2PTNA

On the disordered activation domain in trypsinogen. chemical labelling and low-temperature crystallography
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title On the Disordered Activation Domain in Trypsinogen. Chemical Labelling and Low-Temperature Crystallography
pubmed rcsb
molecule keywords TRYPSIN
molecule tags Hydrolase (serine proteinase)
source organism Bos taurus
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1981-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ptnA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ptnA02
3U8OH 4ABBA 2GV6A 2XCNA 3ZZAA 1FI8A 4B76A 4GHTA 1RIWC 2BVRH 2OXSA 3LT3A 2A7CA 1AKSA 3M7UA 2QXHA 3TIUA 2FI3E 4MNVA 1Y5AT 3A80A 3R3GB 3AAVA 2ZDAH 3N7OA 3VB7A 2XXLA 1UTLM 1D3PB 3F9FA 3QK1A 1EZUC 3RMMH 4E06H 1A5IA 1QQUA 4CRAA 1GVZA 3QZRA 5EPYA 4O9VA 5C1XA 1HYLA 1V2OT 1YCPH 1WUNH 3TGIE 1LCYA 3GDUA 4UE7H 1CQQA 1FPCH 3CENA 1FIWA 1MTNB 2ODQA 1MTSA 1GBTA 1W11U 1C1PA 1CSOE 4DGJA 1O0DH 5LPRA 2O8MA 4JZEH 2NU0E 4Y79A 3ITIA 1YPEH 2ZHWH 4HZHA 3UTUH 1D6WA 1TPAE 1Z1JA 1ABJH 1UK2A 2FOEA 4Y71A 3NWUA 1C1OA 1YYY1 5HMAA 3LPRA 1RGQA 1EUFA 1C4V2 1HGTH 2WYGA 1L1NA 1N6XA 1EAUA 1TRNA 4IN2A 4NIXA 6ESTA 1PYTD 3ZZBA 2J4IA 4HGCA 1XMNB 1GBCA 1HAYB 1LVMA 2ALPA 5T6DA 1RFNA 3GCTF 1YLCA 2GX4A 2ZFRH 1CA0B 2CV3A 1HJ8A 2WUCA 2WPJS 3DUXH 1G3EA 3RXIA 5TCAA 1GI3A 1PQ7A 1FV9A 4ZROA 1C2EA 4BAKB 1O2XA 2ANWA 2EC9H 2O8LA 3EA9A 3M37A 1C4Y2 1Z8RA 4ISNA 3G01A 3ZZ7A 4IC5A 4X1SU 2FESH 1D3DB 3S0NA 1RRKA 2F9VA 2J92A 1GBAA 3GDSA 1AHTH 5EQRA 1HV7A 1YPGH 3PTBA 3L33A 2GMTC 1TMUH 4Z6AH 3TH3H 1YPLH 2A5AA 4WMFA 2Y7ZA 1TALA 1HDTH 1QGFA 1Y8TA 1CO7E 3ZVCA 1CHOG 1YC0A 1EP6A 1MAXA 4DIIH 2B5TB 2G4TA 2QF0A 1DLEA 3SI4H 1NFXA 1JIMA 5EXNA 1FN8A 4UFDH 5DO4H 2FDAA 4AFZA 4I8KA 1ZMLA 2HWLB 5C67A 2A2XH 2ZCLP 4KTCA 1GMCG 1MKXK 2AYWA 2BDIA 2HNTE 4ISOA 3M35A 3B9FH 1FMGA 1TQ0B 1GBLA 1Y3YA 3MMGA 5CHAB 2XTTB 4X1RU 3T27A 2A45B 3ATLA 1ELDE 3SO3A 2GDEH 1TX6A 1FLEE 1DWDH 2QXIA 5FCRA 1QRWA 2ZZUH 3RMOH 2QC2A 3M36A 3LDXH 2BHGA 1GMDG 3D49H 4R0IA 2XC5A 3C27B 3B8JA 1CT0E 1KLIH 1NFYA 3QGNB 4HI3A 3MU5A 3P8NA 3SHAH 2Y5FA 2ZU5A 1MKWK 2ZC9H 1N1LA 1YPJH 4K3JA 3QZQA 4D9RA 1GJ4H 4TY7A 5F03A 1CBWB 2BMGB 1Y3XA 4IMZA 3STIA 1HPGA 1QJ6B 2ZTYA 2PGBB 1C5UA 1TRMA 3PO1B 3PMJA 1OP2A 1BOQA 3ELAH 4OGXA 1KXBA 1SHHB 1YBWA 2PHBA 3E6PH 3EAJA 2FLRH 2BQ6B 2IJOB 1E34B 1S83A 2Z9GA 2PTNA 2AGIX 1TFXA 2XYAA 4NSVA 2FWWA 1OSSA 1C2FA 1O5FH 3STJA 3KGPA 4LZ4B 1V2NT 5GWZA 3PLPA 5EQQA 4BXWA 3PMHB 3A7VA 1BDAA 2GZ7A 3ZZ9A 4BTIB 4MG3A 2AIQA 3MFJA 1NN6A 4FUCA 1B7XB 1A7SA 1O3GA 4CBNA 2W7UA 3SJ8A 4X6MA 4MPXA 1ARBA 1EQ9A 3DFJA 2XRCA 1O2KA 4Y0YE 2QAAA 3M3SA 1DITH 4Y7AA 3O8DA 1FJSA 1MCVA 2TRMA 1TABE 1X7AC 1LDTT 7LPRA 4X8UH 3D23A 3S9AA 3EA8A 1P2NA 2ZDKA 1ELEE 2H9HA 5HYOA 3AASA 1AZ8A 1PQ5A 1C2MA 5AVDA 3GYMA 1OWJA 2GCTC 1XKBC 2V3HH 1TGTA 3I78A 1KLJH 2BDBA 4MNYA 4INKA 5EW2H 1ESAA 4E7RG 4B75A 1V2KT 1DXWA 3ZZ8A 1A5GH 1YLDA 2R0LA 1H8IH 1GI4A 2PSXA 1F5KU 3HPTB 3ZV8A 2HVXA 3SNDA 4ZHAA 3TPIZ 3BTWE 1GL0E 3LGWA 5E0HA 2W7SA 1O2OA 4A1VA 5I25A 1OWEA 2TPIZ 3GY7A 1GGDB 1OP0A 1BB0B 3A82A 3EYDA 2EI7A 2QXJA 5L2YH 1GBIA 3LOXA 1ELGA 3BSQA 1MTWA 4IC6A 5EQSA 2DE9A 4INHA 1WV7H 4DY7B 4YLQH 1QA7A 3OYPA 1O5CB 4JYVH 1O2UA 2QIQA 4KGAA 1BQYA 2QGRA 4HFPB 2QF3A 2P8OB 1P11E 3DHKH 2A4GA 1IAUA 1LHGH 4NFEA 1GHZA 3P8GA 3BG4B 4FUJA 3RXJA 5JB9S 3OY6U 2BY9X 3BEIB 3TVJB 1J14A 2A1DB 2G5NA 4A5TS 4B73A 2TGDA 4I31A 5FPYA 5HM2A 2CHAC 2H2ZA 4JYTA 1O3IA 1A46H 1T4VH 2BY7X 2VWMA 2FOFA 1O3PB 3T29A 1CT4E 1HFDA 1QQ4A 2AEIH 1SGQE 3A88A 1TE0A 3B23B 1E35B 5I46H 2GCHG 3SNBA 1EX3A 3TJOA 1UO6A 2QA9E 1QTFA 2WUBA 2WYJA 1OWDA 5C3NA 1OYQA 1ESBA 3MO3A 4X6NA 4WMEA 1SG8B 1E36B 5T6GA 1O2IA 1MCTA 3SZNA 1QCPA 5FX5A 4LOYH 1BITA 7GCHG 2ZU3A 1GJDB 1VITF 2H5DA 1LPKB 2XW9A 1P9UA 2PKAA 3SU6A 2P95A 2XBVA 1O3HA 1HNEE 1BTHH 1SOTA 1ZMJA 1M9UA 2V6NA 2FI4E 1EPTC 2Y80A 4MDSA 3E1XB 3M61U 2QY0B 1Y59T 2XBXA 1SGIB 2VWLA 4CR5A 2P16A 1FY1A 3T2NA 1BMMH 1HAZB 2BLQA 3FP7E 2HGTH 4BAQB 1V2RT 1NS3A 2CXVA 2ZU1A 4OS6A 1J15A 2W5EA 5JDUB 1J9CH 2OQUA 3RXLA 3BIUH 2OC1A 3A87A 3LGUA 2R3UA 1ZJKA 2HOBA 1G3CA 4LZ1H 4X1NU 4GVUA 4FU8A 1VZQH 3LJOA 1C5MD 1MBMA 2WPHS 4SGBE 1T8OA 1HUTH 1KSNA 3RXTA 1K1LA 4JMYA 1TOCB 2ZPSA 2BZ6H 1LQDB 3RXEA 3RC5A 5L2ZH 2CGAA 1GJAB 3ZV9A 4ISLA 1GG6C 1NRQH 1GBMA 1FPHH 3M5LA 1GHWH 3SW2B 4TPYA 2BDAA 1G2LA 1BTYA 2OD3B 3MI4A 1TPPA 3A84A 1ARCA 3A8DA 5BRRE 1VGCB 2IOTA 3U1JB 1HJ9A 3QUMP 4WH6A 3GOVB 3T26A 1ZZZA 3GY4A 3DFLA 3SV6A 2GVFA 6CHAB 3CP7A 1PPEE 2G4UA 1KDQB 2XWAA 8GCHF 1EJMA 1VJAU 5E0GA 3SUFA 2BY8X 3UREA 5A2MH 1BRAA 4B2CA 1MQ6A 6GCHG 1NU9A 1O2NA 3Q3XA 1VCPA 1TB6H 1C2DA 2BOKA 1V2WT 7ESTE 1PPBH 4AG2A 4CR9A 4X6PA 3SU2A 1LVYA 1O36A 2C8WB 2A0QB 4KKDA 5C5OA 2FOGA 5EGMA 1IOEA 1NC6A 2Z7FE 2Z9KA 1MTNC 1AIXH 2ODYB 1TBQH 3RC4A 5CE1A 1FUJA 1MU8B 1RTFB 1L0ZA 3Q76A 2OINA 2F9OA 2EEKA 4NCYA 4ZKSU 3QGJA 1GI6A 4BXSA 1K2I1 1QL8A 4B71A 1NY22 3FP8E 2SNVA 3E8LA 1FXYA 3A89A 3A8AA 4Q7YA 1YPHE 2J38A 1UVTH 1IQFA 1O2YA 4NGAH 2F9PA 2JETC 4AGKA 3E90B 1CVWH 2WV4A 2HPPH 1G30B 1W12U 1S6HA 1QNJA 4YO9A 2BLVA 4CH2B 2FX6A 4X2YA 2VIVA 1O2JA 1IQJA 1T8MA 4MNXA 5AHGH 1P05A 1F0RA 2ZU2A 3UNSA 1SGYE 1JRSA 1O5EH 4H6SB 5EODA 2AERH 4I33A 4KP0A 3S7HB 3KEEA 1TNLA 2ZNKH 5AFZH 1KXCA 5DP4A 1E37B 4AZ2B 2BDCA 4R8TB 1EJAA 1YF4A 3RC6A 1UTQA 5IDKA 1QA0A 4DG4A 2PTCE 4X8VH 1P2OA 2BVSH 2ZTZA 1XX9A 1UTJA 1QJ1B 1V2ST 4X1QU 1QL9A 3GY5A 2PUXB 4ZUHA 1C2LA 3MNCA 1GJ8B 4X2VA 3NPSA 2A7JA 4ABDA 4ZMAH 5JBTA 2IPHA 5A0BA 1BIOA 2BD5A 1HLTH 1LPZB 5GXPA 1J16A 1LO6A 2AMQA 3Q77A 2PR3A 3ATMA 5GJ4B 1QRZA 3ZVGA 1AE8H 2XWBI 3P92A 3BEFB 4ABJA 1JRTA 2OLGA 4KELA 4K8YA 5TCCA 3FZZA 1S82A 1C1VH 2I6QA 4A1TA 2FP7B 3NKKA 1A4WH 2BQ7B 1XXFA 3FAOA 3RXFA 2FX4A 1O3AA 2TGTA 1DOJA 1ZJDA 2G00A 1W10U 1UK4A 3QLPH 1SFQB 1W2KH 2AGEX 3MU4A 1GI2A 3ESTA 3ODFA 1S0QA 2FOHA 3DT0H 1O2LA 3QN7A 1MBQA 1C1NA 3K65B 3LH3A 2Y82A 4X6OA 1H8DH 1HIAB 2V3OH 4BNRA 2J95A 3ZVEA 1DSTA 5F8XA 3MH7A 1EASA 1V2UT 4HTCH 1NTPA 2SGDE 3MU1A 2ZHEH 3VB6A 1N8OB 1G32B 2HALA 3LGTA 4UFEH 1AFEH 5DGJA 1O5BB 1LMWB 1TX8A 1UJ1A 1ZGIA 1TQ7B 2BDHA 1RXPA 4JYUH 2Q6FA 2FIRH 1T8NA 3P8OA 3S9BA 1EATA 5FXLA 2BQWB 4NA9H 1B0FA 1GCDA 1A3EH 2FLBH 4K1TA 4GCHG 5DP5A 3MH6A 1KTTB 1EZSC 1ZYOA 3VPKA 1F7ZA 1QB9A 1O34A 1HAIH 2F91A 2Y6TA 3SU4A 5C2ZA 2ZQ2A 3VGCB 2VWNA 2D1JA 1LHCH 3TNTA 1C1TA 2ZDMA 3LIWA 2JKHA 3W94A 2UUJB 1BTXA 3VB5A 1MTVA 1ELCA 5T3HA 1DWCH 5JBAS 1GMCF 2GTBA 5SGAE 3SUDA 1GJCB 4VGCB 5EOKA 2SFAA 1DDJA 3TITA 3P17H 5DK1A 3KIDU 1K1OA 4NG9H 3M5MA 3O8RA 4I8LA 1MD8A 3A7XA 1GBFA 1ELBA 4Q80A 1INCA 2BD8A 2VVVA 1TMBH 2XBWA 4WH8A 1UK3A 1O2PA 4Y6DA 3T25A 2H6MA 1UCYK 1C2KA 1GVKB 3BN9A 2FZZA 3SUEA 1AB9B 1O5GH 1SQTA 2GV7A 4QT8C 2HNTC 1HAHH 2VIDA 3SJIA 1EXFA 1TNKA 1C9TA 1UCYE 4YT6H 5C5NA 1SGEE 2BTCE 1ZPBA 4ZAEA 4CRCA 3NXPA 1PPCE 3A7YA 1P02A 1NO9H 1FY5A 1UMAH 4OS7A 2GDDA 1HAXB 1G9IE 1K22H 2GZ9A 3PROA 1ANDA 5F8TA 4I8JA 3LU9B 1P2MA 1B5GH 3P6ZB 2ZFTA 4TY6A 4ZKRU 4Y11E 2Z6BD 1Q31A 1HJAB 1GVLA 1IQMA 1CHGA 3OSYA 5GPIB 2QN5T 2VGCC 2QYIA 5T6FA 1MMJN 1HAVB 1O31A 2A5KA 1GBKA 2ZFPH 3UOUA 1EAIA 1V2PT 2F9BH 3SU1A 4DOQA 1GJ7B 3GICB 3VB3A 3BG4C 3EDXB 2IN2A 1O2HA 5AFYH 2BOHB 2G81E 1P2QA 3ZVAA 1K21H 1TMTH 1W7XH 1ELTA 1AMHA 1FQ3A 1OPHB 3O8BA 3MNBA 1MKXH 3V12A 1O2QA 3KHVA 3GCNA 2ZTXA 1W8BH 2PW8H 4Q7XA 1DPOA 1ANBA 2ZA5A 1DY9A 1FNIA 2BD3A 1GMHF 1P3EA 2FOAA 2I6SA 2EI8A 1O2GH 2JH0D 2ODPA 3W95A 4OS4A 4ABAA 1AFQB 1O3JA 1AY6H 1W13U 3RU4T 1QRXA 5LPFA 1HXFH 1IQHA 1K1PA 4FUGA 2SNWA 2F83A 2PFEA 2WPKS 2CN0H 1QBNA 5DP3A 4O97A 1C1SA 1FIZA 1RIWB 5ESBA 1OKXA 2C8XB 3MU8A 2ZEBA 2Z3EA 2A4OA 3R0FA 2ZPQA 2AH4X 4OS5A 1TAWA 1ZGVA 1MKWH 1BHXF 2HPQH 1GHVH 1RS0A 1XUKA 3NZIA 1HAPH 2J9NA 1G37A 1BBRK 3T5FH 3T28A 3RM0H 1V2MT 1C5XB 2BLOA 4YOGA 5G4BA 4Y8XA 4YT7H 4WXIA 1H4WA 3SV7A 1C5WB 4FUBA 1GBEA 1TIOA 1BBRE 1GWAA 1ELVA 2ESTE 1ZHPA 5FPSA 1O2TA 5HM9A 3KQBA 1IHTH 2KAIB 2SGEE 1O3FA 1WTHD 3O8CA 2RA0A 4RKOB 3KCGH 3ATIA 1ANEA 3A83A 1JMOH 2NU4E 4ABEA 4ZHLU 3GY6A 1P8VC 2Z3CA 3IG6B 3E3TA 1NRRH 1XVOA 2BD7A 3CS7A 4FUFA 3VB4A 1JOUB 1P12E 1Y3UA 4XBCA 2Z9IA 2H1UA 4ISIH 1QR3E 1ZRKA 4DT7B 4UFGH 2Q6GA 3NCLA 1DUAA 4NSYA 1ZSLA 2K1QA 3MNXA 3TK9A 3RXSA 3E91A 1UHBB 4FU9A 1C5LH 1EZQA 1IQLA 1RTLA 1GHBF 3ZZ4A 5C1UA 1P09A 4Q2KA 1S84A 5DKMA 4D8NA 1ABIH 4U01A 4Z0KA 1CU1A 1SLWB 3H7TA 4JZDH 5GCHF 2GCHF 1JWTA 3URCA 4YM9A 1QL7A 5A8YA 3TLOA 2W3KA 3S9CA 2FYRA 2RCEA 2ZGHA 2ZIQH 1TBRH 1P03A 4CHAC 5FCKA 5F6MA 1O33A 1YPKH 7GCHF 3V3MA 2P94A 1FAKH 4OS2A 1O5DH 2FS9A 8LPRA 1HAGE 2GKVE 1HRTH 1P57B 3PLBA 4NFFA 4UONA 2P59A 1O3MA 4B2AA 1XUJA 2HNTF 1BMAA 1SGTA 2A4QA 1A0JA 1QY6A 1L1GA 4AB9A 1WSSH 3U8RH 2ZQ1A 1DSUA 1OS8A 1W0YH 3UOPA 1Y3WA 3PLKA 4BAHB 3C1KA 3MO9A 3SHCH 1S85A 1TGSZ 3PWBA 4CRFA 4K1SA 1SGFA 1O2MA 2D8WA 3Q3YA 1BMNH 2RA3A 4BAOB 4UD9H 2GGVB 1SQAA 2ZPRA 2OTVA 3M3VA 4JK5A 1BTWA 3V13A 5J4SA 4B1TA 4MVNA 3RXHA 3UY9A 1DFPA 2FOBA 3F68H 3QDZB 3GYLB 2V0BA 2ZECA 4UFFH 3ATKA 1O2RA 1AUTC 3I29A 3SN8A 1GI0A 2PV9B 1SC8U 3L3TA 2J2UA 4H4FA 2NU3E 2V35A 1FDPA 4LXBH 2ZFQH 3SJOA 3ZYEA 1PFXC 2BX4A 2FYQA 1GHYH 4FXGH 1GI5A 4Y76A 1RD3B 2OBQA 2PWXA 3KF2A 2R3YA 4Y10E 2A31A 1K1MA 8KME2 4O03A 1O3CA 1ESTA 1Z7KA 2ZHDA 2BDYA 4XE4A 4AGJA 4XFQA 1S6FA 1F0UA 3EA7A 1D3QB 3BTDE 4AB8A 1AO5A 4IGDA 4DIHH 4ABIA 2UUKB 2R2MB 1DUEA 2QV1A 4INLA 3MH5A 1U6QA 4F4OC 1EJNA 2FPZA 3A8CA 3QTOH 1OYTH 1QIXB 1GCTB 4K60A 3PM3A 3U98H 3KNXA 3WY8A 3TK5A 2THFB 3ODDA 3RUOA 3RXQA 2J94A 1YKTA 2VVUA 1AUJA 5AF9H 2STBE 3F1SB 4UEHH 1PPGE 1SLUB 4BANB 2XBYA 4YESB 2FODA 2A32A 5FX6A 2XNIA 2ZHFH 1SI5H 1H1BA 4Y8YA 2CF8H 1V2LT 1C5YB 1GI1A 2H5CA 5GIBA 3JZ2B 1Q3XA 4I8GA 3PMBB 1T31A 2GCTB 2UUFB 3A7WA 2Z9LA 1GL1A 1C1MA 4F49A 5HXFA 1SHYA 5LPEA 1O38A 1NPMA 2Q1JA 1KXAA 1W0ZU 3F9EA 5E2PA 1NRPH 1W3CA 1PPFE 3SBKA 2XC4A 2WINI 1ZTJA 1VITG 2PKSC 2F9UA 3FFGA 1EOJA 5DG6A 2GD4B 2ALVA 4DW2U 4JZ1A 2BY5X 1LHFH 1CGIE 2ANYA 9ESTA 1OWIA 1S81A 3EQ0H 1YCPM 3HKIB 1AVXA 3A7ZA 4GPGA 2LNCA 1C2JA 2ZCHP 2B0FA 3RXRA 1MQ5A 4RKJB 1UTMA 1QB1A 4SGAE 1CGJE 1A1RA 2GP9B 1RJXB 1YP9A 3GISB 1SVPA 4BTTB 1ELAA 3MOCA 1OWKA 2G51A 1O30A 1Z8JB 1N8OC 1FY3A 4RN6A 1F0TA 1KDQA 1WTGH 4FVBA 3TJUA 4WMDA 4CRGA 1MTUA 1G3DA 1YPHC 3DA9B 4NIVA 2O8TA 3BTME 3NUMA 3LC5A 1YGCH 1BRUP 1AQ7A 2WPIS 1DLKB 3PB1E 2STAE 2PUQH 3GY8A 1ZSJA 1LHEH 2OC7A 5C20A 3ZVBA 1O3NA 4MLFB 3LKWA 1GHAF 3QWCH 3SNEA 4AOQA 3ATWA 4AFQA 1DXPA 3BTQE 1AZZA 1T7CA 1V3XA 2FTLE 1THRH 3VGCC 1P04A 4K2YA 2C4FH 1NROH 5EG4A 1F5RA 3H5CB 1L4DA 3RXPA 2WV5A 3SNAA 2FOMB 2ZU4A 2VNTA 4VGCC 1Q2WA 1C1QA 1E38B 3KQDA 3OX7U 1CA0C 4J1YA 1THSH 1WAYB 5E8EH 1GI7B 1TNHA 3UWIA 5A0CA 4AX9H 8GCHG 4AN7A 1LTOA 1O2VA 2ZI2H 4X8SH 2ZGCA 1SGDE 3V7TA 4IS5A 1GJBB 2FO9A 1YPMH 4JK6A 4U2WA 3Q3KA 4TWWA 1EKBB 2ZGBH 1ETSH 1V2TT 3RMLH 1J17T 1EPTB 1EZXC 1WBGB 3P70B 2B8OH 5HGGA 1F92A 2Z94A 1QBVH 2BDGA 2NWNA 5J4QA 4OS1A 2AIPA 4GLYA 3TJNA 1PYTC 2VB0A 3PMAB 1MU6B 2ZGJA 1VR1H 1O5AB 3SQEE 1HJAC 3MWIU 2TGPZ 1IQGA 1UTKA 5E2OA 3OTJE 1Z1IA 2A5IA 3PTNA 1IHSH 3PV4A 5CHAC 1TNGA 1O39A 1ZPZA 4AFUA 1UTNA 5DP9A 3ZZDA 3RXDA 3JZ1B 4OGYA 1WQVH 2FXRA 1J8AA 5E0JA 1T8LA 4YZUA 2VINA 4FUDA 4WJG2 1NZQH 1PJPA 1TA6A 4K69A 2PSYA 4NIWA 4YOIA 4A7IB 1ELFA 4E05H 1GJ6A 1ZRBA 3RXOA 3BTKE 4K8BA 1SMFE 1AKSB 1NRSH 1CBWC 3TU7H 2B7DH 1V2QT 1MZAA 1C5NH 3IWMA 1HIAA 3PO1C 1YCPK 2BD2A 4ABGA 4MNWA 3FZDA 2OBOA 2Z3DA 2AGGX 1AN1E 2Q6DA 1C5PA 3PYHA 1OP8A 1K1NA 1DWBH 2OUAA 5FBEA 1QBOA 1AE5A 5K7RA 1GHXH 1QJ7B 1TNIA 1N6YA 3RP2A 4IBLH 2YNBA 4DJZB 1P2IA 2BM2A 1O3LA 2G52A 3RXGA 3RXVA 2OCVB 1HAOH 1PQ8A 1V2VT 3P95A 9LPRA 3HATH 3UFAA 4IW4E 4X0WU 1S0RA 1CHOF 5EXLA 3ENSB 4I7YH 2SGAA 1GBBA 4FUHA 4Y0ZE 1Z8GA 4K5ZA 1HBTH 4H6TA 2G8TA 4E7NA 3DD2H 3A8BA 2VIPA 2ZF0H 3SV2H 3A81A 2ZDLA 3BTEE 4H42U 1NT1A 1SGCA 2SGQE 2C93B 1FAXA 1L2EA 4NZQA 1T4UH 3SU0A 5EXMA 2AMDA 3A86A 3A85A 1AVGH 2VJ1A 2ZCKP 1MAYA 3BTGE 1TPOA 3D65E 3T62A 4NZLA 1GBHA 2JETB 1BRBE 1Z71A 2M5TA 1GMDF 3HKJB 5DP7A 2TIOA 1NFUA 3LGVA 2Z9JA 1OOKB 4WWYA 1FZZA 5FPTA 2VH0A 2Y81A 3F9GA 3LGYA 3RXKA 1GDUA 1GGDC 2NU2E 1GJ5H 1UCYH 1OXGA 4KTSA 1UTPA 4CREA 1C2GA 1XUIA 4TPIZ 2BD9A 1TBZH 1Z6JH 1BTZA 3UNQA 3SGBE 1LKBA 1V6DA 3ZZ6A 4DVAU 4ZXXH 3MYWA 3MH4A 2OC0A 5B6OA 2P8OC 4BTUB 2RG3A 3S69A 3V0XA 1NM6A 2OQ5A 1P2KA 5DP6A 2Y7XA 3GCOA 3LJJA 1E0FD 3GCHB 3HGPA 2PLXA 5JPMH 1BRCE 3URDA 3E0PB 2H9TH 3OU0A 3AVZA 3GCTG 3SQHE 1HAVA 4WY3A 1OX1A 3TGJE 3RDZA 2TBSA 2G55A 3U69H 4M7GA 2ILNA 3KN2A 1BCUH 1BHXB 3BV9B 2DE8A 2UUYA 3SU5A 3F6UH 1O3BA 3QTVH 1HB0B 1SL3A 2CF9H 1LQEA 1O3KA 1DANH 2JH6D 1C5QA 4D7FA 2O8UA 4J2YB 1D6RA 1LHDH 1FY8E 1K1JA 3RM2H 5JBBS 1K9OE 1TLDA 1Z6EA 2EA3A 4ABFA 5L6NH 1K28D 4X1PU 1SBWA 1TWXB 1ZMNA 2ZHQH 3EE0B 3UUZA 3UPEA 4NIYA 4FUIA 1C2IA 1TNJA 2VIOA 3P8FA 2VVCA 1XXDA 5A0AE 2GT8A 4B2BA 3RLYH 1LVOA 1KXDA 1KY9A 2BVXH 1F2SE 3AW0A 1VITH 1ZHMA 2LPRA 3HGNA 1C5OH 4AYYB 1B0EA 2CJIA 3AW1A 1O3DA 3OY5U 3EGKH 5JB8S 3KL6A 4MPVA 1PQAA 1YM0A 3RXMA 1QFKH 5DJ7A 3MHWU 1SOZA 2SGFE 1BBRH 1GCTC 3H7OA 1NU7B 2R2WU 4GUXA 4CRBA 1AWHB 4THNH 2KAIA 4XDEA 5F8ZA 2P93A 4D76A 1TGCA 1WOFA 2ASUB 1SSXA 2GT7A 2BZAA 3SGQE 4B74A 1EOLA 3NK8A 3S7KB 1BMLA 1MUEB 4AG1A 1SQOA 1LKAA 1GMHG 5EU8A 4ZXYH 4X8TH 2ANMH 3RU4E 4ZKOU 3U8TH 3K6YA 1L1JA 3VFEA 1EB2A 2FMJA 1SR5C 3SGAE 2H9EH 3M3TA 2D2DA 3HK6B 1XM1A 2Y5GA 1UHBA 1ZTLA 3M7TA 3SNCA 3SORA 3MO6A 5EW1H 1VGCC 3LGIA 1Y5BT 2VIWA 1QB6A 1P01A 3VXEH 1KYNA 1FY4A 1C1UH 5FAHA 3K6ZA 4ZHMU 2FI5E 2VIQA 3LH1A 2GMTB 1RTKA 4MPUA 2ZFSA 2CMYA 3TH4H 6CHAC 1O3EA 1MH0A 1O37A 3VEQB 3U9AH 1C9PA 1GJ9B 3KQEA 2RDLA 1EAXA 4PROA 1O3OA 3L6PA 2FEQH 1LPGB 2P3FH 1XUGA 4NWLA 4AFSA 2AFQB 2OP9A 1Z8IB 4WVPE 3RLWH 3RMNH 3UIRA 2PGQB 2VU8E 2FM2A 4AORA 4ASHA 6LPRA 1A61H 3BTFE 4TWYA 4ABHA 2BB4A 2VGCB 3RU4D 2FTMA 3UNRA 1CE5A 1ZLRA 1AVWA 1TONA 1IQEA 1T32A 1NESE 1PPZA 1DE7H 4ZKNU 1AI8H 1C1RA 4ISHH 5DPAA 1DY8A 3LONA 4CH8B 5EPNA 3SJ9A 3AAUA 1GHBG 2C3SA 3BEUA 4X2XA 1VCQA 4YTAA 3UWJH 1FN6A 2F3CE 3FP6E 1G36A 3F9HA 1WCZA 1P10A 2BXUH 1QHRB 1DVAH 3RXBA 4NA7A 1TX7A 2HRVA 5GCHG 1ZPCA 1GDQA 1A0LA 4NA8A 1AWFH 3Q00A 4XBDA 2PKAB 1W14U 1WU1A 3M5OA 1IQIA 4BAMB 4WXVA 1TGNA 2ZKSA 4NWKA 5BPEA 3ZYDA 1EAWA 5A8ZA 2ZDNA 3A7TA 4U30A 1BJUA 1TGBA 2BY6X 3RXUA 4I8HA 1XUFA 2ZGXH 1VJ9U 3UR6A 1SGPE 4YOJA 1BJVA 4YLUA 3BTTE 1THPB 2VH6A 3TK6A 4FUEA 3ZVFA 2R9PA 5FBIA 1MZDA 1P3CA 1CT2E 1G3BA 2C90B 2QXGA 4MPWA 5TJXA 4A92A 1ETTH 5C1YA 3U1IB 2ANKH 1O2WA 1TPSA 1JXPA 1DICA 5H4IB 5PTPA 2B9LA 6GCHF 3ZZ5A 2HLCA 1SFIA 1XKAC 4O3TA 1XUHA 1TA2A 3SV9A 3BTHE 1C5SA 5JBCS 1UTOA 1ACBE 1ZTKA 4XBBA 3BF6H 3SU3A 3TJVA 1SB1H 3CS0A 3ZZ3A 3K2UA 1DS2E 1TOMH 3GY2A 2AS9A 4JZFH 1KXEA 3SUGA 3SOSA 1GBDA 2A4RA 4A6LA 2NU1E 2J34A 5CMXH 1AGJA 2OC8A 5A09A 4IN1A 1ETRH 1BUIA 1C1WH 3M7QA 1IQNA 2BYAX 1JIRA 3I77A 1H9IE 1H9LB 1SGFG 1G2MA 4XSKU 2AMPA 1K1IA 3PWCA 2C8ZB 3UQVA 2ZFFH 1ZR0A 1P9SA 5LH8A 4JZIA 4Q7ZA 4MQAA 3SI3H 3VXFH 4Y8ZA 2WPMS 1BZXE 2Y5HA 2ZDVH 3GY3A 1IQKA 1ZSKA 2P3UB 4CHAB 1O2ZA 1AD8H 2W26A 3K9XB 1DX5M 1ZHRA 1D9IA 3D62A 4TYDA 4XOJA 1SGRE 1HXEH 4BOHA 2BX3A 2QCYA 1L4ZA 1SLXB 1KLTA 1EP5A 4ZH8A 3TNSA 3FANA 1C5ZB 1UVPA 3QO6A 4DURA 2TGAA 2CHAB 4AYVB 1KXFA 2O9QA 2R0KA 1SLVB 4D9QA 3UR9A 1C5TA 1WYKA 3RXCA 4CBOA 1P2JA 1H9HE 1O2SA 2YOLA 1XVMA 3KQCA 4ESTE 1W7GH 1UVSH 1C2HA 3IITA 2BLWA 4FVDA 2SGPE 1ANCA 2BD4A 3RXAA 3FVFB 1GDNA 1P0SH 2UWOA 1GI9B 1A5HA 1ID5H 3BG8A 1A0HB 3SJKA 3M5NA 5A8XA 3SV8A 4O3UA 1GBJA 1O32A 5ABWA 1SGNE 4DCDA 1KIGH 1A2CH 2UWLA 1KTSB 2DUCA 1WQSA 2WPLS 1UVUH 1CA8B 1AB9C 1Y3VA 4IMQA 5LGOA 1TRYA 2W3IA 1BT7A 3E16B 1BTUA 4GAWA 2EI6A 1MD7A 2O8WA 1HCGA 1O35A 1GPZA 4CRDA 5IYTA 2YNAA 2ZO3H 1V2JT 4Y7BA 1P06A 1GI8B 2A7HA 1FONA 3GDVA 4FU7A 4I32A 4K1EA 3UQOA 3TH2H 1DT2A 2JH5D 3E0NB 5JYIA 1S5SA 1EPTA 2ULLA 3QX5H 5DP8A 1TYNA 1BA8B 4D7GA 4X2WA 2ZP0H 1GHAG 1UVOA 2FS8A 2GZ8A 1OWHA 4WF8A 2A2QH 3TGKE 1DM4B 2F9NA 1JBUH 3MU0A 2ZG0H 2XC0A 4JCNA 5L30H 5ESTE 4GSOA 1D4PB 4A1XA 3ZZCA 3ZVDA 1C4U2 3MNSA 2XCFA 4GCHF 3GCHC 1CGHA 1PPHE 2D26C 1QURH 4UDWH 5ETXA 5K0HA 1SPJA 2FOCA 8ESTE 2ZWLH 7KMEH 1NFWA 4U32A 3MTYA 1GG6B 1Y5UT 1C5VA 2UWPA 2P3TB 1F0SA 4RSPA 3LC3A 5FHTA 4MTBA 1A3BH 5GDSH 1BTPA 1F5LA 2G5VA 4KTUA 2PKSB 1ZOMA 3HK3B 2VWOA 1DWEH 1C5RA 1AFQC 1LVBA 2C8YB 3BIVH 1VCWA 1AU8A 1EB1H 1D3TB 4LK4A 1ORFA 2BXTH 1NRNH 4GHQA
chains in the Genus database with same CATH superfamily
3U8OH 4ABBA 2GV6A 2XCNA 5EJ1A 3ZZAA 1FI8A 4B76A 4GHTA 1RIWC 2BVRH 2OXSA 3LT3A 2A7CA 1AKSA 3M7UA 2QXHA 3TIUA 2FI3E 4MNVA 1Y5AT 3A80A 3R3GB 3AAVA 2ZDAH 3N7OA 3VB7A 2XXLA 1UTLM 1D3PB 3F9FA 4P00A 3QK1A 1EZUC 3RMMH 4E06H 1A5IA 1QQUA 4CRAA 1GVZA 3QZRA 5EPYA 4O9VA 5C1XA 5CDFE 1HYLA 1V2OT 1YCPH 1WUNH 3TGIE 1LCYA 3GDUA 4UE7H 1CQQA 1FPCH 3CENA 1FIWA 1MTNB 2ODQA 1MTSA 1GBTA 1W11U 1C1PA 1CSOE 4DGJA 4RI0A 1O0DH 5LPRA 2O8MA 4JZEH 2NU0E 4Y79A 3ITIA 1YPEH 2ZHWH 4HZHA 3UTUH 1D6WA 1TPAE 1Z1JA 1ABJH 1UK2A 2FOEA 4Y71A 3NWUA 1C1OA 1YYY1 5HMAA 3LPRA 1RGQA 1EUFA 1C4V2 1HGTH 2WYGA 1L1NA 1N6XA 1EAUA 1TRNA 4IN2A 4NIXA 6ESTA 1PYTD 3ZZBA 2J4IA 4HGCA 1XMNB 1GBCA 1HAYB 1LVMA 2ALPA 3MQKC 5T6DA 1RFNA 3GCTF 1YLCA 2GX4A 2ZFRH 1CA0B 2CV3A 1HJ8A 2WUCA 2WPJS 3DUXH 1G3EA 3RXIA 5TCAA 1GI3A 1PQ7A 1FV9A 4ZROA 1C2EA 4BAKB 1O2XA 2ANWA 2EC9H 2O8LA 3EA9A 3M37A 3KQ5A 1C4Y2 1Z8RA 4ISNA 3G01A 3ZZ7A 4IC5A 4X1SU 2FESH 1D3DB 3S0NA 1RRKA 2F9VA 2J92A 1GBAA 3GDSA 1AHTH 5EQRA 1HV7A 1YPGH 3PTBA 3L33A 2GMTC 1TMUH 4Z6AH 3TH3H 1YPLH 2A5AA 4WMFA 2Y7ZA 1TALA 1HDTH 2K8IA 1QGFA 1Y8TA 1CO7E 3ZVCA 1CHOG 1YC0A 1EP6A 1MAXA 4DIIH 2B5TB 4Q63A 2G4TA 2QF0A 1DLEA 3SI4H 1NFXA 1JIMA 5EXNA 1FN8A 4UFDH 5DO4H 2FDAA 4AFZA 4I8KA 1ZMLA 2HWLB 5C67A 2A2XH 2ZCLP 4KTCA 1GMCG 1MKXK 2AYWA 2BDIA 2HNTE 4ISOA 3M35A 3B9FH 1FMGA 1TQ0B 1GBLA 1Y3YA 3MMGA 5CHAB 2XTTB 4X1RU 3T27A 2A45B 3ATLA 1ELDE 3SO3A 2GDEH 1TX6A 1FLEE 1DWDH 2QXIA 5FCRA 1QRWA 2ZZUH 3RMOH 2QC2A 3M36A 3LDXH 2BHGA 1GMDG 3D49H 4R0IA 2XC5A 3C27B 2KX4A 3B8JA 1CT0E 1KLIH 1NFYA 3QGNB 4HI3A 3MU5A 3P8NA 3SHAH 2Y5FA 2ZU5A 1MKWK 2ZC9H 1N1LA 1YPJH 4K3JA 3QZQA 4D9RA 1GJ4H 4TY7A 5F03A 1CBWB 2BMGB 1Y3XA 4IMZA 3STIA 1HPGA 4TT3D 1QJ6B 2ZTYA 2PGBB 1C5UA 1TRMA 3PO1B 3PMJA 1OP2A 1BOQA 3ELAH 4OGXA 3FO8D 1FX0B 1KXBA 1SHHB 1YBWA 2PHBA 3E6PH 3EAJA 2FLRH 2BQ6B 2IJOB 1E34B 1S83A 2Z9GA 2PTNA 2AGIX 1MABB 1TFXA 2XYAA 4NSVA 2FWWA 2W6JD 1OSSA 1C2FA 5F53A 1O5FH 3STJA 3KGPA 4LZ4B 1V2NT 5GWZA 3PLPA 5EQQA 4BXWA 3PMHB 3A7VA 1BDAA 2GZ7A 3ZZ9A 4BTIB 4MG3A 2J98A 2AIQA 3MFJA 3WW7A 1NN6A 4FUCA 1B7XB 1A7SA 1O3GA 4CBNA 2W7UA 3SJ8A 4X6MA 4MPXA 1ARBA 1EQ9A 3DFJA 2JDID 1O2KA 2XRCA 2QAAA 4Y0YE 3M3SA 1DITH 4Y7AA 3O8DA 1FJSA 1MCVA 2TRMA 1TABE 1X7AC 1LDTT 3DSOA 4X8UH 7LPRA 3D23A 3S9AA 3EA8A 1P2NA 2ZDKA 1ELEE 2H9HA 4ASUD 5HYOA 3AASA 1AZ8A 1PQ5A 1C2MA 5AVDA 3GYMA 1OWJA 2GCTC 1XKBC 2V3HH 1TGTA 3I78A 1KLJH 2BDBA 1W0JD 4MNYA 4INKA 5EW2H 1ESAA 4E7RG 4B75A 1V2KT 3OEED 1DXWA 3ZZ8A 1A5GH 1YLDA 2LP6A 2R0LA 1H8IH 1GI4A 2PSXA 1F5KU 3HPTB 3ZV8A 2HVXA 3SNDA 4ZHAA 3TPIZ 3BTWE 1GL0E 4DT4A 3LGWA 5E0HA 2W7SA 1O2OA 4A1VA 5C94A 1OWEA 5I25A 2TPIZ 3GY7A 1GGDB 1OP0A 1BB0B 3A82A 3EYDA 2EI7A 2QXJA 5L2YH 1GBIA 3LOXA 1ELGA 3BSQA 4HG6A 5KGOA 1MTWA 4IC6A 5EQSA 2DE9A 4INHA 1WV7H 4DY7B 4YLQH 3UAIC 1QA7A 3OYPA 2L74A 1E79D 1O5CB 4JYVH 1O2UA 2QIQA 4KGAA 1BQYA 2QGRA 4HFPB 2QF3A 2P8OB 1P11E 3F0PA 3DHKH 2A4GA 1IAUA 1LHGH 4NFEA 4AC9A 1GHZA 3P8GA 5B6LA 3BG4B 4FUJA 3RXJA 3OE7D 5JB9S 5FL7D 3OY6U 2BY9X 3BEIB 3TVJB 1J14A 2A1DB 2G5NA 4A5TS 4B73A 2TGDA 4I31A 5FPYA 5HM2A 2CHAC 2H2ZA 4JYTA 1O3IA 1A46H 1T4VH 2BY7X 2VWMA 2FOFA 1O3PB 3T29A 1CT4E 1HFDA 1QQ4A 2AEIH 1SGQE 2AHME 3A88A 1TE0A 3B23B 1E35B 5I46H 2L6OA 2GCHG 3SNBA 1EX3A 3TJOA 1UO6A 2QA9E 1QTFA 2WUBA 2WYJA 2KCYA 1OWDA 3FOAA 1OYQA 5C3NA 1ESBA 3MO3A 4X6NA 4WMEA 1SG8B 1E36B 5T6GA 1O2IA 1MCTA 3SZNA 1QCPA 5FX5A 4LOYH 1BITA 7GCHG 2ZU3A 1GJDB 1VITF 2H5DA 1LPKB 2XW9A 1P9UA 2PKAA 3SU6A 3NRLA 2P95A 2XBVA 1O3HA 1HNEE 1BTHH 1SOTA 1ZMJA 1M9UA 2V6NA 2FI4E 1EPTC 2Y80A 4MDSA 3E1XB 3M61U 2QY0B 1Y59T 2XBXA 3SZEA 4F48B 1SGIB 2VWLA 4CR5A 2P16A 4XD7D 1FY1A 3T2NA 5KECA 1BMMH 1HAZB 2BLQA 3FP7E 2HGTH 4BAQB 1V2RT 1NS3A 5IK2D 2CXVA 2ZU1A 4OS6A 1J15A 2W5EA 5JDUB 1J9CH 2OQUA 3RXLA 3BIUH 2OC1A 3A87A 3LGUA 2R3UA 1ZJKA 2HOBA 1G3CA 4LZ1H 4X1NU 4GVUA 4FU8A 1VZQH 3LJOA 1C5MD 1MBMA 2WPHS 4SGBE 1T8OA 1HUTH 1KSNA 3RXTA 1K1LA 4JMYA 1TOCB 2ZPSA 2BZ6H 1LQDB 3RXEA 3RC5A 5L2ZH 2CGAA 1GJAB 3ZV9A 4ISLA 1GG6C 1NRQH 1GBMA 1FPHH 3M5LA 1GHWH 3SW2B 4TPYA 2BDAA 1G2LA 1BTYA 2OD3B 3MI4A 1TPPA 3A84A 1ARCA 3A8DA 5BRRE 1VGCB 2IOTA 3U1JB 4ACAA 1HJ9A 3QUMP 4WH6A 3GOVB 3T26A 1ZZZA 3GY4A 3DFLA 3SV6A 2GVFA 6CHAB 3CP7A 1PPEE 2G4UA 1KDQB 2XWAA 8GCHF 1EJMA 1VJAU 5E0GA 3SUFA 2BY8X 3UREA 5A2MH 1BRAA 4B2CA 1MQ6A 6GCHG 1NU9A 1O2NA 3Q3XA 1VCPA 1TB6H 1C2DA 2BOKA 1V2WT 7ESTE 1PPBH 4AG2A 4CR9A 4X6PA 3SU2A 1LVYA 1O36A 2C8WB 2A0QB 4KKDA 5C5OA 2FOGA 5EGMA 1IOEA 1NC6A 2Z7FE 2Z9KA 1MTNC 1AIXH 2ODYB 1TBQH 3RC4A 5CE1A 1FUJA 1MU8B 1RTFB 1L0ZA 3Q76A 2OINA 2F9OA 2EEKA 4NCYA 4ZKSU 3QGJA 1GI6A 4BXSA 1K2I1 1QL8A 4B71A 1NY22 3FP8E 3GS9A 2SNVA 3E8LA 1FXYA 3A89A 3A8AA 4Q7YA 1YPHE 2J38A 1UVTH 1IQFA 1O2YA 2V7QD 1WDIA 4NGAH 2F9PA 2JETC 4AGKA 2J5UA 3E90B 1CVWH 2WV4A 2HPPH 1G30B 1W12U 1S6HA 1QNJA 4YO9A 2BLVA 4CH2B 2FX6A 4X2YA 2VIVA 1O2JA 1IQJA 1T8MA 4MNXA 5AHGH 1P05A 1F0RA 2ZU2A 3UNSA 1SGYE 1JRSA 1O5EH 4H6SB 5EODA 2AERH 4I33A 4KP0A 3S7HB 3KEEA 1TNLA 2ZNKH 5AFZH 1KXCA 5DP4A 1E37B 4AZ2B 2BDCA 4R8TB 1EJAA 1YF4A 3RC6A 1UTQA 5IDKA 1QA0A 4DG4A 2PTCE 4X8VH 3VG8A 1P2OA 2BVSH 2ZTZA 1XX9A 1UTJA 1QJ1B 1V2ST 4X1QU 1QL9A 3GY5A 2PUXB 4ZUHA 1C2LA 3MNCA 1GJ8B 4X2VA 3NPSA 2A7JA 4ABDA 1E1QD 4ZMAH 5JBTA 2IPHA 5C0UA 5A0BA 1BIOA 2BD5A 1HLTH 1LPZB 5GXPA 1J16A 1LO6A 2AMQA 3Q77A 2PR3A 3ATMA 5GJ4B 1QRZA 3ZVGA 1AE8H 2XWBI 3P92A 3BEFB 4ABJA 1JRTA 2OLGA 4KELA 4K8YA 5TCCA 3FZZA 1S82A 1C1VH 2I6QA 4A1TA 2FP7B 3NKKA 1A4WH 2BQ7B 1XXFA 3FAOA 3RXFA 2FX4A 1O3AA 2TGTA 1DOJA 1ZJDA 2G00A 1W10U 1UK4A 3QLPH 1SFQB 1W2KH 2AGEX 3MU4A 1KMHB 1GI2A 3ESTA 3ODFA 1S0QA 2FOHA 3DT0H 2EQNA 1O2LA 3QN7A 1MBQA 1C1NA 3K65B 3LH3A 2Y82A 4X6OA 1H8DH 1H8ED 1HIAB 2V3OH 4BNRA 2J95A 4XRNA 3ZVEA 1DSTA 5F8XA 3MH7A 1EASA 1V2UT 4HTCH 1NTPA 2SGDE 3MU1A 2ZHEH 3VB6A 1N8OB 1G32B 2HALA 1COWD 3LGTA 4UFEH 1AFEH 5DGJA 1O5BB 3W1EA 1LMWB 1TX8A 1UJ1A 1ZGIA 1TQ7B 2BDHA 1RXPA 4JYUH 2Q6FA 2FIRH 1T8NA 2M2AA 3P8OA 3S9BA 1EATA 5FXLA 2BQWB 4NA9H 1B0FA 1GCDA 1A3EH 2FLBH 4K1TA 4GCHG 5DP5A 3MH6A 1KTTB 1EZSC 1ZYOA 3VPKA 1F7ZA 1QB9A 1O34A 1HAIH 2F91A 2Y6TA 3SU4A 5C2ZA 4I86A 2ZQ2A 3VGCB 2VWNA 2D1JA 1LHCH 3TNTA 1C1TA 2ZDMA 3LIWA 2JKHA 3W94A 2UUJB 1BTXA 3VB5A 1MTVA 1ELCA 5T3HA 1DWCH 2XNDD 5JBAS 3PV5A 1GMCF 2GTBA 5SGAE 3SUDA 1GJCB 4VGCB 5EOKA 2SFAA 1DDJA 3TITA 3P17H 5DK1A 3KIDU 1K1OA 2J97A 4NG9H 3M5MA 3O8RA 4I8LA 1MD8A 3A7XA 1GBFA 1ELBA 4Q80A 1INCA 2BD8A 2VVVA 1TMBH 2XBWA 4WH8A 1UK3A 1O2PA 4Y6DA 3T25A 2H6MA 3F2GA 1UCYK 1C2KA 1GVKB 3BN9A 2FZZA 3SUEA 1AB9B 1O5GH 1SQTA 2GV7A 4QT8C 2HNTC 1HAHH 2VIDA 3SJIA 1EXFA 1TNKA 1C9TA 1UCYE 4YT6H 5C5NA 1SGEE 2BTCE 1ZPBA 4ZAEA 4CRCA 3NXPA 1PPCE 3A7YA 1P02A 1NO9H 1FY5A 1UMAH 4OS7A 2GDDA 1HAXB 1G9IE 1K22H 1YWUA 2GZ9A 1ANDA 3PROA 4I8JA 5F8TA 3LU9B 1P2MA 1B5GH 3P6ZB 2ZFTA 4TY6A 4ZKRU 4Y11E 2Z6BD 1Q31A 1HJAB 1GVLA 1IQMA 1CHGA 3OSYA 5GPIB 2QN5T 5T1VA 2VGCC 2QYIA 3U28C 5T6FA 1MMJN 1HAVB 1O31A 2A5KA 1GBKA 2ZFPH 3UOUA 1EAIA 1V2PT 2F9BH 3SU1A 4DOQA 1GJ7B 5HIZA 3GICB 3VB3A 3CNRA 3BG4C 3EDXB 1W0KD 2IN2A 1O2HA 5AFYH 2BOHB 2G81E 1P2QA 3ZVAA 1K21H 1TMTH 1W7XH 1ELTA 1AMHA 1FQ3A 1OPHB 3O8BA 1SQRA 3MNBA 1MKXH 3V12A 1O2QA 3KHVA 3GCNA 2ZTXA 1W8BH 2PW8H 4Q7XA 1DPOA 1ANBA 2GJGA 2ZA5A 1DY9A 1FNIA 5EIYA 2BD3A 1GMHF 1P3EA 2FOAA 2I6SA 3FKSD 2EI8A 1O2GH 2JH0D 2ODPA 3W95A 4OS4A 4ABAA 1AFQB 1O3JA 1AY6H 1W13U 3RU4T 1QRXA 5LPFA 1HXFH 4ACBA 2RFKC 1IQHA 1K1PA 4FUGA 2SNWA 2F83A 2PFEA 2WPKS 2CN0H 1QBNA 5DP3A 4O97A 1C1SA 1FIZA 1RIWB 5ESBA 1OKXA 2C8XB 3MU8A 2ZEBA 2Z3EA 2A4OA 3R0FA 2ZPQA 2AH4X 4OS5A 1TAWA 1ZGVA 1MKWH 1BHXF 2HPQH 1GHVH 1RS0A 1XUKA 3NZIA 1HAPH 2J9NA 1G37A 3N99A 5EJLA 1BBRK 3T5FH 3T28A 3N7DA 3RM0H 3AK5A 1V2MT 1C5XB 2BLOA 4YOGA 5G4BA 4Y8XA 4YT7H 4WXIA 1H4WA 3SV7A 1C5WB 4FUBA 1GBEA 1TIOA 1BBRE 1GWAA 1ELVA 2ESTE 1ZHPA 5FPSA 1O2TA 5HM9A 3KQBA 1IHTH 2KAIB 2SGEE 1O3FA 1WTHD 3O8CA 2RA0A 4RKOB 3KCGH 3ATIA 1ANEA 3A83A 1JMOH 2NU4E 4ABEA 4ZHLU 3GY6A 1P8VC 2Z3CA 3IG6B 3E3TA 1NRRH 1XVOA 2BD7A 3CS7A 4FUFA 3VB4A 1JOUB 1P12E 1Y3UA 4XBCA 2Z9IA 1OHHD 2H1UA 4ISIH 1QR3E 1ZRKA 4DT7B 4UFGH 2Q6GA 3NCLA 3OFND 1DUAA 4NSYA 1ZSLA 2K1QA 3MNXA 3TK9A 3RXSA 3E91A 1QZ8A 1UHBB 4FU9A 1C5LH 1EZQA 1IQLA 1RTLA 1GHBF 3ZZ4A 5C1UA 1P09A 4Q2KA 1S84A 5DKMA 4D8NA 1ABIH 4U01A 4Z0KA 3KYGA 1CU1A 1SLWB 3H7TA 4JZDH 5GCHF 2GCHF 1JWTA 3URCA 4YM9A 1QL7A 5A8YA 3TLOA 2JIZD 2KR7A 2W3KA 3S9CA 2FYRA 2RCEA 2ZGHA 2ZIQH 1TBRH 1P03A 4CHAC 5FCKA 5F6MA 1O33A 1YPKH 7GCHF 3V3MA 2P94A 1FAKH 4OS2A 1O5DH 2FS9A 8LPRA 1HAGE 2GKVE 1HRTH 1P57B 3PLBA 4NFFA 4UONA 2P59A 1O3MA 4B2AA 1XUJA 2HNTF 1BMAA 1SGTA 2A4QA 1A0JA 1QY6A 1L1GA 4AB9A 1WSSH 3U8RH 2ZQ1A 1DSUA 1OS8A 1W0YH 3UOPA 1YY3A 1Y3WA 5HIYA 3PLKA 4BAHB 3C1KA 1BMFD 3MO9A 3SHCH 1S85A 1TGSZ 3PWBA 4CRFA 4K1SA 1SGFA 1O2MA 2D8WA 3Q3YA 1BMNH 2RA3A 4BAOB 4UD9H 2GGVB 1SQAA 2ZPRA 2OTVA 3M3VA 4JK5A 5GNDA 1BTWA 3V13A 5J4SA 4B1TA 4MVNA 3RXHA 3UY9A 1DFPA 2FOBA 3F68H 3QDZB 3GYLB 2V0BA 2ZECA 4UFFH 3ATKA 1O2RA 1AUTC 3I29A 3SN8A 1GI0A 2PV9B 1SC8U 3L3TA 2J2UA 4H4FA 2NU3E 2V35A 1FDPA 4LXBH 2ZFQH 3SJOA 3ZYEA 1PFXC 2BX4A 2FYQA 1GHYH 4FXGH 1GI5A 4Y76A 1RD3B 2OBQA 2PWXA 3KF2A 2R3YA 4Y10E 2A31A 1K1MA 8KME2 4O03A 1O3CA 1ESTA 1Z7KA 2ZHDA 2BDYA 4XE4A 4AGJA 4XFQA 1S6FA 1F0UA 3EA7A 4FOUC 1D3QB 3BTDE 4AB8A 1AO5A 4IGDA 4DIHH 4ABIA 2UUKB 2R2MB 1DUEA 2QV1A 2WPDD 4INLA 3MH5A 4OM9A 1U6QA 4F4OC 1EJNA 2FPZA 3A8CA 3QTOH 1OYTH 1QIXB 1GCTB 4K60A 3PM3A 3U98H 3KNXA 3WY8A 3TK5A 2THFB 3ODDA 3RUOA 3RXQA 2J94A 1YKTA 2VVUA 1AUJA 5AF9H 2STBE 2KFWA 3F1SB 4UEHH 1PPGE 1SLUB 4BANB 2XBYA 2W6ID 4YESB 2FODA 2A32A 5FX6A 2XNIA 2ZHFH 1SI5H 1H1BA 4Y8YA 2CF8H 1V2LT 1C5YB 1GI1A 2H5CA 5GIBA 3JZ2B 1Q3XA 4I8GA 3PMBB 1T31A 2GCTB 2UUFB 3A7WA 2Z9LA 1GL1A 1C1MA 4F49A 5HXFA 1SHYA 5LPEA 1O38A 1NPMA 2Q1JA 1KXAA 1W0ZU 3F9EA 5E2PA 1NRPH 1W3CA 1PPFE 3SBKA 2XC4A 2WINI 1ZTJA 1VITG 2PKSC 2F9UA 3FFGA 2WSSD 1EOJA 5DG6A 2GD4B 2ALVA 4DW2U 4JZ1A 2BY5X 1LHFH 1CGIE 2ANYA 2YMSD 9ESTA 1OWIA 1S81A 3EQ0H 1WXRA 1YCPM 3HKIB 1AVXA 3A7ZA 4GPGA 2LNCA 1C2JA 2ZCHP 2B0FA 3RXRA 1MQ5A 4RKJB 1UTMA 1QB1A 4SGAE 1CGJE 1A1RA 2GP9B 1RJXB 1YP9A 3GISB 1SVPA 4BTTB 1ELAA 3MOCA 1OWKA 2G51A 1O30A 1Z8JB 1N8OC 1FY3A 4RN6A 3OEHD 1F0TA 1KDQA 1WTGH 4FVBA 3TJUA 4WMDA 4CRGA 1MTUA 1G3DA 1YPHC 3DA9B 4NIVA 2O8TA 3BTME 3NUMA 3LC5A 2KZ4A 1YGCH 1BRUP 1AQ7A 2WPIS 1DLKB 3PB1E 2STAE 2PUQH 3GY8A 1ZSJA 1LHEH 2OC7A 5C20A 3ZVBA 1O3NA 4MLFB 1UW7A 3LKWA 1GHAF 3QWCH 3WWFA 3SNEA 4AOQA 3ATWA 4AFQA 1DXPA 3BTQE 1AZZA 1T7CA 1V3XA 2FTLE 2YMSB 1THRH 3VGCC 1P04A 4K2YA 2C4FH 1NROH 3F3BA 1F5RA 5EG4A 3H5CB 3FN8A 1L4DA 3RXPA 2WV5A 3SNAA 2FOMB 2ZU4A 2VNTA 4VGCC 1Q2WA 1C1QA 1E38B 3KQDA 3OX7U 1CA0C 4P02A 4J1YA 1THSH 1WAYB 5E8EH 1GI7B 1TNHA 3UWIA 3DSGA 5A0CA 4AX9H 8GCHG 4AN7A 1LTOA 1O2VA 2ZI2H 4X8SH 2ZGCA 1SGDE 3V7TA 4IS5A 1GJBB 5EJZA 2FO9A 1YPMH 4JK6A 4U2WA 2CK3D 3Q3KA 4TWWA 1EKBB 2ZGBH 1ETSH 1V2TT 3RMLH 1J17T 1EPTB 1EZXC 1WBGB 3P70B 2B8OH 5HGGA 1F92A 2Z94A 1QBVH 2BDGA 2NWNA 5J4QA 4OS1A 2AIPA 4GLYA 3TJNA 1PYTC 2VB0A 3DSPA 3PMAB 1MU6B 2ZGJA 1VR1H 3PRDA 1O5AB 3SQEE 1HJAC 3MWIU 2TGPZ 1IQGA 1UTKA 5E2OA 3OTJE 1Z1IA 2A5IA 3PTNA 1IHSH 3PV4A 5CHAC 1TNGA 1O39A 1ZPZA 4AFUA 1UTNA 5DP9A 3ZZDA 3RXDA 3JZ1B 4OGYA 1WQVH 2FXRA 2KCAA 1J8AA 5E0JA 1T8LA 4YZUA 2VINA 4FUDA 4WJG2 1NZQH 1PJPA 3ZIAD 1TA6A 4K69A 2PSYA 4NIWA 4YOIA 4A7IB 1ELFA 4E05H 1GJ6A 1ZRBA 3RXOA 3BTKE 4K8BA 1SMFE 1AKSB 1NRSH 1CBWC 3TU7H 2B7DH 1V2QT 1MZAA 1C5NH 3IWMA 1HIAA 3PO1C 1YCPK 2BD2A 4ABGA 4MNWA 3FZDA 3H09A 2OBOA 2Z3DA 2RDEA 2AGGX 1AN1E 2Q6DA 1C5PA 3PYHA 1OP8A 1K1NA 1E1RD 1DWBH 2OUAA 5FBEA 1QBOA 1AE5A 5K7RA 1GHXH 1QJ7B 1TNIA 1N6YA 3RP2A 4IBLH 2YNBA 4DJZB 1P2IA 4B6FA 2BM2A 1O3LA 2G52A 3RXGA 3RXVA 2OCVB 2WHXA 1HAOH 1PQ8A 1V2VT 3P95A 9LPRA 3HATH 3UFAA 4IW4E 4X0WU 1S0RA 1CHOF 5EXLA 3ENSB 4I7YH 2SGAA 1GBBA 4FUHA 4Y0ZE 1Z8GA 4K5ZA 1HBTH 2OK5A 4H6TA 3UB0A 2G8TA 4E7NA 3DD2H 3A8BA 2VIPA 2ZF0H 3SV2H 3A81A 2ZDLA 2EY4C 3BTEE 4H42U 1NT1A 1SGCA 2SGQE 3PV2A 2C93B 3F2HA 1S6LA 1FAXA 1L2EA 4NZQA 1T4UH 3SU0A 5EXMA 2AMDA 3A86A 3A85A 1AVGH 2VBCA 2VJ1A 2ZCKP 5DN6D 1MAYA 2LELA 1TPOA 3BTGE 3D65E 4NZLA 3T62A 1GBHA 2JETB 1BRBE 1Z71A 5KEDA 2M5TA 1GMDF 3HKJB 5DP7A 2TIOA 1NFUA 3LGVA 1EFRD 2Z9JA 1OOKB 4WWYA 1FZZA 5FPTA 2VH0A 2Y81A 2F43B 3F9GA 3LGYA 3RXKA 1GDUA 1GGDC 2KM0A 2NU2E 2JJ1D 1GJ5H 4TSFD 1UCYH 1OXGA 4KTSA 1UTPA 4CREA 1C2GA 1XUIA 4TPIZ 2BD9A 1TBZH 1Z6JH 1BTZA 3KYFA 3UNQA 3SGBE 1LKBA 1V6DA 3ZZ6A 4DVAU 4ZXXH 3MYWA 3MH4A 2OC0A 2F4LA 3PRBA 5B6OA 2P8OC 4BTUB 2RG3A 3S69A 3SYJA 3V0XA 4YXWD 1NM6A 2OQ5A 2QF4A 1P2KA 5DP6A 2Y7XA 3GCOA 3LJJA 1E0FD 3GCHB 3HGPA 2PLXA 2XOKD 5JPMH 1BRCE 3URDA 3E0PB 2H9TH 3OU0A 3AVZA 3GCTG 3SQHE 1HAVA 4WY3A 1OX1A 3TGJE 3RDZA 2TBSA 2G55A 3U69H 4M7GA 2ILNA 3KN2A 1BCUH 1BHXB 3BV9B 2DE8A 3OAAD 2UUYA 3SU5A 3F6UH 1O3BA 3QTVH 1HB0B 1SL3A 2CF9H 1LQEA 1O3KA 1DANH 2JH6D 4Q4LA 1C5QA 4D7FA 2O8UA 4J2YB 1D6RA 1LHDH 1FY8E 1K1JA 3RM2H 5JBBS 1K9OE 1TLDA 1Z6EA 2EA3A 2WV9A 4ABFA 5L6NH 1K28D 4X1PU 1SBWA 1TWXB 1ZMNA 2ZHQH 3EE0B 3N7EA 3UUZA 3UPEA 4NIYA 4FUIA 1C2IA 1TNJA 2VIOA 3P8FA 2VVCA 4RT1A 1XXDA 5A0AE 2GT8A 4B2BA 3RLYH 2QE7D 1LVOA 1KXDA 1KY9A 2BVXH 1F2SE 3AW0A 1VITH 2J98B 1ZHMA 2LPRA 3HGNA 1C5OH 4AYYB 1B0EA 2CJIA 3AW1A 4F55A 1O3DA 3OY5U 3EGKH 5JB8S 3KL6A 4MPVA 1PQAA 1YM0A 3RXMA 1QFKH 5DJ7A 3MHWU 1SOZA 2SGFE 1BBRH 1GCTC 3H7OA 1NU7B 2R2WU 4GUXA 5HKKD 5DSFA 4CRBA 1AWHB 4THNH 2KAIA 4XDEA 5F8ZA 2P93A 4D76A 1TGCA 1WOFA 2ASUB 1SSXA 2GT7A 2BZAA 3SGQE 4B74A 1EOLA 5CHBA 3NK8A 3S7KB 1BMLA 1MUEB 4AG1A 1SQOA 2KCOA 1LKAA 1GMHG 5EU8A 4ZXYH 4X8TH 2ANMH 3RU4E 4ZKOU 3U8TH 3K6YA 1L1JA 3VFEA 1EB2A 2FMJA 1SR5C 3SGAE 2H9EH 3M3TA 2D2DA 3HK6B 1XM1A 2Y5GA 1UHBA 1ZTLA 3M7TA 3SNCA 3SORA 3MO6A 5EW1H 1VGCC 3LGIA 1Y5BT 2VIWA 1QB6A 1P01A 3VXEH 1KYNA 1FY4A 1C1UH 5FAHA 3K6ZA 4ZHMU 2FI5E 2VIQA 3LH1A 2GMTB 3DCLA 1RTKA 4MPUA 2ZFSA 2CMYA 3TH4H 2V3MA 6CHAC 1O3EA 1MH0A 1O37A 3VEQB 2WZQA 3U9AH 1C9PA 1GJ9B 3KQEA 2RDLA 1EAXA 4PROA 1O3OA 3L6PA 2FEQH 1LPGB 2P3FH 1XUGA 4NWLA 4AFSA 2AFQB 2OP9A 1Z8IB 4WVPE 3RLWH 4M9FA 2IJD1 3RMNH 3UIRA 2PGQB 2VU8E 2FM2A 4AORA 4ASHA 6LPRA 1A61H 3BTFE 4TWYA 4ABHA 2BB4A 2VGCB 3RU4D 2FTMA 1K0HA 3UNRA 1CE5A 1ZLRA 1AVWA 1TONA 1IQEA 1T32A 1NESE 1PPZA 1DE7H 4ZKNU 3WWBA 1AI8H 1C1RA 4ISHH 5DPAA 1DY8A 3LONA 4CH8B 5EPNA 3SJ9A 3AAUA 1GHBG 2C3SA 3BEUA 4X2XA 1VCQA 4YTAA 3UWJH 1FN6A 2YMSC 2F3CE 2IPQX 3FP6E 1G36A 3F9HA 1WCZA 1P10A 2BXUH 1QHRB 2JJ2D 1DVAH 3RXBA 4NA7A 1TX7A 2HRVA 5GCHG 4RT0A 1ZPCA 1GDQA 1A0LA 4NA8A 1AWFH 3Q00A 2K0QA 4XBDA 2PKAB 1W14U 1WU1A 3M5OA 1IQIA 4BAMB 4WXVA 1TGNA 2ZKSA 4NWKA 5BPEA 3ZYDA 1EAWA 5A8ZA 2ZDNA 3A7TA 4U30A 1BJUA 1TGBA 2BY6X 3RXUA 1H8HD 4I8HA 1XUFA 2ZGXH 1VJ9U 3UR6A 1SGPE 4YOJA 1BJVA 4YLUA 3BTTE 1THPB 2VH6A 3TK6A 4FUEA 3ZVFA 2R9PA 5FBIA 1MZDA 1P3CA 1CT2E 1G3BA 2C90B 2QXGA 4MPWA 5TJXA 4A92A 1ETTH 5C1YA 3U1IB 2ANKH 1O2WA 1TPSA 1JXPA 4Z1MD 1DICA 5H4IB 5PTPA 2B9LA 6GCHF 3ZZ5A 2HLCA 1SFIA 1XKAC 4O3TA 1XUHA 1TA2A 3SV9A 3BTHE 1C5SA 5JBCS 1UTOA 1ACBE 1ZTKA 4XBBA 3BF6H 3SU3A 3TJVA 4FETA 1SB1H 3CS0A 3ZZ3A 3K2UA 1DS2E 1TOMH 3GY2A 2AS9A 4JZFH 1KXEA 3SUGA 3SOSA 4ZCNA 1GBDA 2A4RA 4A6LA 2NU1E 2J34A 5CMXH 1AGJA 2OC8A 5A09A 4IN1A 1ETRH 1BUIA 1C1WH 3M7QA 1IQNA 2BYAX 1JIRA 3I77A 1H9IE 1H9LB 1SGFG 1G2MA 4XSKU 2AMPA 1YLNA 1K1IA 3PWCA 2C8ZB 3UQVA 2ZFFH 1ZR0A 1P9SA 5LH8A 4JZIA 4Q7ZA 4MQAA 3SI3H 3VXFH 4Y8ZA 2WPMS 1BZXE 2Y5HA 2ZDVH 3GY3A 1IQKA 1ZSKA 2P3UB 4CHAB 1O2ZA 1AD8H 2W26A 3K9XB 1DX5M 1ZHRA 1D9IA 3D62A 4TYDA 4XOJA 1SGRE 1HXEH 4BOHA 2BX3A 2KCPA 2QCYA 1L4ZA 1SLXB 1VKYA 1KLTA 1EP5A 4ZH8A 3TNSA 3FANA 1C5ZB 1UVPA 3QO6A 4DURA 2TGAA 2CHAB 4AYVB 1KXFA 2O9QA 2R0KA 1SLVB 4B6EA 4D9QA 3UR9A 1C5TA 1WYKA 3RXCA 4CBOA 1P2JA 1NBME 1H9HE 1O2SA 2YOLA 1XVMA 3KQCA 4ESTE 1W7GH 1UVSH 1C2HA 3IITA 2BLWA 4FVDA 2SGPE 1ANCA 2BD4A 3RXAA 3FVFB 1GDNA 1P0SH 2UWOA 1GI9B 1A5HA 1ID5H 3BG8A 1A0HB 3SJKA 3M5NA 5A8XA 3SV8A 4O3UA 1GBJA 1O32A 5ABWA 1SGNE 4DCDA 1KIGH 1A2CH 2UWLA 1KTSB 2DUCA 1WQSA 2WPLS 1UVUH 1CA8B 1SKYE 1AB9C 1Y3VA 4IMQA 5LGOA 1TRYA 2W3IA 1BT7A 3E16B 1BTUA 4GAWA 2EI6A 1MD7A 3F2FA 3EE7A 2O8WA 1HCGA 1O35A 1GPZA 4CRDA 5IYTA 3F0OA 2YNAA 5C0TA 2ZO3H 1V2JT 4Y7BA 2HVYB 1P06A 1GI8B 2A7HA 1FONA 3GDVA 4FU7A 4I32A 4K1EA 3UQOA 2HLDD 3TH2H 2PP6A 1DT2A 2JH5D 2QF5A 3E0NB 5JYIA 1S5SA 1EPTA 2ULLA 3QX5H 5DP8A 1TYNA 1BA8B 1NBMD 4D7GA 4X2WA 2ZP0H 1GHAG 1UVOA 2FS8A 2GZ8A 1OWHA 4WF8A 2A2QH 3TGKE 1DM4B 2F9NA 1JBUH 3MU0A 2ZG0H 2XC0A 4JCNA 5L30H 5ESTE 5C17A 4GSOA 1D4PB 4A1XA 3ZZCA 3ZVDA 1C4U2 3MNSA 2XCFA 4GCHF 3GCHC 1CGHA 1PPHE 2D26C 1QURH 4UDWH 5ETXA 5K0HA 1SPJA 2FOCA 8ESTE 2ZWLH 7KMEH 1NFWA 4U32A 3MTYA 1GG6B 1Y5UT 1C5VA 2UWPA 2P3TB 1F0SA 4RSPA 3LC3A 5FHTA 4MTBA 1A3BH 3OTPA 5GDSH 1BTPA 1F5LA 2G5VA 4KTUA 2PKSB 1ZOMA 3HK3B 2VWOA 1DWEH 1C5RA 1AFQC 1LVBA 2C8YB 3BIVH 1VCWA 1AU8A 1EB1H 1D3TB 4LK4A 1ORFA 2BXTH 1NRNH 4GHQA
chains in the Genus database with same CATH topology
3U8OH 4ABBA 2GV6A 2XCNA 3ZZAA 1FI8A 4B76A 4GHTA 1RIWC 2BVRH 2OXSA 3LT3A 2A7CA 1AKSA 3M7UA 2QXHA 3TIUA 2FI3E 4MNVA 1Y5AT 3A80A 3R3GB 3AAVA 2ZDAH 3N7OA 3VB7A 2XXLA 1UTLM 1D3PB 3F9FA 3QK1A 1EZUC 3RMMH 4E06H 1A5IA 1QQUA 4CRAA 1GVZA 3QZRA 5EPYA 4O9VA 5C1XA 1HYLA 1V2OT 1YCPH 1WUNH 3TGIE 1LCYA 3GDUA 4UE7H 1CQQA 1FPCH 3CENA 1FIWA 1MTNB 2ODQA 1MTSA 1GBTA 1W11U 1C1PA 1CSOE 4DGJA 1O0DH 5LPRA 2O8MA 4JZEH 2NU0E 4Y79A 3ITIA 1YPEH 2ZHWH 4HZHA 3UTUH 1D6WA 1TPAE 1Z1JA 1ABJH 1UK2A 2FOEA 4Y71A 3NWUA 1C1OA 1YYY1 5HMAA 3LPRA 1RGQA 1EUFA 1C4V2 1HGTH 2WYGA 1L1NA 1N6XA 1EAUA 1TRNA 4IN2A 4NIXA 6ESTA 1PYTD 3ZZBA 2J4IA 4HGCA 1XMNB 1GBCA 1HAYB 1LVMA 2ALPA 5T6DA 1RFNA 3GCTF 1YLCA 2GX4A 2ZFRH 1CA0B 2CV3A 1HJ8A 2WUCA 2WPJS 3DUXH 1G3EA 3RXIA 5TCAA 1GI3A 1PQ7A 1FV9A 4ZROA 1C2EA 4BAKB 1O2XA 2ANWA 2EC9H 2O8LA 3EA9A 3M37A 1C4Y2 1Z8RA 4ISNA 3G01A 3ZZ7A 4IC5A 4X1SU 2FESH 1D3DB 3S0NA 1RRKA 2F9VA 2J92A 1GBAA 3GDSA 1AHTH 5EQRA 1HV7A 1YPGH 3PTBA 3L33A 2GMTC 1TMUH 4Z6AH 3TH3H 1YPLH 2A5AA 4WMFA 2Y7ZA 1TALA 1HDTH 1QGFA 1Y8TA 1CO7E 3ZVCA 1CHOG 1YC0A 1EP6A 1MAXA 4DIIH 2B5TB 2G4TA 2QF0A 1DLEA 3SI4H 1NFXA 1JIMA 5EXNA 1FN8A 4UFDH 5DO4H 2FDAA 4AFZA 4I8KA 1ZMLA 2HWLB 5C67A 2A2XH 2ZCLP 4KTCA 1GMCG 1MKXK 2AYWA 2BDIA 2HNTE 4ISOA 3M35A 3B9FH 1FMGA 1TQ0B 1GBLA 1Y3YA 3MMGA 5CHAB 2XTTB 4X1RU 3T27A 2A45B 3ATLA 1ELDE 3SO3A 2GDEH 1TX6A 1FLEE 1DWDH 2QXIA 5FCRA 1QRWA 2ZZUH 3RMOH 2QC2A 3M36A 3LDXH 2BHGA 1GMDG 3D49H 4R0IA 2XC5A 3C27B 3B8JA 1CT0E 1KLIH 1NFYA 3QGNB 4HI3A 3MU5A 3P8NA 3SHAH 2Y5FA 2ZU5A 1MKWK 2ZC9H 1N1LA 1YPJH 4K3JA 3QZQA 4D9RA 1GJ4H 4TY7A 5F03A 1CBWB 2BMGB 1Y3XA 4IMZA 3STIA 1HPGA 1QJ6B 2ZTYA 2PGBB 1C5UA 1TRMA 3PO1B 3PMJA 1OP2A 1BOQA 3ELAH 4OGXA 1KXBA 1SHHB 1YBWA 2PHBA 3E6PH 3EAJA 2FLRH 2BQ6B 2IJOB 1E34B 1S83A 2Z9GA 2PTNA 2AGIX 1TFXA 2XYAA 4NSVA 2FWWA 1OSSA 1C2FA 1O5FH 3STJA 3KGPA 4LZ4B 1V2NT 5GWZA 3PLPA 5EQQA 4BXWA 3PMHB 3A7VA 1BDAA 2GZ7A 3ZZ9A 4BTIB 4MG3A 2AIQA 3MFJA 1NN6A 4FUCA 1B7XB 1A7SA 1O3GA 4CBNA 2W7UA 3SJ8A 4X6MA 4MPXA 1ARBA 1EQ9A 3DFJA 2XRCA 1O2KA 4Y0YE 2QAAA 3M3SA 1DITH 4Y7AA 3O8DA 1FJSA 1MCVA 2TRMA 1TABE 1X7AC 1LDTT 7LPRA 4X8UH 3D23A 3S9AA 3EA8A 1P2NA 2ZDKA 1ELEE 2H9HA 5HYOA 3AASA 1AZ8A 1PQ5A 1C2MA 5AVDA 3GYMA 1OWJA 2GCTC 1XKBC 2V3HH 1TGTA 3I78A 1KLJH 2BDBA 4MNYA 4INKA 5EW2H 1ESAA 4E7RG 4B75A 1V2KT 1DXWA 3ZZ8A 1A5GH 1YLDA 2R0LA 1H8IH 1GI4A 2PSXA 1F5KU 3HPTB 3ZV8A 2HVXA 3SNDA 4ZHAA 3TPIZ 3BTWE 1GL0E 3LGWA 5E0HA 2W7SA 1O2OA 4A1VA 5I25A 1OWEA 2TPIZ 3GY7A 1GGDB 1OP0A 1BB0B 3A82A 3EYDA 2EI7A 2QXJA 5L2YH 1GBIA 3LOXA 1ELGA 3BSQA 1MTWA 4IC6A 5EQSA 2DE9A 4INHA 1WV7H 4DY7B 4YLQH 1QA7A 3OYPA 1O5CB 4JYVH 1O2UA 2QIQA 4KGAA 1BQYA 2QGRA 4HFPB 2QF3A 2P8OB 1P11E 3DHKH 2A4GA 1IAUA 1LHGH 4NFEA 1GHZA 3P8GA 3BG4B 4FUJA 3RXJA 5JB9S 3OY6U 2BY9X 3BEIB 3TVJB 1J14A 2A1DB 2G5NA 4A5TS 4B73A 2TGDA 4I31A 5FPYA 5HM2A 2CHAC 2H2ZA 4JYTA 1O3IA 1A46H 1T4VH 2BY7X 2VWMA 2FOFA 1O3PB 3T29A 1CT4E 1HFDA 1QQ4A 2AEIH 1SGQE 3A88A 1TE0A 3B23B 1E35B 5I46H 2GCHG 3SNBA 1EX3A 3TJOA 1UO6A 2QA9E 1QTFA 2WUBA 2WYJA 1OWDA 5C3NA 1OYQA 1ESBA 3MO3A 4X6NA 4WMEA 1SG8B 1E36B 5T6GA 1O2IA 1MCTA 3SZNA 1QCPA 5FX5A 4LOYH 1BITA 7GCHG 2ZU3A 1GJDB 1VITF 2H5DA 1LPKB 2XW9A 1P9UA 2PKAA 3SU6A 2P95A 2XBVA 1O3HA 1HNEE 1BTHH 1SOTA 1ZMJA 1M9UA 2V6NA 2FI4E 1EPTC 2Y80A 4MDSA 3E1XB 3M61U 2QY0B 1Y59T 2XBXA 1SGIB 2VWLA 4CR5A 2P16A 1FY1A 3T2NA 1BMMH 1HAZB 2BLQA 3FP7E 2HGTH 4BAQB 1V2RT 1NS3A 2CXVA 2ZU1A 4OS6A 1J15A 2W5EA 5JDUB 1J9CH 2OQUA 3RXLA 3BIUH 2OC1A 3A87A 3LGUA 2R3UA 1ZJKA 2HOBA 1G3CA 4LZ1H 4X1NU 4GVUA 4FU8A 1VZQH 3LJOA 1C5MD 1MBMA 2WPHS 4SGBE 1T8OA 1HUTH 1KSNA 3RXTA 1K1LA 4JMYA 1TOCB 2ZPSA 2BZ6H 1LQDB 3RXEA 3RC5A 5L2ZH 2CGAA 1GJAB 3ZV9A 4ISLA 1GG6C 1NRQH 1GBMA 1FPHH 3M5LA 1GHWH 3SW2B 4TPYA 2BDAA 1G2LA 1BTYA 2OD3B 3MI4A 1TPPA 3A84A 1ARCA 3A8DA 5BRRE 1VGCB 2IOTA 3U1JB 1HJ9A 3QUMP 4WH6A 3GOVB 3T26A 1ZZZA 3GY4A 3DFLA 3SV6A 2GVFA 6CHAB 3CP7A 1PPEE 2G4UA 1KDQB 2XWAA 8GCHF 1EJMA 1VJAU 5E0GA 3SUFA 2BY8X 3UREA 5A2MH 1BRAA 4B2CA 1MQ6A 6GCHG 1NU9A 1O2NA 3Q3XA 1VCPA 1TB6H 1C2DA 2BOKA 1V2WT 7ESTE 1PPBH 4AG2A 4CR9A 4X6PA 3SU2A 1LVYA 1O36A 2C8WB 2A0QB 4KKDA 5C5OA 2FOGA 5EGMA 1IOEA 1NC6A 2Z7FE 2Z9KA 1MTNC 1AIXH 2ODYB 1TBQH 3RC4A 5CE1A 1FUJA 1MU8B 1RTFB 1L0ZA 3Q76A 2OINA 2F9OA 2EEKA 4NCYA 4ZKSU 3QGJA 1GI6A 4BXSA 1K2I1 1QL8A 4B71A 1NY22 3FP8E 2SNVA 3E8LA 1FXYA 3A89A 3A8AA 4Q7YA 1YPHE 2J38A 1UVTH 1IQFA 1O2YA 4NGAH 2F9PA 2JETC 4AGKA 3E90B 1CVWH 2WV4A 2HPPH 1G30B 1W12U 1S6HA 1QNJA 4YO9A 2BLVA 4CH2B 2FX6A 4X2YA 2VIVA 1O2JA 1IQJA 1T8MA 4MNXA 5AHGH 1P05A 1F0RA 2ZU2A 3UNSA 1SGYE 1JRSA 1O5EH 4H6SB 5EODA 2AERH 4I33A 4KP0A 3S7HB 3KEEA 1TNLA 2ZNKH 5AFZH 1KXCA 5DP4A 1E37B 4AZ2B 2BDCA 4R8TB 1EJAA 1YF4A 3RC6A 1UTQA 5IDKA 1QA0A 4DG4A 2PTCE 4X8VH 1P2OA 2BVSH 2ZTZA 1XX9A 1UTJA 1QJ1B 1V2ST 4X1QU 1QL9A 3GY5A 2PUXB 4ZUHA 1C2LA 3MNCA 1GJ8B 4X2VA 3NPSA 2A7JA 4ABDA 4ZMAH 5JBTA 2IPHA 5A0BA 1BIOA 2BD5A 1HLTH 1LPZB 5GXPA 1J16A 1LO6A 2AMQA 3Q77A 2PR3A 3ATMA 5GJ4B 1QRZA 3ZVGA 1AE8H 2XWBI 3P92A 3BEFB 4ABJA 1JRTA 2OLGA 4KELA 4K8YA 5TCCA 3FZZA 1S82A 1C1VH 2I6QA 4A1TA 2FP7B 3NKKA 1A4WH 2BQ7B 1XXFA 3FAOA 3RXFA 2FX4A 1O3AA 2TGTA 1DOJA 1ZJDA 2G00A 1W10U 1UK4A 3QLPH 1SFQB 1W2KH 2AGEX 3MU4A 1GI2A 3ESTA 3ODFA 1S0QA 2FOHA 3DT0H 1O2LA 3QN7A 1MBQA 1C1NA 3K65B 3LH3A 2Y82A 4X6OA 1H8DH 1HIAB 2V3OH 4BNRA 2J95A 3ZVEA 1DSTA 5F8XA 3MH7A 1EASA 1V2UT 4HTCH 1NTPA 2SGDE 3MU1A 2ZHEH 3VB6A 1N8OB 1G32B 2HALA 3LGTA 4UFEH 1AFEH 5DGJA 1O5BB 1LMWB 1TX8A 1UJ1A 1ZGIA 1TQ7B 2BDHA 1RXPA 4JYUH 2Q6FA 2FIRH 1T8NA 3P8OA 3S9BA 1EATA 5FXLA 2BQWB 4NA9H 1B0FA 1GCDA 1A3EH 2FLBH 4K1TA 4GCHG 5DP5A 3MH6A 1KTTB 1EZSC 1ZYOA 3VPKA 1F7ZA 1QB9A 1O34A 1HAIH 2F91A 2Y6TA 3SU4A 5C2ZA 2ZQ2A 3VGCB 2VWNA 2D1JA 1LHCH 3TNTA 1C1TA 2ZDMA 3LIWA 2JKHA 3W94A 2UUJB 1BTXA 3VB5A 1MTVA 1ELCA 5T3HA 1DWCH 5JBAS 1GMCF 2GTBA 5SGAE 3SUDA 1GJCB 4VGCB 5EOKA 2SFAA 1DDJA 3TITA 3P17H 5DK1A 3KIDU 1K1OA 4NG9H 3M5MA 3O8RA 4I8LA 1MD8A 3A7XA 1GBFA 1ELBA 4Q80A 1INCA 2BD8A 2VVVA 1TMBH 2XBWA 4WH8A 1UK3A 1O2PA 4Y6DA 3T25A 2H6MA 1UCYK 1C2KA 1GVKB 3BN9A 2FZZA 3SUEA 1AB9B 1O5GH 1SQTA 2GV7A 4QT8C 2HNTC 1HAHH 2VIDA 3SJIA 1EXFA 1TNKA 1C9TA 1UCYE 4YT6H 5C5NA 1SGEE 2BTCE 1ZPBA 4ZAEA 4CRCA 3NXPA 1PPCE 3A7YA 1P02A 1NO9H 1FY5A 1UMAH 4OS7A 2GDDA 1HAXB 1G9IE 1K22H 2GZ9A 3PROA 1ANDA 5F8TA 4I8JA 3LU9B 1P2MA 1B5GH 3P6ZB 2ZFTA 4TY6A 4ZKRU 4Y11E 2Z6BD 1Q31A 1HJAB 1GVLA 1IQMA 1CHGA 3OSYA 5GPIB 2QN5T 2VGCC 2QYIA 5T6FA 1MMJN 1HAVB 1O31A 2A5KA 1GBKA 2ZFPH 3UOUA 1EAIA 1V2PT 2F9BH 3SU1A 4DOQA 1GJ7B 3GICB 3VB3A 3BG4C 3EDXB 2IN2A 1O2HA 5AFYH 2BOHB 2G81E 1P2QA 3ZVAA 1K21H 1TMTH 1W7XH 1ELTA 1AMHA 1FQ3A 1OPHB 3O8BA 3MNBA 1MKXH 3V12A 1O2QA 3KHVA 3GCNA 2ZTXA 1W8BH 2PW8H 4Q7XA 1DPOA 1ANBA 2ZA5A 1DY9A 1FNIA 2BD3A 1GMHF 1P3EA 2FOAA 2I6SA 2EI8A 1O2GH 2JH0D 2ODPA 3W95A 4OS4A 4ABAA 1AFQB 1O3JA 1AY6H 1W13U 3RU4T 1QRXA 5LPFA 1HXFH 1IQHA 1K1PA 4FUGA 2SNWA 2F83A 2PFEA 2WPKS 2CN0H 1QBNA 5DP3A 4O97A 1C1SA 1FIZA 1RIWB 5ESBA 1OKXA 2C8XB 3MU8A 2ZEBA 2Z3EA 2A4OA 3R0FA 2ZPQA 2AH4X 4OS5A 1TAWA 1ZGVA 1MKWH 1BHXF 2HPQH 1GHVH 1RS0A 1XUKA 3NZIA 1HAPH 2J9NA 1G37A 1BBRK 3T5FH 3T28A 3RM0H 1V2MT 1C5XB 2BLOA 4YOGA 5G4BA 4Y8XA 4YT7H 4WXIA 1H4WA 3SV7A 1C5WB 4FUBA 1GBEA 1TIOA 1BBRE 1GWAA 1ELVA 2ESTE 1ZHPA 5FPSA 1O2TA 5HM9A 3KQBA 1IHTH 2KAIB 2SGEE 1O3FA 1WTHD 3O8CA 2RA0A 4RKOB 3KCGH 3ATIA 1ANEA 3A83A 1JMOH 2NU4E 4ABEA 4ZHLU 3GY6A 1P8VC 2Z3CA 3IG6B 3E3TA 1NRRH 1XVOA 2BD7A 3CS7A 4FUFA 3VB4A 1JOUB 1P12E 1Y3UA 4XBCA 2Z9IA 2H1UA 4ISIH 1QR3E 1ZRKA 4DT7B 4UFGH 2Q6GA 3NCLA 1DUAA 4NSYA 1ZSLA 2K1QA 3MNXA 3TK9A 3RXSA 3E91A 1UHBB 4FU9A 1C5LH 1EZQA 1IQLA 1RTLA 1GHBF 3ZZ4A 5C1UA 1P09A 4Q2KA 1S84A 5DKMA 4D8NA 1ABIH 4U01A 4Z0KA 1CU1A 1SLWB 3H7TA 4JZDH 5GCHF 2GCHF 1JWTA 3URCA 4YM9A 1QL7A 5A8YA 3TLOA 2W3KA 3S9CA 2FYRA 2RCEA 2ZGHA 2ZIQH 1TBRH 1P03A 4CHAC 5FCKA 5F6MA 1O33A 1YPKH 7GCHF 3V3MA 2P94A 1FAKH 4OS2A 1O5DH 2FS9A 8LPRA 1HAGE 2GKVE 1HRTH 1P57B 3PLBA 4NFFA 4UONA 2P59A 1O3MA