2PTNA

On the disordered activation domain in trypsinogen. chemical labelling and low-temperature crystallography
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title On the Disordered Activation Domain in Trypsinogen. Chemical Labelling and Low-Temperature Crystallography
pubmed rcsb
source organism Bos taurus
molecule tags Hydrolase (serine proteinase)
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1981-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ptnA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ptnA02
1G3DA 3P95A 2JH5D 2EI8A 3BEUA 1MAXA 2C4FH 3SNCA 2BDYA 3PLKA 4WH6A 1D6RA 3SBKA 4TWYA 2UWPA 3M35A 1CGHA 1GHAF 1OKXA 3AAUA 1O2PA 1CA0B 4B1TA 1HAIH 1TRMA 1TNLA 3BG8A 3ZVDA 2AGIX 4DW2U 2VVCA 5E0HA 5LPEA 5T6DA 4IN2A 5LPFA 3L33A 3TPIZ 5EPNA 1IOEA 2JH0D 4X6NA 4OS7A 1TNJA 1HAHH 2BDGA 2CF9H 3MMGA 3MO6A 1Y5UT 4DY7B 2GCHF 2XC5A 2F9PA 1MU6B 2GD4B 1ZRKA 2P8OC 1EASA 1QL8A 1DOJA 2VU8E 1A7SA 3PTBA 2WV5A 1ZMJA 3SU2A 1TX7A 4VGCC 1NFUA 1MAYA 2Y81A 1MTNB 5K7RA 1E36B 2SNVA 2QXJA 1GI5A 4NA9H 1TGBA 4CRBA 1P0SH 2VIPA 4FXGH 1W2KH 4H6TA 4OGYA 1BHXF 3Q00A 3C1KA 1THPB 1MZDA 3UQOA 3QWCH 1GPZA 1GVLA 1HPGA 1RIWC 1UK2A 5JBAS 3TK9A 3M61U 4I8HA 1KXAA 3SW2B 4FUCA 1O3IA 4XBCA 3U69H 1GGDC 3RMNH 1ORFA 3GY8A 2G4TA 2Q6DA 1P12E 1XUJA 1ETSH 5JYIA 1GMDF 4DURA 1E0FD 1D6WA 1AN1E 2CHAC 3B8JA 4LZ4B 1GMHG 3QZQA 5DP5A 1TB6H 1MCVA 1TMBH 1BIOA 3TGIE 2ZNKH 1D3PB 1A0HB 4I8JA 1NU9A 2SGFE 3P8FA 3LH1A 3SGQE 4F4OC 3R3GB 1YCPM 1C5PA 5L2ZH 1UTNA 3KNXA 1Z8JB 2HOBA 1DUAA 4MPVA 1WV7H 1BMLA 1A0LA 4AZ2B 2OQ5A 5F03A 3UNQA 7KMEH 2SGQE 1S82A 1UTKA 4X1SU 1QHRB 3O8BA 5PTPA 4AGKA 2RCEA 2EA3A 5HGGA 6GCHG 1NTPA 4YOJA 4ISOA 4ISLA 1GJ7B 3RXAA 4KTUA 3W95A 4A7IB 1QBVH 1MKXH 5EW2H 1C5QA 2Y82A 3KIDU 5GIBA 3GY4A 2VIVA 4Q7ZA 3MOCA 2OC7A 1L0ZA 2K1QA 4DVAU 1L1NA 1SGIB 1LTOA 3QTOH 3K2UA 1A5HA 2BQWB 4Y8YA 3BTKE 1MH0A 3ZZ5A 1ABIH 5F6MA 3CENA 1S5SA 2J95A 4JZEH 4Y79A 1FNIA 1P57B 4H6SB 1AKSB 1F2SE 2XCFA 2VVUA 4J1YA 1F0SA 2BMGB 5FBEA 3M7QA 4M7GA 5EQSA 3RXGA 5C1XA 2D2DA 2A5IA 1UTLM 2Y5FA 3VPKA 2BD4A 3RMMH 5E0GA 1GL0E 1C2FA 3Q3XA 3Q77A 4K1EA 4IMQA 3GDVA 3UIRA 4QT8C 1A2CH 1JRTA 1YLCA 4WF8A 1TOCB 3ZVGA 2BZ6H 1GBIA 4XBBA 1C5XB 2STAE 1OP2A 2FO9A 2JETB 1VITH 1HXEH 7GCHG 1LKAA 2BTCE 1CHOF 1HAPH 5GDSH 1UVPA 3SNBA 3NUMA 2BD8A 3ELAH 4K2YA 1RGQA 1DX5M 4A5TS 1J15A 1XKAC 1ACBE 2OC8A 5HM9A 1GG6B 3ZYDA 3D62A 3RXIA 2QAAA 5EXNA 4OS1A 4OS5A 2GMTB 1HAYB 1NESE 2PUQH 1QY6A 1EAXA 1NROH 1J14A 2CXVA 2D1JA 2Q1JA 3BV9B 1OWJA 2GV7A 2W5EA 1DXPA 3IITA 1V2LT 4J2YB 1GHAG 3ZVEA 1SB1H 3MU0A 4UDWH 3S9AA 5DP9A 1PPCE 3ATIA 2BD9A 1O2UA 2BLQA 4WY3A 2WYGA 2EI7A 4U2WA 1Z1JA 3HKJB 2FLRH 4Z0KA 1SLVB 2SGEE 4A6LA 1LHDH 1SSXA 1AUTC 1BTXA 4GUXA 1QGFA 1GI9B 1O5BB 4RKOB 3R0FA 3KCGH 1W0YH 1GJ4H 5LH8A 5EXMA 3VEQB 2GCHG 3E90B 2BVSH 1GJ9B 1EATA 4U32A 3OX7U 4FUDA 2UUYA 1GBMA 4X1QU 2BD2A 1UVSH 3RXLA 5GWZA 4CHAC 1TWXB 3VB3A 3FVFB 5DP7A 4SGAE 2ZI2H 2ZTXA 2BVXH 3GY7A 4MPXA 1EXFA 5HM2A 1G3EA 1GI1A 1ZZZA 1O5EH 8GCHF 1XXFA 1UVUH 3M3SA 3QX5H 1LQDB 5FHTA 1AE8H 1C5ZB 2R0KA 1D3TB 2C93B 1MTNC 2PSYA 3HGPA 4B2CA 2FIRH 2G00A 1OYTH 2QYIA 1E35B 2TGPZ 3WY8A 1O3CA 1O2NA 2STBE 2ZWLH 3ENSB 1O3HA 1CU1A 4F49A 1S6FA 1OXGA 3SU5A 2A5KA 1GMDG 1QFKH 4CRGA 4X8UH 1C5TA 2THFB 1O5FH 1MZAA 4MLFB 1IAUA 1MTSA 3RXOA 1KY9A 3KHVA 3TK5A 4BAQB 2F9VA 2ZCHP 1EB1H 1C4Y2 1KLJH 3LH3A 3LC3A 3MTYA 2PGBB 1PPZA 2GVFA 3MYWA 3RXKA 1QJ7B 1AFQB 1BB0B 1ETRH 3SU4A 3VXEH 2QC2A 2GDDA 1F92A 1FZZA 2VIWA 1UJ1A 3U9AH 1HIAB 6LPRA 1SHHB 3IG6B 2V3HH 5EW1H 2ZEBA 4AB8A 1YPKH 5C2ZA 1TBZH 1WQVH 4H42U 1EAUA 1ANEA 1DANH 4Y11E 2PKSB 1BITA 3QDZB 1CGIE 1TYNA 4CRCA 3O8RA 1SGRE 1RS0A 2G5VA 1AB9C 3RXHA 1HAOH 4LK4A 3KL6A 2HNTF 5F8ZA 1CBWB 1IQKA 3ODDA 3MU5A 4Y7AA 3RC6A 2Z9GA 2G81E 1PPEE 1SGFA 1O35A 1V2QT 5L2YH 1MU8B 8KME2 1J16A 3OTJE 5JDUB 2G5NA 1YPHC 1AI8H 1C5SA 1T8MA 4XFQA 4B74A 2A4GA 1LHEH 5L30H 4GAWA 5EXLA 1QA7A 3D65E 2BD3A 1Z7KA 3TNSA 5JBBS 1BTUA 1LQEA 3PYHA 1SLUB 3ZZ6A 3ODFA 2BQ7B 1VGCB 1OWDA 3GICB 2ZFSA 2OTVA 1SGPE 4YLQH 4IN1A 3A7ZA 1UVTH 4ABIA 4MNWA 1SC8U 1RTLA 3M5LA 2XBWA 1EPTA 1OOKB 2QF0A 3UTUH 1Y8TA 3MNBA 4B73A 2PKAA 5FCKA 1V2TT 1SLWB 5JB9S 2BQ6B 1QR3E 5ESBA 1DM4B 1P3EA 3E1XB 1TX8A 3A8BA 1Z6EA 4JZ1A 4Q7XA 2SGAA 1BHXB 1YPMH 1BTPA 1TRYA 1EB2A 3BEFB 1GJ5H 1S6HA 1EAWA 1C5LH 1GDNA 1WCZA 2F91A 2OUAA 1K2I1 4K8YA 3P6ZB 2AS9A 2FESH 3URCA 1GHZA 1NFWA 1IQNA 4JZFH 4Y7BA 4XBDA 3SJ9A 1BMAA 3KN2A 3NWUA 3MH6A 3E6PH 5DK1A 1GBTA 2FTLE 4X2VA 3A7TA 2XTTB 2OLGA 2GT7A 3MI4A 1B7XB 2A4RA 4KGAA 4MNXA 5FCRA 1ZJKA 3LGYA 1GBHA 2R2WU 3H5CB 1UTPA 2J2UA 3K6ZA 5H4IB 3I77A 1A3EH 1SG8B 4WMFA 3OY6U 2W3KA 4XE4A 1BTZA 2ZU1A 2PR3A 1A5GH 1GI2A 2FOHA 3GY6A 2F9UA 2P3TB 3KF2A 2A2XH 2ZDVH 1V2OT 3TITA 2TGAA 2GDEH 4YO9A 1FY5A 1H4WA 1XUIA 3SI3H 4X1RU 3SZNA 1FY3A 1HJAB 3VFEA 2ESTE 5A0AE 2Y7ZA 2FWWA 3U8TH 3S9BA 2AGGX 3SV9A 3SN8A 1C1QA 1O2MA 2NU4E 3UQVA 1TONA 1DPOA 2NU0E 5EOKA 2KAIA 4GSOA 3GCNA 4B2AA 1DWEH 3JZ1B 1C5RA 1P3CA 8GCHG 1KXFA 3F9HA 4AFZA 3TJUA 2ZFPH 1TIOA 1O3MA 1HNEE 4Y71A 1NPMA 1GI8B 1N8OB 2ZGBH 3QTVH 1GCTB 2ZP0H 5CMXH 5C1UA 4O97A 1P11E 1ELVA 3V3MA 1P10A 3G01A 3GY3A 1KXBA 2FEQH 3A8CA 1F5LA 1V6DA 1MKWK 3TJOA 1C1NA 4UE7H 1K28D 3EA7A 1GJBB 1O2WA 1O2LA 1ZSJA 1OWHA 1E37B 3DFJA 1V2JT 2ZQ2A 3QK1A 4Y6DA 4DIIH 2ANMH 3RUOA 1CT0E 4CR9A 5GXPA 1BTWA 1GHBF 1V2ST 3E0PB 1PYTC 4FUHA 1EOLA 1Z8RA 2XBYA 2PLXA 3VXFH 1LDTT 4ZXYH 1TX6A 3NCLA 3OSYA 1YM0A 2D8WA 3RDZA 2Y80A 1AFEH 1IQLA 1TLDA 4WVPE 3QGNB 1DWDH 5EPYA 1W10U 1O2IA 1Z6JH 1ESTA 3HPTB 5ABWA 1O3FA 3A7WA 2VINA 1P2MA 4DIHH 1DS2E 4FU8A 2GTBA 3SNDA 1AU8A 1C4V2 1TGCA 4ISNA 4AFSA 1P04A 1C2KA 1SGYE 4K3JA 1C5MD 1MUEB 5C67A 2QA9E 1BRCE 1OX1A 2OD3B 4INHA 1SGCA 2GZ8A 2GZ9A 4CR5A 3S69A 1C1VH 1MTVA 4BOHA 4MNYA 3M7TA 3HGNA 1SQTA 4BTUB 1PQAA 1SR5C 3CS0A 1BCUH 1UTQA 3Q3YA 1GDQA 5HMAA 2PWXA 1UHBB 1A46H 1UCYH 4MPUA 2W7SA 3F9EA 1DFPA 1Q3XA 1Y3XA 1BQYA 1TNGA 3UNSA 1HV7A 4D76A 1ZSLA 1O2XA 1CBWC 4AG1A 3TLOA 4ABFA 1YPLH 4E7RG 1O5AB 4YLUA 3SV8A 3RXFA 4BAOB 1QQUA 3U98H 4YT7H 4Y0YE 1P9SA 1CHGA 2DE8A 3ZZBA 3RM0H 2GCTC 3UOUA 3SU0A 3RXMA 4PROA 2OQUA 2FOFA 2XWAA 5A0CA 1GBLA 2A32A 2P93A 1KDQA 2O8WA 3ZZ8A 4DGJA 2BM2A 2OBOA 1GBKA 1VGCC 2ZU4A 3U1IB 2RA3A 1MQ5A 2FM2A 1O2ZA 3H7TA 4SGBE 1BBRH 1ZLRA 2FOEA 1CSOE 3ZVCA 1SVPA 5GCHF 2QGRA 4Q80A 1O3AA 1O34A 4CREA 4JYUH 3ITIA 3ZVFA 2ALVA 2OXSA 1RJXB 1W3CA 1J8AA 3A85A 1AIXH 3W94A 1Z8IB 3KGPA 1E38B 2H1UA 4Q2KA 1WAYB 3ZVBA 2F83A 1KXCA 1IQIA 4I8LA 1K22H 3SQHE 2QCYA 1NRQH 4I33A 1TMTH 2FOAA 1DVAH 1BJUA 2QF3A 2A7JA 2ZHFH 1GCDA 1HJ8A 4NFFA 4I32A 1C9TA 5DJ7A 1SL3A 4E06H 4CH8B 1SGDE 2FMJA 1GL1A 4KELA 2SFAA 1S83A 2H5DA 1HGTH 4X8TH 1DE7H 1GI7B 2ODYB 2PHBA 2BXTH 5FPTA 1XVMA 2BY7X 4KKDA 3ZZ3A 1VJAU 1NN6A 3GYMA 1ELFA 5E2PA 1TABE 1AGJA 1C5VA 2RDLA 4TPYA 3U8OH 2AEIH 1OWEA 2AMQA 1SFQB 2A2QH 4K5ZA 4X1PU 2FI4E 5E2OA 2SGPE 3EE0B 1GJAB 1FLEE 3BTEE 3C27B 4ZHLU 1ARCA 3LGTA 1ZR0A 1HBTH 2OBQA 1D9IA 2QN5T 1HJAC 1G32B 4HZHA 1C4U2 1FDPA 1YPEH 4D7FA 1LVOA 4ISHH 3F6UH 1EAIA 3SU1A 2J92A 2CMYA 4JYVH 5AFYH 2W3IA 3ZYEA 4K8BA 3SV2H 1HAVB 1YP9A 1T4VH 3UR6A 4WXVA 2C8WB 1F5KU 4NA7A 5EG4A 2XBXA 1T7CA 1KTSB 1TQ0B 5T3HA 3GCOA 1AO5A 2WYJA 1QRZA 1O32A 1MMJN 3M5NA 3VGCB 3AVZA 3RM2H 1MKXK 2EEKA 1N8OC 1HJ9A 1VITF 1W8BH 1W11U 1V2NT 3LGVA 4DT7B 2JKHA 3L3TA 2G52A 1AUJA 4A1TA 1VCWA 3MNCA 2ZFFH 1PQ5A 2SNWA 4MTBA 2YNAA 3QLPH 1TNKA 3AW1A 3OYPA 1GHBG 1O2RA 2ZCKP 2YOLA 3GCTF 1QTFA 4D8NA 2WPHS 1G37A 5FX6A 1VJ9U 4O3UA 2IN2A 1Y3VA 2GX4A 2R9PA 1GWAA 1XXDA 2BY8X 2D26C 5JPMH 3VB6A 1YCPK 2ANKH 2P59A 4X8VH 5A8ZA 2ZHWH 1U6QA 3OY5U 1O3DA 1THRH 2ZC9H 2ZTZA 3H7OA 4NIYA 4ZAEA 1GBDA 2FS8A 2FTMA 3SNAA 1HRTH 3E3TA 5DP6A 2XCNA 1QCPA 1K1MA 3LGIA 2IPHA 3A7YA 2IJOB 1WOFA 2A31A 1YPHE 1XX9A 2BDBA 2ILNA 2ZDAH 2HNTE 3STIA 1W0ZU 3UY9A 3A83A 1AZZA 1QA0A 1J17T 2IOTA 3A89A 3RXCA 1W7GH 5DG6A 2ZPSA 1QB6A 2Y7XA 5LGOA 1SI5H 1CA0C 3PTNA 1NY22 5JB8S 2A5AA 3TK6A 1GDUA 1CA8B 1EP6A 1EZQA 4GVUA 4NG9H 1YBWA 1KTTB 4K1TA 5K0HA 3JZ2B 1YKTA 2VH0A 1THSH 2G8TA 3PO1B 3RXDA 3AASA 1TNIA 3BTME 1UTOA 3E0NB 4B2BA 1ZPBA 1C1WH 5FPYA 1ZRBA 4O3TA 2Q6GA 3BG4B 3FP7E 2A0QB 4H4FA 1A4WH 1JWTA 2BX3A 3SV6A 4TWWA 1LHFH 3RC5A 2BZAA 1O2QA 3RMOH 5C20A 1V2UT 1MCTA 3ZZDA 3ESTA 1TOMH 2H2ZA 1IHSH 2BLWA 3B9FH 1ELEE 2G51A 3F9GA 2ZGJA 1B5GH 4Z6AH 4GPGA 1G36A 4HI3A 4LZ1H 1P2KA 1DT2A 2ASUB 4YOIA 3SOSA 3ATKA 3UPEA 1V2KT 1EOJA 4AYVB 3LOXA 1O3JA 3T28A 1Y5AT 2NU3E 3V0XA 1O2GH 1H1BA 4D7GA 1GI3A 3M36A 3PMBB 1IQFA 5GCHG 2Z9JA 3LPRA 4X8SH 4X6PA 3T25A 4WH8A 1K1JA 2AERH 3KQEA 1P2QA 1UTJA 2A7CA 4JZDH 2ZDNA 1HDTH 1QJ6B 3RXRA 5BPEA 3LJJA 1K1OA 3UREA 1C5OH 4E7NA 3PMAB 5AF9H 1OWIA 5J4SA 3P17H 9LPRA 1C1TA 1FN8A 5EU8A 4FUJA 1NM6A 2DUCA 3QGJA 4BAHB 5FPSA 3TVJB 1P2OA 1C1OA 3SGBE 4U01A 2H6MA 1P9UA 3SNEA 4MQAA 3NPSA 1ZJDA 1GVKB 1HAGE 4AN7A 4D9RA 1LHGH 1KXEA 1SQAA 2ZU2A 2ZPQA 2HALA 1WUNH 3A7XA 3A8DA 1VCQA 3SGAE 3L6PA 1FONA 2Z9LA 1SFIA 3SU3A 1WTHD 1TGNA 3DFLA 4JCNA 2HPQH 1N1LA 4TYDA 4D9QA 4K1SA 2ZFRH 1G30B 1LVMA 3A87A 4A1VA 3A81A 2HGTH 3M5OA 5ETXA 2HPPH 4AX9H 1PPBH 3VB5A 3BTFE 2CN0H 1S81A 4ABAA 4CRAA 1D3QB 1Y3UA 3MO3A 1FY1A 3S9CA 1Q31A 1FMGA 1O3KA 3RXEA 5LPRA 3URDA 4OS2A 1AWHB 2P8OB 3PWBA 3PLPA 2I6QA 3T2NA 1XMNB 1DSUA 4RN6A 1A3BH 1NRPH 3I78A 1K1LA 1FIZA 2J4IA 2FX6A 1W13U 1P03A 1QB9A 4FUFA 3PB1E 5FBIA 4UEHH 2VWLA 5C1YA 1NT1A 4UFEH 3BTQE 1ESAA 1MTWA 3GDSA 1TFXA 3SHCH 1ELCA 1O38A 3LT3A 5DP4A 4KTSA 3SORA 4INLA 1K1IA 1Z71A 2FX4A 4MVNA 1RIWB 2FZZA 1TNHA 2FODA 2FYRA 1K1NA 1VITG 1Q2WA 2PSXA 5IDKA 1OPHB 1GGDB 4DJZB 3FP8E 3ZZAA 4HFPB 4I8GA 3VGCC 1HUTH 2DE9A 3GCTG 2JETC 1AZ8A 2QIQA 1JBUH 1GVZA 1CQQA 4ZH8A 2CF8H 1XVOA 2FOGA 1H9HE 3O8CA 2CHAB 2Y6TA 5CE1A 1GJ8B 3Q76A 2WINI 1SGFG 2BVRH 3RU4T 2O8UA 2BOHB 1YPJH 2H9TH 3T26A 3PMJA 1GG6C 4UFFH 1V2MT 1DUEA 3RLYH 2QV1A 1H9LB 1A0JA 2GMTC 1O30A 2ANWA 8ESTE 1UTMA 2VIQA 4A1XA 1W12U 2ZF0H 3BTGE 2A1DB 4NIXA 2ALPA 2WPJS 1FAXA 2GKVE 4CH2B 1GBCA 1VZQH 4GCHF 4JYTA 1CVWH 1O0DH 5A8XA 2B5TB 3UR9A 1TAWA 4ABJA 5SGAE 2VWMA 3MNSA 4Q7YA 1PJPA 4X6OA 1GBJA 3Q3KA 2TGDA 1P02A 2P16A 3GOVB 2BY9X 5F8XA 2Z9KA 3A88A 2I6SA 2OINA 3BF6H 4B75A 5HXFA 4K60A 2NU1E 2CV3A 3DD2H 1ZHPA 2M5TA 2R3UA 4BTTB 2EI6A 3A86A 4I8KA 3RMLH 1D4PB 3M3VA 1O2OA 4IC5A 2HLCA 1XUFA 4RSPA 1S84A 2RA0A 2FP7B 1FPCH 1DY9A 3STJA 3BEIB 2XNIA 2Z3CA 2Y5HA 4NCYA 1GMCG 2ZECA 1ZTLA 1PPHE 1V2VT 2BDAA 2V6NA 4GHTA 3SHAH 2ANYA 3F68H 3EA9A 2GT8A 1C5WB 7LPRA 2WPKS 1V2WT 1SBWA 5A8YA 2ZKSA 2F9OA 4LOYH 1NRNH 3KEEA 4X2WA 1GJCB 1IQGA 5AFZH 2XWBI 3GYLB 1VR1H 5JBTA 2W7UA 1O3EA 1AKSA 3MH4A 4MPWA 1PPGE 3MU8A 1L1GA 2FOMB 5T6FA 3RXBA 3FAOA 1FAKH 1KYNA 3ATMA 4BXWA 5A09A 1GBFA 4MNVA 1A61H 1WTGH 2A4QA 1GBBA 2ZHDA 5BRRE 3QUMP 2OP9A 3DHKH 3ZZ7A 3MFJA 3CP7A 1ABJH 4IMZA 1BRAA 1ZMNA 2Y5GA 1O2KA 4XSKU 3DA9B 2TRMA 1P05A 5TCAA 3P70B 1HAXB 1AFQC 3ATLA 2FOBA 2PGQB 3A7VA 2CJIA 1F0UA 2ODPA 2QY0B 3BTWE 1TPOA 3HK3B 2BLOA 2ZGCA 4Y8ZA 1HCGA 2HWLB 4JZIA 3T29A 2BDHA 1TMUH 1O3OA 1ZPCA 2NWNA 2AMDA 1EJMA 2FPZA 3OU0A 1DSTA 1G3BA 2XC0A 1HFDA 2PKSC 1DWBH 4ZKSU 1CO7E 3SJKA 1IQEA 1BJVA 4IGDA 4FUEA 5F8TA 3LC5A 1PQ7A 6CHAB 2Z6BD 1GI6A 1IQHA 1WSSH 1C2DA 1HAZB 1NO9H 3A84A 1O2HA 7ESTE 1LMWB 2ZO3H 1SGQE 1SGNE 2UWLA 4CHAB 2F9BH 1RFNA 1EPTB 2XXLA 1TA6A 1Y5BT 4DOQA 2PKAB 4INKA 1ANBA 3UWJH 1EUFA 3LDXH 1JRSA 2PFEA 3RXVA 3P8NA 1ZPZA 2GZ7A 2OCVB 1O5DH 3ZV8A 1OYQA 2V3OH 2XRCA 1C1RA 1T8NA 2F9NA 4DCDA 3SI4H 4MG3A 4ZKNU 1GI4A 2BHGA 4BTIB 2FXRA 2O8TA 1FI8A 2UWOA 1V3XA 3MH7A 4NZQA 1CGJE 3IWMA 3LIWA 1MQ6A 3MWIU 3AAVA 2CGAA 2C8XB 1N6YA 2TPIZ 2XC4A 4ISIH 2LPRA 4ZKRU 5C5OA 2B9LA 5IYTA 1C1SA 4NGAH 3TH2H 3TGKE 1O2TA 1QIXB 1UCYK 3ZV9A 3LU9B 1O2VA 1LPKB 1QJ1B 1GBAA 3M37A 1FJSA 1T8LA 1FY4A 2VGCB 1BUIA 3TGJE 4AG2A 2BD7A 1M9UA 2ZGXH 5I25A 2FYQA 1BT7A 3V13A 1F5RA 1O3LA 4CRFA 3RXJA 1IQMA 4O03A 2R0LA 1JIRA 1QL9A 2ZFTA 3FP6E 2VH6A 1AMHA 2P3FH 1PYTD 3RC4A 3NZIA 1K21H 5C3NA 1GHYH 1DLEA 1GJDB 3BIUH 3B23B 5E8EH 1LKBA 5JBCS 1SGTA 1C2LA 2R3YA 2PTNA 1Z1IA 1YF4A 1T32A 2J38A 4GCHG 2B8OH 2ZU3A 1EZSC 1SMFE 3RXQA 4YOGA 2QXHA 2OC1A 3SUEA 1LVYA 3A8AA 1T4UH 1BTHH 2KAIB 1S0RA 1GHWH 1H9IE 1SOZA 2ZHEH 3F1SB 1MD7A 5T6GA 1BBRK 2GP9B 1TE0A 1AB9B 5TJXA 3RU4D 1ZTJA 2J34A 4IBLH 1TPAE 4ZUHA 1L4DA 3EGKH 3RXUA 1EJAA 1V2RT 1FUJA 1HIAA 5DPAA 3VB7A 1GHXH 2O9QA 4AOQA 3GCHB 5B6OA 1P8VC 2RG3A 1PPFE 4ABBA 1NFYA 2Q6FA 1NRRH 2H9HA 4Y0ZE 4IW4E 4FVDA 1HYLA 3AW0A 1F7ZA 1EX3A 1G2MA 3MH5A 1YCPH 4YTAA 2ZDKA 1FIWA 5CHAB 1LVBA 2FI3E 2Z9IA 4Y8XA 3LGUA 2ZDLA 3S7HB 2BOKA 3MNXA 3RP2A 3FZZA 1QBNA 1KIGH 3CS7A 1YGCH 4WJG2 4UONA 2B7DH 2Z7FE 4JK6A 3QZRA 2YNBA 1YC0A 1BDAA 1OP0A 1ELGA 1XUHA 1L2EA 4ZKOU 3E91A 4AORA 1SOTA 1L1JA 2VB0A 3E8LA 1GCTC 5ESTE 3SJOA 1LO6A 3NXPA 1H8DH 4FUGA 1CE5A 1JIMA 1EQ9A 2C90B 3QN7A 1TGTA 1W14U 2EC9H 1XM1A 4OS4A 1P2NA 4I31A 3P8GA 2Z3DA 1W7XH 3FFGA 1LCYA 4I7YH 1JOUB 2AH4X 3MU1A 4UFGH 4WXIA 2QXGA 2VIDA 1O33A 1OWKA 3EAJA 2G55A 1H8IH 3ZVAA 1QRXA 4XDEA 3ZZ9A 3V7TA 2TIOA 4KTCA 1SHYA 4WMDA 4FUBA 1SGEE 3PMHB 1J9CH 4FU7A 4O9VA 1TGSZ 1KLIH 1GJ6A 3SU6A 1NRSH 4E05H 1DLKB 1C5YB 1UVOA 5EQQA 4ABGA 1QL7A 3SO3A 5TCCA 3UWIA 1ESBA 1YPGH 1X7AC 1BMMH 1Y59T 2ZTYA 3BTHE 2O8MA 3EA8A 3MU4A 1DITH 4TPIZ 3NKKA 3SUGA 4AFQA 1WQSA 2Z3EA 3RLWH 4B71A 4R0IA 2PTCE 1ZSKA 1NS3A 1CT2E 1RTFB 4AGJA 1BMNH 5EGMA 1EZUC 1A5IA 2J9NA 3K65B 3BN9A 1O5CB 3E16B 1QBOA 1YLDA 4Y76A 3LONA 4XOJA 4IS5A 2TGTA 2A4OA 1MD8A 5I46H 6CHAC 2W26A 2Z94A 2AIQA 1AWFH 1NFXA 4DG4A 1KDQB 1O3NA 2OC0A 1ELDE 3LKWA 8LPRA 3RXSA 1ANDA 2ODQA 1GMCF 3TH4H 2AMPA 1O3BA 2VWNA 1HXFH 2BX4A 3DT0H 2ZCLP 2ZGHA 1EPTC 3M5MA 3LJOA 4NSVA 1BTYA 3S7KB 1MTUA 3NK8A 3TJVA 3A80A 4TY6A 2JH6D 4KP0A 3UUZA 1AQ7A 2GGVB 2C8ZB 1ID5H 1O5GH 3SUFA 2XBVA 3SV7A 1JXPA 3KQCA 4RKJB 4HGCA 1E34B 1P01A 5DO4H 3P8OA 3FANA 2H9EH 5L6NH 3T62A 2ZU5A 5A2MH 3S0NA 1O2YA 1GHVH 1CT4E 1P09A 1UK4A 1DWCH 2R2MB 3M7UA 4ZXXH 1RXPA 1KXDA 3P92A 4YM9A 1C1UH 1AD8H 1ELBA 1KLTA 1Z8GA 4NWLA 2BD5A 1DDJA 9ESTA 4BNRA 3U1JB 4OGXA 1F0RA 4B76A 1ZOMA 1BRBE 1OSSA 1TRNA 1B0EA 2VGCC 3HKIB 3QO6A 1B0FA 4THNH 5C5NA 3TH3H 1INCA 2FDAA 5EODA 2P94A 2WUCA 1TALA 3MHWU 4CBOA 1C9PA 2UUJB 1HB0B 1N6XA 4ASHA 1O37A 2VVVA 3F9FA 1O31A 3FZDA 1S85A 3M3TA 3U8RH 4ZHAA 4R8TB 4WWYA 2ZZUH 2A7HA 1FXYA 1P2JA 2AFQB 1C2MA 3PLBA 4JK5A 1NC6A 4CRDA 2ZIQH 1C5NH 5AHGH 1LPZB 2J94A 4GHQA 2ZPRA 4AFUA 2BXUH 3SJIA 2V35A 3BTDE 3VB4A 1QNJA 3D49H 1G9IE 2AYWA 2ZHQH 4X6MA 1RTKA 1DY8A 3K6YA 3MO9A 5FXLA 4CBNA 3UNRA 1AVGH 1XUKA 3HATH 3ZZCA 4X0WU 1UO6A 3ZZ4A 3T5FH 2VIOA 4VGCB 1MBMA 5FAHA 1ZMLA 1TPPA 1RD3B 3V12A 4ABDA 3TIUA 3GCHC 2WV4A 2P95A 4ZMAH 1OS8A 5AVDA 1ANCA 3K9XB 2P3UB 5DP8A 5FX5A 2C3SA 1FY8E 1ELAA 1UHBA 5HYOA 4X1NU 3RXPA 2HNTC 3I29A 4MDSA 1ELTA 2ULLA 4ABHA 2GCTB 5CHAC 1T31A 3PWCA 1NZQH 3RU4E 1O36A 4ZROA 3PROA 1IHTH 1NU7B 1JMOH 3GY5A 4NSYA 3TNTA 1AVXA 4IC6A 1EZXC 1ZHRA 4TY7A 2G4UA 1C2IA 1SLXB 2FOCA 1A1RA 2AIPA 2TBSA 1T8OA 1Y3WA 3SUDA 3T27A 1BZXE 1O3GA 3GY2A 2VNTA 1EKBB 1UK3A 2UUFB 3RXTA 2BDCA 1CHOG 2FLBH 2VWOA 2XYAA 1EJNA 1O2JA 4AB9A 2BB4A 1GBEA 1XKBC 1AHTH 1GMHF 4OS6A 1PQ8A 4FVBA 2WPIS 4HTCH 1KSNA 3GDUA 1DXWA 4YESB 1UCYE 1Y3YA 4NZLA 3BTTE 3D23A 5J4QA 1BOQA 3UFAA 1FN6A 1C2GA 2ZFQH 1FV9A 1ARBA 4BANB 2AGEX 2WPMS 4JMYA 5GJ4B 3TJNA 2B0FA 4NFEA 3EDXB 2UUKB 1EP5A 1AE5A 1V2PT 2FS9A 1C5UA 1FQ3A 3A82A 1ETTH 6GCHF 4A92A 1UMAH 4NWKA 1LPGB 4NIVA 2C8YB 3GISB 4YT6H 3KQDA 1G3CA 3TU7H 5G4BA 4Y10E 5A0BA 1MKWH 1P06A 1C1PA 3HK6B 1YYY1 2F3CE 4BAKB 2ZA5A 1LHCH 1K9OE 2LNCA 1TBRH 3PO1C 1QURH 2HVXA 4NIWA 1VCPA 3ATWA 1TPSA 2BYAX 4UD9H 4ABEA 2NU2E 2ZDMA 1ZYOA 3SJ8A 3PV4A 5DP3A 1FPHH 3O8DA 4ESTE 3BG4C 5E0JA 5GPIB 4K69A 1L4ZA 1OP8A 1BBRE 1P2IA 1O39A 1QQ4A 1TBQH 1TQ7B 2HRVA 4X2YA 5DGJA 1S0QA 1G2LA 1WU1A 1SQOA 1K1PA 3KQBA 3SQEE 1BRUP 4YZUA 2ZG0H 4BXSA 3PM3A 4AYYB 4LXBH 2GV6A 1DICA 4FUIA 4UFDH 6ESTA 1QB1A 2QXIA 1SPJA 2VJ1A 4ZHMU 1ZHMA 4BAMB 3N7OA 1D3DB 2PW8H 3BIVH 1QRWA 1IQJA 1C1MA 2WUBA 1F0TA 1PFXC 1BA8B 1WYKA 1XUGA 2BY6X 1O3PB 2WPLS 2PV9B 2ZQ1A 2A45B 1GI0A 4FU9A 1MBQA 4WMEA 2FI5E 4X2XA 3LGWA 3EQ0H 2SGDE 1ZGVA 1HAVA 5DKMA 3DUXH 7GCHF 2BLVA 2BDIA 1ZTKA 1C2JA 1HLTH 1AVWA 1RRKA 2V0BA 2H5CA 1O2SA 1ZGIA 2O8LA 3UOPA 4NA8A 5EQRA 4U30A 1AY6H 2XW9A 4GLYA 1C2HA 2PUXB 1C2EA 2BY5X 3EYDA 1WBGB 3BSQA 1TA2A
chains in the Genus database with same CATH superfamily
1G3DA 3P95A 2JH5D 3WWFA 2EI8A 3BEUA 1MAXA 2C4FH 3SNCA 2BDYA 3PLKA 4WH6A 1D6RA 3SBKA 4TWYA 2UWPA 3OEED 3M35A 1CGHA 1GHAF 1OKXA 3AAUA 1O2PA 1CA0B 4B1TA 1HAIH 1TRMA 1TNLA 3OE7D 3BG8A 3ZVDA 2AGIX 4DW2U 2KX4A 2VVCA 5E0HA 5LPEA 5T6DA 4IN2A 5LPFA 2OK5A 3L33A 2QE7D 3TPIZ 5EPNA 1IOEA 2JH0D 4X6NA 4OS7A 1TNJA 1HAHH 2BDGA 2CF9H 3MMGA 3MO6A 1Y5UT 4DY7B 1W0KD 2GCHF 2XC5A 2F9PA 1MU6B 2GD4B 1ZRKA 2P8OC 1EASA 1QL8A 1DOJA 2VU8E 1A7SA 3PTBA 2WV5A 1ZMJA 3SU2A 1TX7A 4VGCC 1NFUA 1MAYA 2Y81A 1MTNB 5K7RA 1E36B 2SNVA 2QXJA 1GI5A 4NA9H 1TGBA 4CRBA 1P0SH 2VIPA 4FXGH 1W2KH 4H6TA 4OGYA 1BHXF 3Q00A 3C1KA 1THPB 2LP6A 1MZDA 2QF5A 3UQOA 3QWCH 1GPZA 1GVLA 1HPGA 1RIWC 1UK2A 5JBAS 3TK9A 3M61U 4I8HA 1KXAA 3SW2B 4FUCA 1O3IA 4XBCA 3U69H 1GGDC 3RMNH 1ORFA 3GY8A 1KMHB 2G4TA 2Q6DA 3N99A 5C0UA 1P12E 1XUJA 1ETSH 5JYIA 1GMDF 1WXRA 4DURA 1E0FD 1D6WA 1AN1E 2CHAC 3B8JA 4LZ4B 1GMHG 3QZQA 5DP5A 1TB6H 1MCVA 1TMBH 4RT0A 1BIOA 3TGIE 2JDID 3WW7A 2ZNKH 1D3PB 1A0HB 4I8JA 1NU9A 2SGFE 3P8FA 3LH1A 3SGQE 4F4OC 3R3GB 1YCPM 1C5PA 5L2ZH 1UTNA 3KNXA 1Z8JB 2HOBA 1DUAA 4MPVA 1WV7H 1BMLA 1A0LA 4AZ2B 2OQ5A 5F03A 3UNQA 7KMEH 2SGQE 1S82A 1UTKA 3OTPA 4X1SU 1QHRB 3O8BA 5PTPA 4AGKA 2RCEA 2EA3A 5HGGA 6GCHG 1NTPA 4YOJA 4ISOA 4ISLA 1GJ7B 3RXAA 4KTUA 3W95A 4A7IB 1QBVH 1MKXH 5EW2H 1C5QA 2Y82A 3KIDU 3F3BA 5GIBA 3GY4A 2VIVA 4TSFD 4Q7ZA 3MOCA 2OC7A 1L0ZA 2K1QA 4DVAU 1L1NA 1SGIB 1LTOA 5HIYA 3QTOH 3K2UA 1A5HA 2BQWB 4Y8YA 3BTKE 1MH0A 3ZZ5A 1ABIH 5F6MA 3CENA 1S5SA 2J95A 4JZEH 4Y79A 1FNIA 1P57B 4H6SB 3KYFA 1AKSB 1F2SE 3N7EA 2XCFA 2VVUA 4J1YA 1F0SA 2BMGB 5FBEA 3M7QA 4M7GA 5EQSA 3RXGA 5C1XA 2D2DA 2A5IA 1UTLM 5T1VA 2Y5FA 3VPKA 2BD4A 3RMMH 5E0GA 1GL0E 1C2FA 3Q3XA 3Q77A 4K1EA 4IMQA 3GDVA 3UIRA 4QT8C 1A2CH 3OFND 1JRTA 1YLCA 4WF8A 1TOCB 3ZVGA 2BZ6H 3PV5A 1GBIA 4XBBA 1C5XB 2STAE 1OP2A 2FO9A 2JETB 1VITH 1HXEH 7GCHG 1LKAA 3H09A 2BTCE 1BMFD 1CHOF 1HAPH 5GDSH 1UVPA 3SNBA 1QZ8A 3NUMA 2BD8A 3ELAH 4K2YA 1RGQA 1DX5M 4A5TS 1J15A 1XKAC 1ACBE 2OC8A 5HM9A 1GG6B 3ZYDA 4Q4LA 3D62A 3RXIA 2QAAA 5EXNA 4OS1A 4OS5A 2GMTB 1HAYB 2WSSD 1NESE 2PUQH 1QY6A 1EAXA 1NROH 1J14A 2CXVA 2D1JA 2Q1JA 3BV9B 1OWJA 2GV7A 2W5EA 1DXPA 3IITA 1V2LT 4J2YB 1GHAG 3ZVEA 5HKKD 1SB1H 3MU0A 4UDWH 3S9AA 5DP9A 1PPCE 3ATIA 2BD9A 1O2UA 4Q63A 2BLQA 4WY3A 2WYGA 2EI7A 4U2WA 2J98B 1Z1JA 3HKJB 2FLRH 4Z0KA 1SLVB 2SGEE 4A6LA 1LHDH 1SSXA 2K0QA 1AUTC 1BTXA 4GUXA 1QGFA 1GI9B 1O5BB 4RKOB 3R0FA 3KCGH 1W0YH 1GJ4H 5LH8A 5EXMA 3VEQB 5EIYA 2GCHG 3E90B 2BVSH 1GJ9B 1EATA 4U32A 3OX7U 4FUDA 2UUYA 1GBMA 4X1QU 2BD2A 2GJGA 1UVSH 3RXLA 5GWZA 4CHAC 1TWXB 3VB3A 3FVFB 5DP7A 4SGAE 2ZI2H 2ZTXA 2BVXH 2JJ2D 3GY7A 4MPXA 1EXFA 5HM2A 1G3EA 1GI1A 1ZZZA 1O5EH 8GCHF 1XXFA 1UVUH 3M3SA 3QX5H 1LQDB 5FHTA 1AE8H 1C5ZB 2R0KA 1D3TB 2C93B 1MTNC 2PSYA 3HGPA 4B2CA 2FIRH 2G00A 1OYTH 2QYIA 1E35B 2TGPZ 3WY8A 1O3CA 1O2NA 2STBE 2ZWLH 3ENSB 1O3HA 1CU1A 4F49A 1S6FA 1OXGA 3SU5A 2A5KA 1GMDG 1QFKH 4CRGA 3AK5A 4X8UH 1C5TA 2THFB 4XRNA 1O5FH 1MZAA 4MLFB 1IAUA 1MTSA 3RXOA 1KY9A 3KHVA 3TK5A 4BAQB 2F9VA 2ZCHP 1EB1H 1C4Y2 1KLJH 3LH3A 3LC3A 3MTYA 4B6EA 1W0JD 2PGBB 1PPZA 2GVFA 3MYWA 3RXKA 1QJ7B 1AFQB 2IPQX 1BB0B 1ETRH 3SU4A 3SZEA 3VXEH 2QC2A 2GDDA 1F92A 1FZZA 2VIWA 1UJ1A 3U9AH 1HIAB 6LPRA 1SHHB 3IG6B 2V3HH 5EW1H 2ZEBA 4AB8A 1YPKH 5C2ZA 1TBZH 1WQVH 4H42U 1EAUA 1ANEA 1DANH 4Y11E 2PKSB 1BITA 3QDZB 1CGIE 1TYNA 4CRCA 3O8RA 3UB0A 1SGRE 1RS0A 2G5VA 1AB9C 3RXHA 1HAOH 4LK4A 3KL6A 2HNTF 5F8ZA 1CBWB 1IQKA 3ODDA 3MU5A 1E1RD 4Y7AA 3RC6A 2Z9GA 2G81E 1PPEE 1SGFA 1O35A 1V2QT 5L2YH 1MU8B 8KME2 1J16A 3OTJE 5JDUB 2G5NA 1YPHC 1AI8H 1C5SA 1T8MA 4XFQA 4B74A 2A4GA 1LHEH 5L30H 4GAWA 2EY4C 5EXLA 1QA7A 3D65E 2BD3A 1Z7KA 3TNSA 5JBBS 1BTUA 1LQEA 3PYHA 1SLUB 3ZZ6A 3ODFA 2BQ7B 1VGCB 1OWDA 3GICB 2ZFSA 2OTVA 2KCYA 1SGPE 4YLQH 4IN1A 3A7ZA 1UVTH 4ABIA 4MNWA 1SC8U 1RTLA 3M5LA 2XBWA 1EPTA 1OOKB 2QF0A 3UTUH 1FX0B 1Y8TA 3MNBA 4B73A 4ACAA 2PKAA 5FCKA 1V2TT 1SLWB 3KQ5A 5JB9S 2BQ6B 1QR3E 5ESBA 1DM4B 1P3EA 3E1XB 1TX8A 3A8BA 1Z6EA 4JZ1A 4Q7XA 2SGAA 1BHXB 3DSPA 1YPMH 1BTPA 1TRYA 5EJZA 1EB2A 3BEFB 1GJ5H 1S6HA 1EAWA 1C5LH 1GDNA 1WCZA 2F91A 2OUAA 1K2I1 4K8YA 3P6ZB 2AS9A 2FESH 3URCA 1GHZA 1NFWA 1IQNA 4JZFH 4Y7BA 4XBDA 3SJ9A 1BMAA 3KN2A 3NWUA 3MH6A 3E6PH 5DK1A 2RFKC 1GBTA 2FTLE 4X2VA 3F2GA 3A7TA 2XTTB 2OLGA 3KYGA 2GT7A 3MI4A 1B7XB 2A4RA 4KGAA 4MNXA 5FCRA 1ZJKA 3LGYA 1GBHA 2R2WU 3H5CB 1UTPA 2J2UA 3K6ZA 5H4IB 3I77A 1A3EH 1SG8B 4WMFA 3OY6U 2W3KA 4XE4A 1BTZA 2ZU1A 2PR3A 1A5GH 1GI2A 2FOHA 3GY6A 2F9UA 2P3TB 5KGOA 3KF2A 4FETA 2A2XH 2ZDVH 1V2OT 3TITA 2TGAA 2GDEH 4YO9A 1FY5A 1H4WA 1XUIA 3SI3H 4X1RU 3SZNA 1FY3A 1HJAB 3VFEA 2ESTE 5A0AE 2Y7ZA 2FWWA 3U8TH 3S9BA 1VKYA 2AGGX 3SV9A 3SN8A 1C1QA 1O2MA 2NU4E 3UQVA 1TONA 1DPOA 2NU0E 5EOKA 2KAIA 4GSOA 1WDIA 3GCNA 4B2AA 1DWEH 5CHBA 3JZ1B 1C5RA 1P3CA 8GCHG 1KXFA 3F9HA 2XNDD 4AFZA 3TJUA 2ZFPH 1TIOA 1O3MA 1HNEE 1E1QD 4Y71A 3GS9A 1NPMA 1GI8B 1N8OB 2ZGBH 3QTVH 1GCTB 2ZP0H 5CMXH 5C1UA 4O97A 1P11E 1ELVA 3V3MA 1P10A 3G01A 3GY3A 1KXBA 4ACBA 2FEQH 3A8CA 1F5LA 1V6DA 1MKWK 3TJOA 1C1NA 4UE7H 1K28D 3EA7A 1GJBB 1O2WA 1O2LA 1ZSJA 1OWHA 1E37B 3DFJA 1V2JT 2ZQ2A 3QK1A 4Y6DA 4DIIH 1SKYE 2ANMH 3RUOA 1CT0E 4CR9A 5GXPA 1BTWA 1GHBF 1V2ST 3E0PB 1PYTC 4FUHA 1EOLA 1Z8RA 2XBYA 2PLXA 3VXFH 1LDTT 4ZXYH 1TX6A 1S6LA 3NCLA 3OSYA 1YM0A 2D8WA 3RDZA 2Y80A 1AFEH 1IQLA 1TLDA 4WVPE 3QGNB 1DWDH 5EPYA 1W10U 1O2IA 1Z6JH 1ESTA 3HPTB 5ABWA 1O3FA 3A7WA 2VINA 4HG6A 1P2MA 4DIHH 1DS2E 4FU8A 2GTBA 3SNDA 1AU8A 1C4V2 1TGCA 4ISNA 4AFSA 1P04A 1C2KA 1SGYE 4K3JA 1C5MD 1MUEB 2EQNA 5C67A 2QA9E 1BRCE 1OX1A 2OD3B 4INHA 1SGCA 2GZ8A 2GZ9A 4CR5A 3S69A 1C1VH 1MTVA 4BOHA 4MNYA 3M7TA 3HGNA 1SQTA 4BTUB 1PQAA 1SR5C 3CS0A 1BCUH 1UTQA 3Q3YA 1GDQA 5HMAA 2PWXA 1UHBB 1A46H 1UCYH 4MPUA 2W7SA 3F9EA 4AC9A 1DFPA 1Q3XA 1Y3XA 1BQYA 1TNGA 2J97A 3UNSA 1HV7A 4D76A 1ZSLA 1O2XA 1CBWC 4AG1A 3TLOA 4ABFA 1YPLH 4E7RG 1O5AB 4YLUA 3SV8A 3RXFA 4BAOB 1QQUA 3U98H 4YT7H 4Y0YE 1P9SA 1CHGA 2DE8A 5C94A 3ZZBA 3RM0H 2GCTC 3UOUA 3SU0A 3RXMA 4PROA 2OQUA 2FOFA 2XWAA 5A0CA 1GBLA 2A32A 1KDQA 2P93A 2O8WA 3ZZ8A 4DGJA 2BM2A 2OBOA 1GBKA 1VGCC 2ZU4A 3U1IB 2KCPA 2RA3A 1MQ5A 2FM2A 1O2ZA 3H7TA 4SGBE 1BBRH 1ZLRA 2FOEA 1CSOE 3ZVCA 1SVPA 5GCHF 2QGRA 4Q80A 1O3AA 1O34A 4CREA 4JYUH 3ITIA 3ZVFA 2ALVA 2OXSA 1RJXB 4XD7D 1W3CA 1J8AA 3A85A 1AIXH 3W94A 1Z8IB 1YLNA 3KGPA 1E38B 2H1UA 4Q2KA 1WAYB 3ZVBA 2F83A 1KXCA 1IQIA 4I8LA 1K22H 3SQHE 2QCYA 1NRQH 4I33A 1TMTH 2FOAA 1DVAH 1BJUA 2QF3A 2A7JA 2ZHFH 1GCDA 1HJ8A 4NFFA 4I32A 3ZIAD 1C9TA 5DJ7A 1SL3A 2IJD1 4E06H 4CH8B 1SGDE 2FMJA 1GL1A 4KELA 2SFAA 1S83A 2H5DA 1HGTH 4X8TH 1DE7H 1GI7B 2ODYB 2PHBA 2BXTH 5FPTA 1XVMA 2BY7X 4KKDA 2LELA 3FO8D 3ZZ3A 1VJAU 4RT1A 1NN6A 3GYMA 2YMSB 1ELFA 5E2PA 1TABE 1AGJA 1C5VA 2RDLA 4TPYA 3U8OH 2AEIH 1OWEA 2AMQA 1SFQB 2A2QH 4K5ZA 4X1PU 2FI4E 5E2OA 2SGPE 3EE0B 1GJAB 1FLEE 3BTEE 3C27B 4ZHLU 1ARCA 3LGTA 1ZR0A 1HBTH 2OBQA 1D9IA 2QN5T 1HJAC 1G32B 3F0PA 4HZHA 1C4U2 1FDPA 1YPEH 4D7FA 1LVOA 4ISHH 3F6UH 1EAIA 3SU1A 2J92A 2CMYA 4JYVH 5AFYH 2W3IA 3ZYEA 4K8BA 3SV2H 1HAVB 1YP9A 1T4VH 3UR6A 5FL7D 4WXVA 2C8WB 1F5KU 4NA7A 5EG4A 2XBXA 1T7CA 3SYJA 1KTSB 1TQ0B 5T3HA 3GCOA 1AO5A 2WYJA 1QRZA 1O32A 1MMJN 3M5NA 3VGCB 3AVZA 3RM2H 1MKXK 5C17A 2EEKA 4F55A 1N8OC 1HJ9A 1VITF 1W8BH 1H8HD 1V2NT 1W11U 3LGVA 4DT7B 2JKHA 3L3TA 2G52A 1AUJA 4A1TA 1VCWA 3MNCA 2ZFFH 1PQ5A 2SNWA 4MTBA 2YNAA 3QLPH 1TNKA 3AW1A 3OYPA 1GHBG 1O2RA 2ZCKP 2YOLA 3GCTF 1QTFA 2W6JD 4D8NA 2HVYB 2WPHS 1G37A 5FX6A 1VJ9U 4O3UA 2IN2A 1Y3VA 1K0HA 2GX4A 2R9PA 1GWAA 1XXDA 2BY8X 2D26C 5JPMH 3VB6A 1YCPK 2ANKH 2P59A 4X8VH 5A8ZA 2ZHWH 1U6QA 3OY5U 1O3DA 1THRH 2ZC9H 2ZTZA 3H7OA 4NIYA 4ZAEA 1GBDA 2FS8A 2FTMA 3SNAA 1HRTH 3E3TA 5DP6A 2XCNA 1QCPA 1K1MA 3LGIA 2IPHA 3A7YA 2IJOB 1WOFA 2A31A 1YPHE 1XX9A 2BDBA 2ILNA 2ZDAH 2HNTE 3STIA 1W0ZU 3UY9A 3A83A 1AZZA 3DSGA 1QA0A 1J17T 2IOTA 3A89A 3RXCA 1W7GH 5DG6A 2ZPSA 1QB6A 2Y7XA 5LGOA 1SI5H 1CA0C 3PTNA 1NY22 5JB8S 2A5AA 3EE7A 3TK6A 1GDUA 1CA8B 1EP6A 1EZQA 4GVUA 4NG9H 5KECA 1NBMD 1YBWA 1KTTB 4K1TA 5K0HA 3JZ2B 2WV9A 1YKTA 3N7DA 2VH0A 1THSH 2G8TA 3PO1B 3RXDA 3AASA 1TNIA 3BTME 1UTOA 3E0NB 4B2BA 1ZPBA 1C1WH 5FPYA 1ZRBA 3DCLA 4O3TA 2Q6GA 3BG4B 3FP7E 2A0QB 4H4FA 1A4WH 1JWTA 2BX3A 3SV6A 4TWWA 1LHFH 3RC5A 5F53A 2BZAA 1O2QA 3RMOH 5C20A 1V2UT 1MCTA 3ZZDA 3ESTA 1TOMH 3PRDA 2H2ZA 1IHSH 2BLWA 3B9FH 1ELEE 2G51A 3F9GA 2ZGJA 1B5GH 4Z6AH 4GPGA 1G36A 4HI3A 4LZ1H 1P2KA 1DT2A 2ASUB 3CNRA 4YOIA 3SOSA 3ATKA 3UPEA 1V2KT 1EOJA 4AYVB 3LOXA 1O3JA 3T28A 1Y5AT 3OAAD 2NU3E 3V0XA 1O2GH 1H1BA 4D7GA 1GI3A 3M36A 3PMBB 1IQFA 5GCHG 2Z9JA 3LPRA 3FKSD 4X8SH 4X6PA 3T25A 4WH8A 1K1JA 2AERH 3KQEA 1P2QA 1UTJA 2A7CA 4JZDH 2ZDNA 4B6FA 1HDTH 1QJ6B 3RXRA 5BPEA 3LJJA 1K1OA 3UREA 1C5OH 4E7NA 3PMAB 5AF9H 1OWIA 5J4SA 3P17H 9LPRA 1C1TA 1FN8A 5EJ1A 5EU8A 4FUJA 1NM6A 4TT3D 2DUCA 3QGJA 4BAHB 5FPSA 3TVJB 1P2OA 1C1OA 3SGBE 4U01A 2H6MA 1P9UA 3SNEA 4MQAA 3NPSA 1ZJDA 1GVKB 5EJLA 1HAGE 4AN7A 4D9RA 1LHGH 1KXEA 4P00A 1SQAA 2ZU2A 2ZPQA 2HALA 1WUNH 3A7XA 3A8DA 1VCQA 3SGAE 3L6PA 1FONA 2Z9LA 1SFIA 3SU3A 1WTHD 2M2AA 1TGNA 3DFLA 4JCNA 2HPQH 1N1LA 4TYDA 4D9QA 4K1SA 2ZFRH 1G30B 1LVMA 3A87A 4A1VA 3A81A 2HGTH 3M5OA 5ETXA 2HPPH 4AX9H 1PPBH 3VB5A 3BTFE 2V3MA 1E79D 2CN0H 1S81A 4ABAA 4CRAA 1D3QB 1Y3UA 3MO3A 1FY1A 3S9CA 1Q31A 1FMGA 1O3KA 3RXEA 5LPRA 3URDA 4OS2A 1AWHB 2P8OB 3PWBA 3PLPA 2I6QA 3T2NA 1XMNB 1DSUA 4RN6A 1A3BH 1NRPH 3I78A 1K1LA 1FIZA 2J4IA 2FX6A 1W13U 1P03A 1QB9A 4FUFA 3PB1E 5FBIA 4UEHH 2VWLA 5C1YA 1NT1A 4UFEH 3BTQE 1ESAA 1MTWA 3GDSA 1TFXA 3SHCH 1ELCA 1O38A 3LT3A 5DP4A 4KTSA 3SORA 4INLA 1K1IA 1Z71A 2FX4A 4MVNA 1RIWB 2FZZA 1TNHA 2FODA 2FYRA 1K1NA 1VITG 3U28C 1Q2WA 2PSXA 3VG8A 5IDKA 1OPHB 1GGDB 4DJZB 3FP8E 3ZZAA 4HFPB 4I8GA 3VGCC 1HUTH 2DE9A 3GCTG 2JETC 1AZ8A 2QIQA 1JBUH 1GVZA 1CQQA 4ZH8A 2CF8H 1XVOA 2FOGA 1H9HE 3O8CA 2CHAB 2Y6TA 5CE1A 1GJ8B 3Q76A 2WINI 1SGFG 2BVRH 3RU4T 2O8UA 2BOHB 4I86A 1YPJH 2H9TH 3T26A 3PMJA 1GG6C 4UFFH 1V2MT 1DUEA 3RLYH 2QV1A 1H9LB 1A0JA 2GMTC 1O30A 2ANWA 4P02A 8ESTE 1UTMA 2VIQA 4A1XA 1W12U 2ZF0H 3BTGE 2A1DB 4NIXA 2ALPA 2WPJS 2WZQA 1FAXA 2GKVE 4CH2B 1GBCA 1VZQH 4GCHF 4JYTA 1CVWH 1O0DH 5A8XA 2B5TB 3UR9A 1TAWA 4ABJA 5SGAE 2VWMA 3MNSA 4Q7YA 1PJPA 4X6OA 1GBJA 3Q3KA 2TGDA 1P02A 2P16A 3GOVB 2BY9X 5F8XA 2Z9KA 3A88A 2I6SA 2OINA 3BF6H 4B75A 5HXFA 4K60A 2NU1E 2CV3A 3DD2H 1ZHPA 2M5TA 2R3UA 4BTTB 2EI6A 3A86A 4I8KA 3RMLH 1D4PB 3M3VA 1O2OA 4IC5A 2HLCA 3NRLA 1XUFA 4RSPA 1S84A 2RA0A 2FP7B 1FPCH 2W6ID 1DY9A 3STJA 3BEIB 2XNIA 2Z3CA 2Y5HA 4NCYA 1GMCG 2ZECA 1ZTLA 1PPHE 1V2VT 2BDAA 2V6NA 4GHTA 3SHAH 2ANYA 3F68H 3EA9A 2GT8A 1C5WB 7LPRA 2WPKS 1V2WT 1SBWA 1NBME 5A8YA 2ZKSA 1H8ED 2F9OA 4LOYH 1NRNH 3KEEA 4X2WA 1GJCB 1IQGA 5AFZH 4F48B 2XWBI 3GYLB 1VR1H 5JBTA 2W7UA 1O3EA 1AKSA 3MH4A 4MPWA 1PPGE 3MU8A 1L1GA 2FOMB 5T6FA 3RXBA 3FAOA 1FAKH 1KYNA 3ATMA 4BXWA 5A09A 1GBFA 4MNVA 1A61H 1WTGH 2A4QA 1GBBA 2ZHDA 5BRRE 3QUMP 2OP9A 3DHKH 3ZZ7A 2PP6A 3MFJA 3CP7A 1ABJH 4FOUC 4IMZA 1BRAA 1ZMNA 2Y5GA 1O2KA 4XSKU 3DA9B 2TRMA 1P05A 5TCAA 3P70B 1HAXB 1AFQC 3ATLA 2FOBA 2KCAA 2PGQB 3A7VA 2CJIA 1F0UA 2ODPA 2QY0B 3BTWE 1TPOA 3HK3B 2BLOA 2ZGCA 4Y8ZA 1HCGA 2HWLB 4JZIA 3T29A 2BDHA 1TMUH 1O3OA 1ZPCA 2NWNA 2AMDA 1EJMA 2FPZA 3OU0A 1DSTA 1G3BA 2XC0A 1HFDA 2PKSC 1DWBH 4ZKSU 2KM0A 1CO7E 3SJKA 1IQEA 1BJVA 3F0OA 4IGDA 4FUEA 5F8TA 3LC5A 1PQ7A 6CHAB 2Z6BD 1GI6A 1IQHA 1WSSH 1C2DA 1HAZB 1NO9H 3A84A 2J5UA 1O2HA 7ESTE 1LMWB 5IK2D 2ZO3H 1SGQE 1SGNE 2UWLA 4CHAB 2F9BH 1RFNA 1EPTB 2XXLA 1TA6A 1Y5BT 2J98A 4DOQA 2HLDD 2PKAB 4INKA 1ANBA 3UWJH 1EUFA 3LDXH 1JRSA 2PFEA 3RXVA 3P8NA 1ZPZA 2GZ7A 2OCVB 1O5DH 3ZV8A 1OYQA 2V3OH 2XRCA 1C1RA 3MQKC 1T8NA 2F9NA 4DCDA 3SI4H 4MG3A 4ZKNU 1GI4A 2BHGA 4BTIB 2FXRA 2O8TA 1FI8A 2UWOA 1V3XA 3MH7A 4NZQA 1CGJE 3IWMA 3LIWA 1MQ6A 3MWIU 3AAVA 2CGAA 2C8XB 1N6YA 2TPIZ 2XC4A 4ISIH 2LPRA 4ZKRU 5C5OA 2B9LA 5IYTA 5CDFE 1C1SA 5B6LA 4NGAH 3TH2H 3TGKE 1O2TA 1QIXB 1UCYK 3ZV9A 3LU9B 1O2VA 1LPKB 1QJ1B 1GBAA 2WPDD 3M37A 1FJSA 1T8LA 1FY4A 2VGCB 1BUIA 3TGJE 1YY3A 2BD7A 4AG2A 1M9UA 2ZGXH 5I25A 2KZ4A 2FYQA 1YWUA 1BT7A 3V13A 1F5RA 1O3LA 4CRFA 2VBCA 3RXJA 1IQMA 4O03A 2R0LA 1JIRA 1QL9A 2ZFTA 3FP6E 2VH6A 1AMHA 2P3FH 1PYTD 3RC4A 3NZIA 1K21H 5C3NA 1GHYH 1DLEA 1GJDB 3BIUH 3B23B 5E8EH 1LKBA 5JBCS 1SGTA 1C2LA 2R3YA 2PTNA 1Z1IA 1YF4A 1T32A 2F4LA 2J38A 4GCHG 2B8OH 2ZU3A 1EZSC 1SMFE 3RXQA 4YOGA 2QXHA 2OC1A 3SUEA 1LVYA 3A8AA 1T4UH 1BTHH 2KAIB 1S0RA 1GHWH 1H9IE 2XOKD 1SOZA 2ZHEH 3F1SB 1MD7A 5T6GA 1BBRK 2GP9B 1TE0A 1AB9B 5TJXA 3RU4D 1ZTJA 2J34A 4IBLH 1TPAE 4ZUHA 1L4DA 3EGKH 3RXUA 1EJAA 1V2RT 1FUJA 1HIAA 5DPAA 3VB7A 1GHXH 2O9QA 4AOQA 3GCHB 5B6OA 1P8VC 2RG3A 1PPFE 4ABBA 1NFYA 2Q6FA 4M9FA 1NRRH 2H9HA 4Y0ZE 4IW4E 4FVDA 1HYLA 3AW0A 1F7ZA 1EX3A 1G2MA 3MH5A 1YCPH 4YTAA 2ZDKA 1FIWA 2RDEA 5CHAB 1LVBA 2FI3E 2Z9IA 4Y8XA 3LGUA 2ZDLA 3S7HB 2BOKA 3MNXA 3RP2A 3FZZA 1QBNA 1KIGH 3CS7A 4ZCNA 1YGCH 4WJG2 4UONA 2B7DH 2Z7FE 4JK6A 3QZRA 2YNBA 1YC0A 1BDAA 1OP0A 1ELGA 1XUHA 1L2EA 4ZKOU 3E91A 4AORA 1SOTA 1L1JA 2VB0A 3E8LA 1GCTC 5ESTE 3SJOA 1LO6A 3NXPA 1H8DH 4FUGA 1CE5A 1JIMA 1EQ9A 2C90B 3QN7A 3WWBA 1TGTA 1W14U 2KCOA 2EC9H 1XM1A 4OS4A 2AHME 1P2NA 4I31A 3P8GA 2Z3DA 1W7XH 3FFGA 1LCYA 4I7YH 1JOUB 2AH4X 3MU1A 4UFGH 4WXIA 2QXGA 2VIDA 1O33A 1OWKA 3EAJA 2G55A 1H8IH 3ZVAA 1QRXA 4XDEA 3ZZ9A 3V7TA 2TIOA 4KTCA 1SHYA 4WMDA 4FUBA 1SGEE 3PMHB 1J9CH 4FU7A 4O9VA 1TGSZ 1KLIH 1GJ6A 3SU6A 1NRSH 4E05H 1DLKB 1C5YB 1UVOA 5EQQA 4ABGA 1QL7A 3SO3A 5TCCA 5HIZA 3UWIA 3F2HA 1ESBA 1YPGH 1X7AC 1BMMH 1Y59T 5DN6D 2ZTYA 3BTHE 2O8MA 3EA8A 3MU4A 1DITH 4TPIZ 3NKKA 3W1EA 3SUGA 4AFQA 1WQSA 2Z3EA 3RLWH 4B71A 4R0IA 2PTCE 1ZSKA 4OM9A 2KR7A 1NS3A 1CT2E 1RTFB 4AGJA 1BMNH 5EGMA 1EZUC 1A5IA 2J9NA 3K65B 3BN9A 1O5CB 3E16B 1QBOA 1YLDA 4Y76A 3LONA 4XOJA 4IS5A 2TGTA 2A4OA 1MD8A 5I46H 6CHAC 2W26A 2Z94A 1COWD 2AIQA 1AWFH 1NFXA 4DG4A 1KDQB 1O3NA 4DT4A 2OC0A 1ELDE 3LKWA 8LPRA 3RXSA 1ANDA 2ODQA 4RI0A 1GMCF 3TH4H 2AMPA 1O3BA 2QF4A 2VWNA 1HXFH 2BX4A 3DT0H 2ZCLP 2ZGHA 1EPTC 3M5MA 3LJOA 4NSVA 1BTYA 3S7KB 1MTUA 3NK8A 3TJVA 3A80A 4TY6A 2JH6D 4KP0A 3UUZA 1AQ7A 2GGVB 2C8ZB 1ID5H 1O5GH 3SUFA 2XBVA 3SV7A 1JXPA 3KQCA 4RKJB 4HGCA 1E34B 1P01A 5DO4H 3P8OA 3FANA 2H9EH 5L6NH 3T62A 2ZU5A 5A2MH 3S0NA 2JIZD 1O2YA 1GHVH 1CT4E 2WHXA 1P09A 1UK4A 1DWCH 2R2MB 3M7UA 4ZXXH 1RXPA 1KXDA 3P92A 4YM9A 1C1UH 1AD8H 1ELBA 1KLTA 1Z8GA 3FN8A 3UAIC 4NWLA 2BD5A 1DDJA 9ESTA 4BNRA 4ASUD 3U1JB 4OGXA 1F0RA 4B76A 1ZOMA 1BRBE 1OSSA 3DSOA 1TRNA 1B0EA 2VGCC 3HKIB 3QO6A 1B0FA 4THNH 5C5NA 3TH3H 1INCA 2FDAA 5EODA 2P94A 2WUCA 1TALA 3MHWU 3FOAA 4CBOA 1C9PA 5KEDA 2UUJB 1HB0B 1N6XA 4ASHA 1O37A 2VVVA 2JJ1D 3F9FA 1O31A 3FZDA 1S85A 3M3TA 3U8RH 4ZHAA 4R8TB 4WWYA 2ZZUH 2A7HA 1FXYA 1P2JA 2AFQB 1C2MA 3PLBA 4JK5A 1NC6A 4CRDA 2ZIQH 1C5NH 5AHGH 1LPZB 2J94A 4GHQA 2ZPRA 4AFUA 2BXUH 3SJIA 2V35A 3BTDE 2YMSC 3VB4A 2KFWA 1QNJA 3D49H 1G9IE 2AYWA 2ZHQH 4X6MA 1RTKA 1DY8A 3K6YA 3MO9A 5FXLA 4CBNA 3UNRA 1AVGH 1XUKA 3HATH 3ZZCA 4X0WU 1UO6A 3ZZ4A 3T5FH 2VIOA 4VGCB 1MBMA 5FAHA 1ZMLA 1TPPA 1RD3B 2L74A 3V12A 4ABDA 3TIUA 3GCHC 2WV4A 2P95A 4ZMAH 1OS8A 5AVDA 1ANCA 3K9XB 2P3UB 5DP8A 5FX5A 2C3SA 1FY8E 1ELAA 1UHBA 5HYOA 4X1NU 3RXPA 2HNTC 3I29A 4MDSA 1ELTA 2ULLA 4ABHA 2GCTB 5CHAC 1T31A 3PWCA 1NZQH 3RU4E 1O36A 4ZROA 5DSFA 3PROA 1IHTH 1NU7B 1JMOH 3GY5A 4NSYA 3TNTA 5C0TA 1AVXA 4IC6A 1EZXC 1ZHRA 4TY7A 2G4UA 1C2IA 1SLXB 2FOCA 1A1RA 2AIPA 2TBSA 1T8OA 1Y3WA 3SUDA 3T27A 1BZXE 1O3GA 3GY2A 2F43B 2VNTA 1EKBB 1UK3A 2UUFB 3RXTA 2BDCA 1CHOG 2FLBH 1MABB 2VWOA 2XYAA 1EJNA 1O2JA 3PV2A 4AB9A 2BB4A 1GBEA 1XKBC 1AHTH 1GMHF 4Z1MD 1OHHD 4OS6A 1PQ8A 4FVBA 2WPIS 4HTCH 1KSNA 3GDUA 1DXWA 4YESB 1UCYE 1Y3YA 4NZLA 3BTTE 3D23A 5J4QA 1BOQA 3UFAA 1FN6A 1C2GA 2ZFQH 1UW7A 1FV9A 1ARBA 4BANB 2AGEX 2WPMS 3PRBA 4JMYA 5GJ4B 3TJNA 2B0FA 4NFEA 3EDXB 2UUKB 1EP5A 1AE5A 1V2PT 2FS9A 1C5UA 1FQ3A 3A82A 5GNDA 1ETTH 6GCHF 4A92A 1UMAH 4NWKA 1SQRA 1LPGB 4NIVA 2C8YB 3GISB 4YT6H 3KQDA 1G3CA 3TU7H 5G4BA 4Y10E 5A0BA 1MKWH 1P06A 1C1PA 3HK6B 1YYY1 2F3CE 4BAKB 2ZA5A 1LHCH 2L6OA 1K9OE 2LNCA 1TBRH 3PO1C 1QURH 2HVXA 4NIWA 1VCPA 3ATWA 1TPSA 2BYAX 4UD9H 4ABEA 2NU2E 2ZDMA 1ZYOA 3SJ8A 3PV4A 5DP3A 1FPHH 3O8DA 4ESTE 3BG4C 5E0JA 5GPIB 4K69A 1L4ZA 1OP8A 1BBRE 2YMSD 1P2IA 1O39A 1QQ4A 1TBQH 1TQ7B 2HRVA 4X2YA 5DGJA 1S0QA 1G2LA 1WU1A 1EFRD 1SQOA 1K1PA 3KQBA 3SQEE 1BRUP 2CK3D 4YZUA 2ZG0H 4BXSA 3PM3A 4AYYB 4LXBH 2GV6A 1DICA 4FUIA 4UFDH 6ESTA 1QB1A 2QXIA 1SPJA 2VJ1A 4ZHMU 1ZHMA 4BAMB 3N7OA 1D3DB 2PW8H 3BIVH 1QRWA 1IQJA 1C1MA 2WUBA 1F0TA 1PFXC 1BA8B 1WYKA 1XUGA 2BY6X 1O3PB 2WPLS 2PV9B 2ZQ1A 2A45B 1GI0A 4FU9A 1MBQA 4WMEA 2FI5E 4X2XA 3LGWA 3EQ0H 2SGDE 1ZGVA 1HAVA 5DKMA 4YXWD 3DUXH 7GCHF 2BLVA 3OEHD 2BDIA 1ZTKA 1C2JA 1HLTH 1AVWA 1RRKA 2V0BA 2H5CA 1O2SA 1ZGIA 2O8LA 3UOPA 4NA8A 5EQRA 2V7QD 4U30A 1AY6H 2XW9A 4GLYA 1C2HA 2PUXB 1C2EA 3F2FA 2BY5X 3EYDA 1WBGB 3BSQA 2K8IA 1TA2A
chains in the Genus database with same CATH topology
1G3DA 3P95A 2JH5D 2EI8A 3BEUA 1MAXA 2C4FH 3SNCA 2BDYA 3PLKA 4WH6A 1D6RA 3SBKA 4TWYA 2UWPA 3M35A 1CGHA 1GHAF 1OKXA 3AAUA 1O2PA 1CA0B 4B1TA 1HAIH 1TRMA 1TNLA 3BG8A 3ZVDA 2AGIX 4DW2U 2VVCA 5E0HA 5LPEA 5T6DA 4IN2A 5LPFA 3L33A 3TPIZ 5EPNA 1IOEA 2JH0D 4X6NA 4OS7A 1TNJA 1HAHH 2BDGA 2CF9H 3MMGA 3MO6A 1Y5UT 4DY7B 2GCHF 2XC5A 2F9PA 1MU6B 2GD4B 1ZRKA 2P8OC 1EASA 1QL8A 1DOJA 2VU8E 1A7SA 3PTBA 2WV5A 1ZMJA 3SU2A 1TX7A 4VGCC 1NFUA 1MAYA 2Y81A 1MTNB 5K7RA 1E36B 2SNVA 2QXJA 1GI5A 4NA9H 1TGBA 4CRBA 1P0SH 2VIPA 4FXGH 1W2KH 4H6TA 4OGYA 1BHXF 3Q00A 3C1KA 1THPB 1MZDA 3UQOA 3QWCH 1GPZA 1GVLA 1HPGA 1RIWC 1UK2A 5JBAS 3TK9A 3M61U 4I8HA 1KXAA 3SW2B 4FUCA 1O3IA 4XBCA 3U69H 1GGDC 3RMNH 1ORFA 3GY8A 2G4TA 2Q6DA 1P12E 1XUJA 1ETSH 5JYIA 1GMDF 4DURA 1E0FD 1D6WA 1AN1E 2CHAC 3B8JA 4LZ4B 1GMHG 3QZQA 5DP5A 1TB6H 1MCVA 1TMBH 1BIOA 3TGIE 2ZNKH 1D3PB 1A0HB 4I8JA 1NU9A 2SGFE 3P8FA 3LH1A 3SGQE 4F4OC 3R3GB 1YCPM 1C5PA 5L2ZH 1UTNA 3KNXA 1Z8JB 2HOBA 1DUAA 4MPVA 1WV7H 1BMLA 1A0LA 4AZ2B 2OQ5A 5F03A 3UNQA 7KMEH 2SGQE 1S82A 1UTKA 4X1SU 1QHRB 3O8BA 5PTPA 4AGKA 2RCEA 2EA3A 5HGGA 6GCHG 1NTPA 4YOJA 4ISOA 4ISLA 1GJ7B 3RXAA 4KTUA 3W95A 4A7IB 1QBVH 1MKXH 5EW2H 1C5QA 2Y82A 3KIDU 5GIBA 3GY4A 2VIVA 4Q7ZA 3MOCA 2OC7A 1L0ZA 2K1QA 4DVAU 1L1NA 1SGIB 1LTOA 3QTOH 3K2UA 1A5HA 2BQWB 4Y8YA 3BTKE 1MH0A 3ZZ5A 1ABIH 5F6MA 3CENA 1S5SA 2J95A 4JZEH 4Y79A 1FNIA 1P57B 4H6SB 1AKSB 1F2SE 2XCFA 2VVUA 4J1YA 1F0SA 2BMGB 5FBEA 3M7QA 4M7GA 5EQSA 3RXGA 5C1XA 2D2DA 2A5IA 1UTLM 2Y5FA 3VPKA 2BD4A 3RMMH 5E0GA 1GL0E 1C2FA 3Q3XA 3Q77A 4K1EA 4IMQA 3GDVA 3UIRA 4QT8C 1A2CH 1JRTA 1YLCA 4WF8A 1TOCB 3ZVGA 2BZ6H 1GBIA 4XBBA 1C5XB 2STAE 1OP2A 2FO9A 2JETB 1VITH 1HXEH 7GCHG 1LKAA 2BTCE 1CHOF 1HAPH 5GDSH 1UVPA 3SNBA 3NUMA 2BD8A 3ELAH 4K2YA 1RGQA 1DX5M 4A5TS 1J15A 1XKAC 1ACBE 2OC8A 5HM9A 1GG6B 3ZYDA 3D62A 3RXIA 2QAAA 5EXNA 4OS1A 4OS5A 2GMTB 1HAYB 1NESE 2PUQH 1QY6A 1EAXA 1NROH 1J14A 2CXVA 2D1JA 2Q1JA 3BV9B 1OWJA 2GV7A 2W5EA 1DXPA 3IITA 1V2LT 4J2YB 1GHAG 3ZVEA 1SB1H 3MU0A 4UDWH 3S9AA 5DP9A 1PPCE 3ATIA 2BD9A 1O2UA 2BLQA 4WY3A 2WYGA 2EI7A 4U2WA 1Z1JA 3HKJB 2FLRH 4Z0KA 1SLVB 2SGEE 4A6LA 1LHDH 1SSXA 1AUTC 1BTXA 4GUXA 1QGFA 1GI9B 1O5BB 4RKOB 3R0FA 3KCGH 1W0YH 1GJ4H 5LH8A 5EXMA 3VEQB 2GCHG 3E90B 2BVSH 1GJ9B 1EATA 4U32A 3OX7U 4FUDA 2UUYA 1GBMA 4X1QU 2BD2A 1UVSH 3RXLA 5GWZA 4CHAC 1TWXB 3VB3A 3FVFB 5DP7A 4SGAE 2ZI2H 2ZTXA 2BVXH 3GY7A 4MPXA 1EXFA 5HM2A 1G3EA 1GI1A 1ZZZA 1O5EH 8GCHF 1XXFA 1UVUH 3M3SA 3QX5H 1LQDB 5FHTA 1AE8H 1C5ZB 2R0KA 1D3TB 2C93B 1MTNC 2PSYA 3HGPA 4B2CA 2FIRH 2G00A 1OYTH 2QYIA 1E35B 2TGPZ 3WY8A 1O3CA 1O2NA 2STBE 2ZWLH 3ENSB 1O3HA 1CU1A 4F49A 1S6FA 1OXGA 3SU5A 2A5KA 1GMDG 1QFKH 4CRGA 4X8UH 1C5TA 2THFB 1O5FH 1MZAA 4MLFB 1IAUA 1MTSA 3RXOA 1KY9A 3KHVA 3TK5A 4BAQB 2F9VA 2ZCHP 1EB1H 1C4Y2 1KLJH 3LH3A 3LC3A 3MTYA 2PGBB 1PPZA 2GVFA 3MYWA 3RXKA 1QJ7B 1AFQB 1BB0B 1ETRH 3SU4A 3VXEH 2QC2A 2GDDA 1F92A 1FZZA 2VIWA 1UJ1A 3U9AH 1HIAB 6LPRA 1SHHB 3IG6B 2V3HH 5EW1H 2ZEBA 4AB8A 1YPKH 5C2ZA 1TBZH 1WQVH 4H42U 1EAUA 1ANEA 1DANH 4Y11E 2PKSB 1BITA 3QDZB 1CGIE 1TYNA 4CRCA 3O8RA 1SGRE 1RS0A 2G5VA 1AB9C 3RXHA 1HAOH 4LK4A 3KL6A 2HNTF 5F8ZA 1CBWB 1IQKA 3ODDA 3MU5A 4Y7AA 3RC6A 2Z9GA 2G81E 1PPEE 1SGFA 1O35A 1V2QT 5L2YH 1MU8B 8KME2 1J16A 3OTJE 5JDUB 2G5NA 1YPHC 1AI8H 1C5SA 1T8MA 4XFQA 4B74A 2A4GA 1LHEH 5L30H 4GAWA 5EXLA 1QA7A 3D65E 2BD3A 1Z7KA 3TNSA 5JBBS 1BTUA 1LQEA 3PYHA 1SLUB 3ZZ6A 3ODFA 2BQ7B 1VGCB 1OWDA 3GICB 2ZFSA 2OTVA 1SGPE 4YLQH 4IN1A 3A7ZA 1UVTH 4ABIA 4MNWA 1SC8U 1RTLA 3M5LA 2XBWA 1EPTA 1OOKB 2QF0A 3UTUH 1Y8TA 3MNBA 4B73A 2PKAA 5FCKA 1V2TT 1SLWB 5JB9S 2BQ6B 1QR3E 5ESBA 1DM4B 1P3EA 3E1XB 1TX8A 3A8BA 1Z6EA 4JZ1A 4Q7XA 2SGAA 1BHXB 1YPMH 1BTPA 1TRYA 1EB2A 3BEFB 1GJ5H 1S6HA 1EAWA 1C5LH 1GDNA 1WCZA 2F91A 2OUAA 1K2I1 4K8YA 3P6ZB 2AS9A 2FESH 3URCA 1GHZA 1NFWA 1IQNA 4JZFH 4Y7BA 4XBDA 3SJ9A 1BMAA 3KN2A 3NWUA 3MH6A 3E6PH 5DK1A 1GBTA 2FTLE 4X2VA 3A7TA 2XTTB 2OLGA 2GT7A 3MI4A 1B7XB 2A4RA 4KGAA 4MNXA 5FCRA 1ZJKA 3LGYA 1GBHA 2R2WU 3H5CB 1UTPA 2J2UA 3K6ZA 5H4IB 3I77A 1A3EH 1SG8B 4WMFA 3OY6U 2W3KA 4XE4A 1BTZA 2ZU1A 2PR3A 1A5GH 1GI2A 2FOHA 3GY6A 2F9UA 2P3TB 3KF2A 2A2XH 2ZDVH 1V2OT 3TITA 2TGAA 2GDEH 4YO9A 1FY5A 1H4WA 1XUIA 3SI3H 4X1RU 3SZNA 1FY3A 1HJAB 3VFEA 2ESTE 5A0AE 2Y7ZA 2FWWA 3U8TH 3S9BA 2AGGX 3SV9A 3SN8A 1C1QA 1O2MA 2NU4E 3UQVA 1TONA 1DPOA 2NU0E 5EOKA 2KAIA 4GSOA 3GCNA 4B2AA 1DWEH 3JZ1B 1C5RA 1P3CA 8GCHG 1KXFA 3F9HA 4AFZA 3TJUA 2ZFPH 1TIOA 1O3MA 1HNEE 4Y71A 1NPMA 1GI8B 1N8OB 2ZGBH 3QTVH 1GCTB 2ZP0H 5CMXH 5C1UA 4O97A 1P11E 1ELVA 3V3MA 1P10A 3G01A 3GY3A 1KXBA 2FEQH 3A8CA 1F5LA 1V6DA 1MKWK 3TJOA 1C1NA 4UE7H 1K28D 3EA7A 1GJBB 1O2WA 1O2LA 1ZSJA 1OWHA 1E37B 3DFJA 1V2JT 2ZQ2A 3QK1A 4Y6DA 4DIIH 2ANMH 3RUOA 1CT0E 4CR9A 5GXPA 1BTWA 1GHBF 1V2ST 3E0PB 1PYTC 4FUHA 1EOLA 1Z8RA 2XBYA 2PLXA 3VXFH 1LDTT 4ZXYH 1TX6A 3NCLA 3OSYA 1YM0A 2D8WA 3RDZA 2Y80A 1AFEH 1IQLA 1TLDA 4WVPE 3QGNB 1DWDH 5EPYA 1W10U 1O2IA 1Z6JH 1ESTA 3HPTB 5ABWA 1O3FA 3A7WA 2VINA 1P2MA 4DIHH 1DS2E 4FU8A 2GTBA 3SNDA 1AU8A 1C4V2 1TGCA 4ISNA 4AFSA 1P04A 1C2KA 1SGYE 4K3JA 1C5MD 1MUEB 5C67A 2QA9E 1BRCE 1OX1A 2OD3B 4INHA 1SGCA 2GZ8A 2GZ9A 4CR5A 3S69A 1C1VH 1MTVA 4BOHA 4MNYA 3M7TA 3HGNA 1SQTA 4BTUB 1PQAA 1SR5C 3CS0A 1BCUH 1UTQA 3Q3YA 1GDQA 5HMAA 2PWXA 1UHBB 1A46H 1UCYH 4MPUA 2W7SA 3F9EA 1DFPA 1Q3XA 1Y3XA 1BQYA 1TNGA 3UNSA 1HV7A 4D76A 1ZSLA 1O2XA 1CBWC 4AG1A 3TLOA 4ABFA 1YPLH 4E7RG 1O5AB 4YLUA 3SV8A 3RXFA 4BAOB 1QQUA 3U98H 4YT7H 4Y0YE 1P9SA 1CHGA 2DE8A 3ZZBA 3RM0H 2GCTC 3UOUA 3SU0A 3RXMA 4PROA 2OQUA 2FOFA 2XWAA 5A0CA 1GBLA 2A32A 2P93A 1KDQA 2O8WA 3ZZ8A 4DGJA 2BM2A 2OBOA 1GBKA 1VGCC 2ZU4A 3U1IB 2RA3A 1MQ5A 2FM2A 1O2ZA 3H7TA 4SGBE 1BBRH 1ZLRA 2FOEA 1CSOE 3ZVCA 1SVPA 5GCHF 2QGRA 4Q80A 1O3AA 1O34A 4CREA 4JYUH 3ITIA 3ZVFA 2ALVA 2OXSA 1RJXB 1W3CA 1J8AA 3A85A 1AIXH 3W94A 1Z8IB 3KGPA 1E38B 2H1UA 4Q2KA 1WAYB 3ZVBA 2F83A 1KXCA 1IQIA 4I8LA 1K22H 3SQHE 2QCYA 1NRQH 4I33A 1TMTH 2FOAA 1DVAH 1BJUA 2QF3A 2A7JA 2ZHFH 1GCDA 1HJ8A 4NFFA 4I32A 1C9TA 5DJ7A 1SL3A 4E06H 4CH8B 1SGDE 2FMJA 1GL1A 4KELA 2SFAA 1S83A 2H5DA 1HGTH 4X8TH 1DE7H 1GI7B 2ODYB 2PHBA 2BXTH 5FPTA 1XVMA 2BY7X 4KKDA 3ZZ3A 1VJAU 1NN6A 3GYMA 1ELFA 5E2PA 1TABE 1AGJA 1C5VA 2RDLA 4TPYA 3U8OH 2AEIH 1OWEA 2AMQA 1SFQB 2A2QH 4K5ZA 4X1PU 2FI4E 5E2OA 2SGPE 3EE0B 1GJAB 1FLEE 3BTEE 3C27B 4ZHLU 1ARCA 3LGTA 1ZR0A 1HBTH 2OBQA 1D9IA 2QN5T 1HJAC 1G32B 4HZHA 1C4U2 1FDPA 1YPEH 4D7FA 1LVOA 4ISHH 3F6UH 1EAIA 3SU1A 2J92A 2CMYA 4JYVH 5AFYH 2W3IA 3ZYEA 4K8BA 3SV2H 1HAVB 1YP9A 1T4VH 3UR6A 4WXVA 2C8WB 1F5KU 4NA7A 5EG4A 2XBXA 1T7CA 1KTSB 1TQ0B 5T3HA 3GCOA 1AO5A 2WYJA 1QRZA 1O32A 1MMJN 3M5NA 3VGCB 3AVZA 3RM2H 1MKXK 2EEKA 1N8OC 1HJ9A 1VITF 1W8BH 1W11U 1V2NT 3LGVA 4DT7B 2JKHA 3L3TA 2G52A 1AUJA 4A1TA 1VCWA 3MNCA 2ZFFH 1PQ5A 2SNWA 4MTBA 2YNAA 3QLPH 1TNKA 3AW1A 3OYPA 1GHBG 1O2RA 2ZCKP 2YOLA 3GCTF 1QTFA 4D8NA 2WPHS 1G37A 5FX6A 1VJ9U 4O3UA 2IN2A 1Y3VA 2GX4A 2R9PA 1GWAA 1XXDA 2BY8X 2D26C 5JPMH 3VB6A 1YCPK 2ANKH 2P59A 4X8VH 5A8ZA 2ZHWH 1U6QA 3OY5U 1O3DA 1THRH 2ZC9H 2ZTZA 3H7OA 4NIYA 4ZAEA 1GBDA 2FS8A 2FTMA 3SNAA 1HRTH 3E3TA 5DP6A 2XCNA 1QCPA 1K1MA 3LGIA 2IPHA 3A7YA 2IJOB 1WOFA 2A31A 1YPHE 1XX9A 2BDBA 2ILNA 2ZDAH 2HNTE 3STIA 1W0ZU 3UY9A 3A83A 1AZZA 1QA0A 1J17T 2IOTA 3A89A 3RXCA 1W7GH 5DG6A 2ZPSA 1QB6A 2Y7XA 5LGOA 1SI5H 1CA0C 3PTNA 1NY22 5JB8S 2A5AA 3TK6A 1GDUA 1CA8B 1EP6A 1EZQA 4GVUA 4NG9H 1YBWA 1KTTB 4K1TA 5K0HA 3JZ2B 1YKTA 2VH0A 1THSH 2G8TA 3PO1B 3RXDA 3AASA 1TNIA 3BTME 1UTOA 3E0NB 4B2BA 1ZPBA 1C1WH 5FPYA 1ZRBA 4O3TA 2Q6GA 3BG4B 3FP7E 2A0QB 4H4FA 1A4WH 1JWTA 2BX3A 3SV6A 4TWWA 1LHFH 3RC5A 2BZAA 1O2QA 3RMOH 5C20A 1V2UT 1MCTA 3ZZDA 3ESTA 1TOMH 2H2ZA 1IHSH 2BLWA 3B9FH 1ELEE 2G51A 3F9GA 2ZGJA 1B5GH 4Z6AH 4GPGA 1G36A 4HI3A 4LZ1H 1P2KA 1DT2A 2ASUB 4YOIA 3SOSA 3ATKA 3UPEA 1V2KT 1EOJA 4AYVB 3LOXA 1O3JA 3T28A 1Y5AT 2NU3E 3V0XA 1O2GH 1H1BA 4D7GA 1GI3A 3M36A 3PMBB 1IQFA 5GCHG 2Z9JA 3LPRA 4X8SH 4X6PA 3T25A 4WH8A 1K1JA 2AERH 3KQEA 1P2QA 1UTJA 2A7CA 4JZDH