 2XBVA 3M3TA 3EYDA 2BD9A 4H4FA 1ORFA 3MU1A 1EAXA 4HZHA 3LDXH 1AUJA 1V2TT 4ZHMU 2F91A 5C67A 1OS8A 1W11U 2QC2A 2C8YB 4FUIA 2ODQA 1GHXH 1WOFA 1EPTC 1K1NA 4GVUA 2G4TA 2AMPA 2NWNA 1AFQB 1RTLA 2OBOA 1O30A 1B0FA 1C1OA 2RA0A 3BTEE 3OX7U 1AFQC 4E7RG 4Y76A 2SGAA 1GHAG 1SGEE 1E34B 1QHRB 3W95A 2J4IA 1W7XH 5JBBS 3RXTA 1UTLM 4X1PU 3ZVFA 4YZUA 1VITH 1UCYE 1RD3B 4R0IA 4ZHAA 1KXEA 3RMMH 3RXJA 4D7FA 1KDQA 1G3CA 5EG4A 5L6NH 3VPKA 1ACBE 3LPRA 1TRYA 4K8YA 1TLDA 2BOHB 2ZQ1A 3E90B 1SBWA 1PPHE 4H42U 3F1SB 4JZIA 5GXPA 1E36B 1GI8B 4K2YA 2FI3E 3MYWA 1F0TA 2PHBA 2F3CE 2D26C 4Q80A 1UVTH 2CXVA 1H8DH 3E8LA 2XC5A 3EA7A 1E37B 4I8JA 5CE1A 1SGTA 2YNBA 4AG2A 1YBWA 5EQRA 1P04A 2P16A 1EUFA 5JPMH 1TNHA 3M37A 1PPCE 2NU0E 1SLUB 2FOFA 3TLOA 5J4QA 1BB0B 1V2KT 2BLOA 2XRCA 4UONA 1Z8RA 3UREA 4B73A 3Q3YA 1P9UA 3GY4A 8ESTE 3U8RH 1NTPA 2QXGA 2Z3DA 1MUEB 3GCHB 1OWJA 5EGMA 3VB5A 2J94A 4ISIH 1HJAB 2HNTC 1VCWA 4LZ1H 4Y8XA 1K1JA 2BTCE 3SUFA 1O38A 3UWIA 1CHOF 3P70B 3LONA 3FP6E 1HBTH 2ZHFH 5DKMA 1AB9C 3M5LA 1O5FH 4ABIA 1YGCH 1ZYOA 1M9UA 3SV8A 1TYNA 4MQAA 1QFKH 3Q3XA 3GYMA 2AIQA 1THSH 4JMYA 2EI7A 3ZVEA 1DLEA 1CHGA 1OP0A 4MPUA 4WMEA 2SGFE 1O3NA 3ATLA 1QY6A 5GPIB 5FX6A 1J16A 4AORA 1XUFA 1O3FA 3EA8A 1GJ9B 1N6YA 4DCDA 1WBGB 2PLXA 2BVXH 2QXIA 1CT0E 1ZHRA 3LU9B 2R9PA 2FDAA 4D7GA 2Y7ZA 4BXSA 2Y5GA 3QTOH 1THPB 2PSYA 2VINA 2STAE 5GJ4B 2NU1E 2BDAA 3LIWA 5A8XA 1O2WA 3CS0A 1HXFH 2FESH 1GJ7B 2AIPA 4Y71A 1GGDC 1KLJH 2WPJS 2A4RA 3SUGA 7GCHF 4INLA 1ARBA 4JZDH 1Z6EA 5K7RA 3H5CB 4X6MA 2OD3B 1AUTC 2R2WU 2ZF0H 3UPEA 1DE7H 1VCQA 1FQ3A 4Y8ZA 2YOLA 1GBTA 4ZKSU 3AAVA 2W26A 1HJAC 3L6PA 1C5SA 4Q7YA 3RXPA 2CV3A 2A5AA 2F9NA 2TGAA 4FXGH 3OY6U 4CRFA 4UDWH 2M5TA 3M7QA 4IN1A 1Q31A 4ABDA 2GVFA 3RXVA 1HAPH 1ZOMA 1P09A 4ABFA 4ZXYH 3HGNA 1C5YB 3A81A 4ZHLU 1QURH 3GOVB 3F9GA 1YM0A 7GCHG 2OLGA 1GMDF 3LH3A 1O39A 1O5CB 5T6FA 1D9IA 1ZMLA 4DY7B 4ZUHA 4AFZA 4AN7A 4WH8A 2ZG0H 5A09A 1NS3A 4FUHA 5CHAC 1BHXF 3ZV8A 3ZV9A 3LOXA 1NU7B 1GG6B 2WYJA 2HOBA 2FS9A 1FI8A 1GMDG 1QBNA 1FV9A 1TNGA 5GIBA 4BAKB 1OWDA 2J38A 1OWIA 2IN2A 1PPGE 2H5DA 4ISHH 1KLTA 3QX5H 1D3TB 4K60A 2AGIX 1W13U 4Y11E 1DVAH 2H2ZA 3SZNA 4INHA 2A31A 1HYLA 1IQEA 1C5OH 1XUGA 3MFJA 3P92A