2PUAA

Crystal structure of the laci family member, purr, bound to dna: minor groove binding by alpha helices
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
339
structure length
339
Chain Sequence
ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLEANTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of LacI member, PurR, bound to DNA: minor groove binding by alpha helices.
pubmed rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*AP*CP*GP*CP*AP*AP*AP*CP*GP*TP*TP*TP*GP*CP*GP*T
total genus 116
structure length 339
sequence length 339
ec nomenclature
pdb deposition date 1997-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2puaA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2puaA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2puaA02
1W25A 3HM9A 4JCYA 1D4ZA 3Q41A 4P98A 4W5QA 4YS6A 4ZMSA 2HINA 4MR9B 3SY8A 5IEJA 3BS3A 2IVQA 5KI6A 4ZPJA 1B0NA 4G86A 2BNOA 1PRUA 1JX6A 1OCTC 2R63A 1MB0A 1QPZA 3EJWA 2WMYA 1C0EA 3FMVA 4Q6BA 1WIZA 3UK0A 2CD7A 1FQWA 1X2LA 1OSLA 4YGXB 3N6VA 3I5AA 2L18A 5HKOA 3DGFC 3S8QA 3CU5A 2E4WA 2B4AA 4EY3A 1D2AA 4O1HA 1QKKA 5CNKA 3MLFA 2H3HA 3Q7TA 1URPA 2PMCA 4D74A 4PE5B 3F73A 1BVHA 1PNTA 3SG0A 3JVIA 4OBBA 4RY9A 3DZDA 5TQ2A 2IU7A 1MVOA 3L1PA 1A2OA 3UKJA 2MEZA 1ZESA 3CTPA 1CEYA 1KRXA 1WH6A 1Z25A 2VUIB 4MLDA 1AB6A 4MQEA 3GBVA 2GX6A 1ZZBA 2AXUA 1EHCA 3CRNA 4RSMA 3MQ4A 4EGSA 8ABPA 1ZITA 1A04A 3ILHA 2FMHA 3QK7A 4YR7A 4W5OA 3ZKCA 3T8YA 4EYOA 4N76A 1O4XA 1OXKB 1ZZ7A 4Q7EA 1ZH2A 4GHJA 4RY8A 2IOYA 4QYWA 2PUFA 5JNWA 4LDAA 1NXSA 2O4AA 1KRWA 3RZZA 3LFPA 1LBHA 1YIOA 3ILYA 4PICA 5EWLB 3SAJA 5JNSA 4RS3A 2IUOA 3JPYA 4F8DA 1QO0A 2MYNA 1ISSA 1AU7A 1PUXA 3QX8A 3LUKA 2ID9A 4Z9AA 1MAVA 5JNTA 3LUCA 4WUTA 1ABEA 5FWYB 3C3KA 1DC7A 1TLFA 3HUUA 4P1ZA 2E4UA 7ABPA 1W9HA 3O9XA 1JWLA 3QLVA 4O8BA 1ZDMA 4YG7B 3MF4A 4IGAA 3K4HA 2KZ8A 3JXBC 5IX8A 4GPAA 1HEYA 3LOPA 2A9PA 2IPMA 1GUBA 4B09A 2KEKA 4NV3A 1KMIY 1CJGA 3CROL 2XCJA 4OLBA 1M2EA 2E4VA 5CNIA 1ZHHA 1C4WA 2IYNA 3TD9A 1SRRA 3KHTA 2QSJA 3HVRA 3B7HA 1RZRA 4Z4EA 1J56A 1DZ3A 4ETMA 2D5VA 1ZZ8A 1YS7A 3S99A 3KTOA 5CNMA 3LTEA 3URMA 4PEVA 2JVIA 1NXWA 3IVPA 4JASB 3G85A 2B5AA 1DP4A 2L8NA 2QZJA 1TM2A 2ICPA 5DCLA 1ZZCA 4IA8A 1T34A 5TPWB 5EWJB 1CHNA 3VNAA 2YHBA 3LUFA 4YG1A 3IP5A 3O1IC 1NEQA 4ZYLA 1BDHA 3HZHA 2RDMA 3JPWA 1H9CA 3LUDA 3Q7RA 1ADRA 1AB5A 3H5IA 3OLZA 4KMRA 3BD1A 4Z5HA 2LYKA 1QQAA 6ABPA 2MSLA 3HCWA 3HV2A 1I3CA 4G0MA 1NXVA 4KQ9A 3NHMA 2LIVA 3L49A 1SQ8A 3P9YA 4G0ZA 4LX8A 5T3YA 2MYPA 1LLIA 1ISRA 2O49A 2PAFA 4KK3A 3N0RA 1RXEA 1USGA 5EWJA 3PXPA 3F52A 3RVRA 3RVMA 3MMNA 5KWSA 1POUA 2HPHA 2PUBA 3DBIA 1TJYA 1NXPA 3TMYA 1Z15A 3N75A 3F7NA 3KYIB 4YLEA 5FWYA 2YHAA 4W5NA 4MQFA 5BRAA 1RZSA 2MYUA 4X4EA 4WXMA 1PRVA 2NZVG 1F4VA 1OXBB 2WWVD 3RVLA 2FSPA 5EWMA 3QYXA 2XSDC 3CFYA 4Z5CA 3JXDL 2PUAA 2GI4A 3FYAA 3IPAA 4HNQA 4JOQA 1KGSA 4I6TA 1YK1A 2WB4A 1DBPA 3BRQA 3C3WA 3FMYA 3H5VA 3BREA 2IPNA 3H6HA 1NXXA 4OLAA 2JVJA 1NXTA 4F8JA 5EWLA 2E4ZA 1PEAA 1QP4A 1ZGZA 2A9OA 3IP6A 1WETA 3N53A 4KV7A 4NCAA 4GNRA 3NBMA 1XHEA 3CZCA 2FVYA 2QXYA 5E3JA 3QWGA 3LKBA 1Z26A 4L4UA 3A0RB 1SXHA 1HF0A 3KLOA 4IF4A 4MQEB 2FMIA 2EBYA 1PEYA 5PNTA 4G0YA 3BDNA 1LBIA 3C3MA 3H5WA 2FEKA 2WRZA 4OATA 3VK0A 5KQLA 4X4CA 5CNJA 2PPXA 3IP9A 4HYEA 4RK6A 3GN5A 4MCTA 3EQZA 4TN5A 2H0AA 3FDFA 3OLXA 4O1IA 1L5YA 3FFTA 3LUJA 2AXZA 3D1NI 5CHYA 1VLZA 4LZLA 4Z9BA 1D5WA 4G0OA 4MPTA 3DGEC 3DLBA 4IVZA 3MIZA 1R63A 3SNKA 1JFVA 3CS3A 3HZIB 2IV1A 2PUEA 2O20A 2CSFA 1ZH4A 4JA2A 4RK4A 2L19A 4YO7A 1GT0C 1ZAYA 4EVQA 4Z4GA 2A6CA 2FTKE 2FW0A 4H60A 1PHRA 2L49A 4RY0A 1EWVA 4MS3B 2AWIA 2JB9A 3HJFA 4RK0A 1EAYA 3KXAA 2HSGA 3QF3A 1IC8A 4OB4A 2QVGA 3QEMA 4RKRA 5FWXA 3OLWA 5I4CA 1RZRD 5IUNC 1SXIA 2FMFA 2L2QA 4FN3A 3N8IA 4MLCA 2LYLA 3SCGA 3EUSA 3JVDA 1JF8A 3O2SB 1JBEA 3M9XA 4MS4B 4WT7A 4S04A 4KRFA 3ZHMA 3T38A 1QO0D 4TLMB 2P4UA 1Z2EA 4YG4A 4IRXA 4RK5A 4MR7A 5TQ0B 4DN6A 2F8SA 1GCAA 1ABFA 2EWTA 3UFDA 1Z18A 2O38A 3JTEA 2MQKA 2FEPA 1DBWA 2A9QA 3NHZA 3G1WA 1R69A 2KYRA 3QQ6A 2NT4A 3QLUA 1LJUA 1DCFA 1YSEA 1LQCA 4L85A 4KPYA 1BDJA 4G97A 1JYFA 4MR8A 5ED4A 2FQWA 4LRQA 4PU8A 1U0SY 3TB6A 5KQGA 3QLTA 3GA5A 3RH0A 4N0QA 2W42A 3H6GA 4G0PA 4X4FA 3KJXA 2R48A 4MR8B 3JS5A 1JLKA 3Q9SA 3QELB 2XDYA 4HNRA 2OQRA 3RVPA 2HQOA 3EODA 4N47A 4ML3A 3GT7A 4MRMB 3G5GA 2PUCA 4IMJB 5B3JA 3LUHA 3GYBA 4LE2A 4EVRA 3HK2A 2V0NA 3F6WA 3FFXA 4Q6WA 3H1FA 4ZMRA 3KG2A 4EYQA 2LYJA 2LCVA 1P6UA 3B2NA 3C97A 3IPCA 4H3HB 3KCNA 3SCHA 2XI8A 2WY2D 4N03A 3CECA 2GRMA 3L6UA 3O74A 1PNRA 2FMKA 3R0JA 1EWKA 1QQBA 3O1HB 4W5TA 3QEMB 4TLLB 1MIHA 5A7LA 1ZZ9A 3RVQA 3IP7A 1DC8A 1DWKA 1Z2DA 2QV0A 3KLNA 2WIUB 5FWXB 4MS1B 3SCFA 1YMUA 2FQYA 3LUGA 4RZSA 5BQ3A 1YVUA 3MM4A 2FN8A 2FN9A 3O1JC 1PRAA 1E3OC 1M5TA 2GWRA 1RPEL 3CHYA 4I6RA 1ZY2A 1NXOA 5DKFA 2A9RA 1K68A 3EULA 4Z4CA 1FFWA 2L17A 1BA2A 1U8TA 5DLEA 4YCSA 2LYRA 4LE1A 4Z4FA 3F51A 3CLCA 2IPAB 3I42A 4Z99A 2FXIA 1P6QA 2IVBA 2QU7A 3N0XA 4N41A 2JCGA 1Z12A 3O75A 1UXCA 2KEIA 3A10A 3CG4A 1BDIA 2GKGA 3OO0A 2FLKA 1X57A 2RJOA 2I6FA 3H5LA 1PERL 3U3WA 3A3KA 4JB2A 3RVKA 2CHFA 4DQDA 3T95A 4N0PA 4FE7A 1FFSA 1E6KA 3GV0A 1L5ZA 1RPJA 4PU7A 1DRJA 1Z17A 3Q7SA 2MYTA 4RWEA 5EWMB 1Z16A 5F64A 4Z58A 1DCMA 4HNSA 5TE9A 4Z4HA 4KQCA 3TX6A 3RVJA 3D02A 1NERA 3M9WA 1SXGA 2AXVA 2OFYA 3H1EA 3N0WA 1APBA 3OQOA 2QVCA 3LFTA 4H3KB 5B3JC 3CNBA 2ZAYA 3HUTA 2M1ZA 2N9UA 1DBQA 2E4XA 4YV7A 2WJWA 2X7XA 3NNDA 1S7EA 4FBIA 3LKVA 3F6PA 4MGEA 4CBVA 4JQDA 2NZUG 2PUDA 4Y42A 2QW1A 3KSMA 1Y1LA 1RNLA 1TMYA 2LUOA 1XHFA 4Z0NA 2LYPA 4KFCA 1JYEA 1A0OA 1YMVA 1ZS4A 1BAPA 3TO5A 3O2QB 1Y9QA 2R1JL 3Q15C 3SM9A 4FE4A 3HDGA 2FEWB 2GZUA 1FFGA 2BJCA 1D1QA 4W5RA 2WJAA 3KS9A 2LYQA 2IDMA 4F11A 4KNYA 5T7BA 3HDVA 3OMWA 4NICA 2MSKA 1XWRA 4MAAA 2HJ9A 3EDCA 2QR3A 3VNBA 2XIUA 2AYZA 3CKMA 5ABPA 2F8TA 2M98A 4JCXA 2FJRA 1TVMA 5JNVA 2JBAA 5HM6A 4NQRA 4WWHA 3C6QA 4O5AA 2HQRA 2PE5A 3HXMA 4J1XA 3QLVC 3R1FA 3FFWA 2EF8A 2AUWA 5TQJA 3RVSA 2R4QA 2PL1A 1NTRA 2FKAA 2GBPA 4M88A 4WZZA 1LCDA 2H8RA 2OR1L 3I09A 2BNNA 2B1JA 4S05A 1JFSA 3OQNA 2JBAB 4EVSA 1E6MA 5K98B 3OMTA 2R47A 4OTZA 3HEBA 4NCBA 3LISA 1QNLA 2AW6A 4JAVC 1Y7YA 2LYSA 2HQBA 5TQ0A 2R25B 4RK1A 4XLTA 3DLHA 3SQNA 1UDRA 4YBAA 2IKSA 3RVNA 2VYCA 3CZ5A 5FBHA 4RU1A 1USIA 3LUAA 1GCGA 4D6XA 4RKQA 1U2QA 5TPWA 1ZN2A 1DJMA 1XWWA 1LMB3 1MB3A 3GN5B 3OP9A 1USKA 2MSWA 1S8NA 3H1GA 2DRIA 3D8UA 3OLYA 4KREA 5JS1A 5FBKA 3F6CA 1JH9A 1M2FA 2PIJA 4OG2A 1JL3A 3KKEA 3O21A 4QYMA 3DNVB 3O2JA 4TMYA 3OO1A 3G7DA 2LP4Y 3W9SA 4ZJPA 2FQXA 3M6MD 5HQJA 4G0QA 4F12A 1U04A 4RV5A 4Z4IA 1L1MA 3A0UA 3GWGA 4LE0A 5IUKC 2ICTA 1UXDA 2JK1A 4XFKA 4ETIA 3H5OA 4X4HA 1P2FA 4MS3A 4D6YA 1M5UA 1R8JA 3EAFA 4UHJA 2KEJA 2AYXA 1QMPA 3OM0A 3KZ3A 1NY5A 4F3TA 1LK0A 4E7OA 1E2BA 2IVGA 2BNMA 4G0XA 4QPJC 5IULC 1FSPA 1U2PA 1JFTA 4X4BA 3QEKA 4MS4A 2PUGA 3OLVA 3OMXA 2E4YA 3BRSA 6CHYA 2WUSR 2JRLA 4YARA 1ZVVA 5GOTA 1RXIA 1YTUA 1E6LA 1P8AA 1F51E 2CWDA 2FLWA 3GRCA 4KVFA 4MQFB 5KQPA 3FYMA 4Y9TA 1CQTA 3JY6A 2PLNA 3HS3A 4MYRA 1EWTA 2ZWMA 4PYRA 5IUJC 3HSYA 5TQ2B 3ROTA 4XAQA 3GL9A 4MS1A 4YWHA 3T6KA 4J1WA 1DCKA 2P9HA 4KZKA 1SD5A 5DTEA 4EUKA 3CG0A 5TPZA 5JNRA 4PU3C 5GQSA 1UTXA 4X4GA 2LPMA 1VPWA 5HSGA 4X4DA 1DRKA 4ETNA 4PU4C 4RK7A 4EYKA 4MCXA 1GLGA 3E61A 4KK4A 1ZPQA 2OENG 5KC9A 1D1PA 4XARA 5IEBA 4IWRA 1YK0A 3OQMA 9ABPA 3FGZA 2NUBA 3H5TA 4EYGA 4QICA 5BR1A 5KQMA 5IC5A 3GBPA 4UHKA 4X4IA 3EGCA 4MRMA 1DW9A 4Z59A 4RXUA 3OM1A 4WXEA 3E3MA 3BILA 2Q5CA 4FB4A 1VKRA 4GQMA 3RVOA 2KPJA 1ZUGA 2CHEA 4PZ0A 1JDNA 3H75A 4NDWA 2CROA 2ID7A 3BBLA 3QLUC 1RIOA 2BGGA 4RDCA 4RXMA 2JVLA 3ZHIA 5JNUA 3NNNA 4YRZA 2PKXA 1EFAA 3QX9A 2XJ3A 5D2CA 2GRLA 1NATA 5BRJA 3MA0A 3NNSA 4XASA 1JHZA 3GBFA 5JS2A 3LMKA 1GUDA 3CLKA 4E7PA 3IDOA 4IMIB 3TRBA 1CYEA 2NT3A 1ZZ6A 1QP7A 3EQ2A 3KYJB 4Z5DA 4MR9A 2TMYA 4IILA 1VRVA 1YS6A 5C5EA 4XXHA 1Z13A 4I6UA 4F06A 1JDPA 1QP0A 3HO1A 1B00A 5TPZD 3UUGA 4JP1A 4RXTA 3K9CA 2J48A 4JB0A 1IIBA 5DGCA 2RGYA 3ROFA 2JVKA 4LDZA 4I8TA 1DG9A 4DADA 2LBPA 2VK2A 2VUHB 5IBQA 1LJLA 2PL9A 3MYYA 2IPLA 2RJNA 3QELA 3RQIA 1WH8A 5C5CA 1LCCA 1ZGGA 5KC8A 4MR7B 1K66A 2PJUA 3JXCL 3I45A 4YP9A
chains in the Genus database with same CATH superfamily
1JDBC 3A6EA 4ROTA 3K0CA 3QLEA 5DF1A 5DHUA 3HM9A 5K4AA 4TS4A 4MKZA 2BFDA 4IUCS 4JLPA 3WTBA 2WD7A 2XKBA 1WD7A 2AXQA 2IEBA 4DUYB 3A9XA 4QDZA 3OT1A 1PRUA 4BN4A 2OLKA 4ZFNA 1K7SN 5H82A 3EEYA 1PJ4A 3D1JA 2R63A 2ZI7A 3KEFA 3RS2A 2WMYA 2GLXA 1N7IA 2QTGA 3UK0A 2W6MA 5GVRA 5FOUA 3UT6A 4XWKA 2PZMA 4N7MA 4ASUA 4BO5A 3BFJA 4XH9B 2CLEB 3O7MA 2Q9AA 3IRUA 1WW8A 2BHRA 3U09A 3KYCB 4HCJA 2WABA 2X3UA 5D8DA 3ICWA 3OQPA 3NWOA 1UBFA 2RBGA 4J2OA 1OLUA 3DBVO 2ZTHA 2G8NA 3EXFB 3IP8A 3RFUA 1SVMA 2C4TA 4FR2A 5IZCA 4LNUA 3N2EA 5JEEA 3O4FA 3SIPA 1XELA 3ZWDA 3EVBA 3F74A 3PNPA 4QEKA 4YDRA 1THMA 3ZE1B 3AINA 4ZANA 1KE2A 1QH8B 3ZVNA 3IPYA 3S29A 5ERYA 3CINA 2AG8A 3MT0A 2O7SA 3L02A 1R1DA 2R84A 3PYMA 1PR6A 4R5HA 3R76A 4CL3A 1MPXA 4RSMA 2WV7A 2OESA 4LRYA 2WIAA 4XGQA 1K5GA 2VWPA 2O1XA 3TRJA 2JIZA 5JFOA 1J0XO 1ZITA 3CEMA 3W90A 5A1JA 3D0OA 1QTIA 3P2EA 2AZ4A 2HWWA 2Y77A 4PLHA 3EG5A 1O4XA 2IC5A 4NENA 2AR7A 3UJ8A 2JAQA 1T9KA 2QJWA 1FS5A 1U02A 4KTVE 4RGQA 2P6PA 2R6FA 2WVHA 3PDJA 1IZYA 3NIFB 2JGDB 4NYMQ 1LB1B 4QLAA 1L3IA 5ALFA 3LFPA 1CDEA 4ANFA 2DVMA 2ZJ8A 4AS1A 4ALLA 3EHEA 4HPJB 2C8VA 4G4GA 3E7XA 4AJHA 5C37A 3JR7A 2UZAA 2MXDA 1XE3A 2OG1A 4YRQA 4LJRA 3UMBA 1KEPA 1OAKA 3CW2A 2ID9A 2PT6A 4Z9AA 4IZIA 5B3AA 1DIAA 3DDSA 1YVDA 4LOLA 3T5GA 3TSAA 1QRAA 2E7ZA 2FWIA 2JC3A 2XMZA 5ITWA 3S5UA 5KKCA 2KZ8A 3WBFA 2GEDA 2W8ZA 3O47A 5CBKA 5MGBA 4LJ8A 2A9PA 3RF7A 4EHAA 1GZ5A 3AOGA 2KEKA 3LCJA 3RM3A 1OZGA 2QUZA 1G8MA 3OEEA 3UJ7A 5F9FA 3DZHA 2H31A 2IYNA 3NW9A 5KYWA 1O9GA 4YT5A 5CITA 3U44A 3B7HA 4IINA 2YZ7A 1CE8B 3H11A 1YS7A 1SZCA 1SWVA 4J16C 1EH5A 4Y6OA 1XHLA 3KTOA 3UWOA 1OLXA 1NF9A 1U6JA 1NR7A 2JVIA 2VCEA 5ITZB 4RADA 1TQ6A 3SZMA 1FMCA 2QZJA 1GTRA 2VA8A 4X24A 4JVSB 4ZCSA 2RD2A 1H2FA 1T2AA 2HDNB 4HWOA 2VH1A 1P0PA 4LXHA 4RACA 4AT1A 3A70A 4CG0A 4CEHB 3FVVA 3GQBA 3M6VA 1F2VA 5FF9A 1NF3A 3LC2O 3H5IA 3QIVA 4EPRA 3GEPA 4EHHA 2BE7A 1WNFA 2R66A 3NFYA 3AVPA 4FCWA 1JN0A 1X7YB 1W49A 4JLUA 4RDHA 1XLWA 1ISRA 3EDMA 1JVNA 5DBGA 1AKMA 1JEQB 2OD2A 3RVMA 2DHDA 4CMEC 3BIJA 1T6YA 1BXZA 2PYZA 1JQDA 1M8GA 1H9BA 3P9IA 4E08A 5LP1A 4PAQA 2G0AA 1BJKA 4NBNA 3WJ1A 1NP6A 2PUBA 1K8XB 1RQNA 4FIZA 1O77A 4R2XA 3X44A 2NX2A 4UMFA 1QFXA 2UVPA 3GUYA 3R74A 1F0KA 4ZVTA 4MSUA 1J33A 1ECJA 3KXDA 4IL5A 3WL8A 1Q7RA 1FRZA 4WXMA 3FLMA 1RRPA 2NYVA 1QC5B 3QV1A 1Y7IA 3A9CA 3W8EA 1BW9A 4CMBA 3OCXA 3CLTD 3HBLA 4X1YA 1X2EA 3FYAA 1EP2B 4XDYA 3W7VA 5HUHA 1YK1A 4MJ7A 1EBFA 3UPTA 5IS2A 4BO4A 4Z2YA 1NDUA 2C5HA 1G8YA 4EKIA 2W2VA 3UB3A 1DUSA 5EWLA 3RSHA 4R1NA 3W7AA 3G0CA 4Q2JA 2ZE6A 3DMDA 3R23A 3TQOA 4ERXA 1RXYA 2RK3A 3ROXA 4K1LA 1P8JA 2AMLA 2PX6A 3ML1A 5IBPA 5I9BA 2AVNA 2V6JA 4QYIA 3OETA 5ES4B 1A50B 5HKAA 4CDMA 4HZUB 3OKCA 5HE8A 1I1OA 2EX1A 5JDCC 3ZKWB 3I1FA 1A71A 1BCSA 4JQZA 1G20E 5FWAA 5I9IA 2ZUTA 1YDWA 3EIWA 3L0CA 3GRZA 1R3UA 1KO1A 3PICA 3PQ7A 4E33A 1QK4A 5CHYA 3V42A 4HEA6 5K3SA 3CUSA 4YRLA 4E4YA 3WV4A 1MXHA 4EWLA 4CXMA 3ASYA 5LD2B 5I8WA 2PN1A 1VDZA 1Y6QA 2JL1A 4LK3A 1Z4NA 2ZBRA 2ZYAA 5BYJA 1G8FA 2O20A 4PRLA 5JE8A 2EDCA 1ZH4A 3K4QA 3SLGA 5DT2A 4AF7A 3MRXA 4UHCA 4XGRA 1CVRA 4E5UA 1OU0A 1EWVA 1GVNB 2JIBA 3HZRA 1F38A 3UKOA 3PUKA 3PFCA 5IF3A 2JB9A 4QQRA 4F6CA 3O9ZA 1XUOA 1Y9ZA 2F9FA 2WWRA 2KMLA 2HV9A 4GT1A 1L7EA 2DUUA 1L5RA 4YT4A 1ZIXA 2BRUA 3FSRA 4PAWA 3UY4A 3FHTA 1A76A 5CB0A 5HMLA 5FP0A 1W6RA 4WT7A 2DTDA 1WMEA 4C29A 2QZSA 4KRFA 3G3EA 3BSFA 3COPA 1J06A 2D5CA 2OXIA 3RVBA 1KYTA 4JXXA 4B2YA 1Y8QB 3HR4A 3EQ6A 1MX3A 4Z3DA 5ALIA 4Q3EA 5CPFA 3K0AB 4K81B 1YZFA 4RCZA 1PT9A 4DLAA 2Z2ZA 3WGIA 5EMMA 1JJIA 3I76A 2QY9A 5A03A 2A4KA 4E1AA 4FDAA 5EOVA 2A9FA 2AUTA 1BMFD 3M6UA 4RHYA 2CUTA 3LPMA 5BNTA 2ZIGA 1RMYA 1S7CA 3CBQA 3GNQA 4MVJI 3I0NA 5FTJA 1CTQA 3TL6A 3M4YA 4QEDA 3C16C 3IURA 3D1VA 3L1VA 2FW6A 3OCCA 4I46A 3RABA 4ML3A 4Q1EA 1IG0A 4A6XA 1NUTA 1PZFA 1U7PA 3KDSE 4RLQA 2OV4A 4TVKA 4DSTA 4R2WA 2XNSA 1BWQA 3CJTA 1NF2A 3OX4A 4D44A 4YGYA 1P6XA 4CTNA 1VP9A 1U2GC 4O4LA 2GFHA 1IHOA 1Z2PX 2QRPA 2YIJA 1XA3A 1J90A 2XVMA 4EKYA 3T7TA 2G4LA 1KY4A 2EF0A 4XD7A 4Y2RA 3OFSA 3ZHCA 4UTXA 1E7RA 4HUQA 5AVYA 1ZZ9A 1ZC3A 4UBNA 5A0VA 2YNMC 1SXJD 5CUQA 3G0OA 1GTL1 1NZJA 3ETNA 3NEYA 3EARA 4JXKA 5E38A 3M0EA 1TPZA 2IS6A 1YMUA 1KXJA 1C9DB 5KVCA 3N74A 3FTEA 2GWRA 1T4MA 1THGA 3DZ8A 3MEQA 1FQOA 3QG5A 5DE3A 2GEBA 2BFAA 4Y1FA 4KGXA 3HWSA 2OKCA 4MPJA 4G5GA 3WAKA 2BGTA 3TW8A 3OPMA 3B6JA 3PNBA 1KOLA 2CXRA 2ZWOA 2X42A 2BFNA 3I4FA 4QPZA 3S2EA 3IVMA 5KO2A 2WOOA 2GHQA 3EY4A 4X1IB 1HE5A 3GUHA 5BOSB 1QH8A 1R74A 5HDBB 1TA0A 3WNQA 1UXCA 3SC2B 3W3AH 2R2AA 2VBGA 4BPRA 2DLNA 2O48X 5DGHA 4GC5A 5JRZA 5DPMA 5CX4A 3A3KA 4C30A 4HNAB 1XIVA 3KBOA 4IDPA 4OHRA 5JSKA 3SY8A 4EA7A 3PFBA 3SS7X 2ZE8A 2XE8A 4ZQEA 1DCMA 4EH1A 3JR3A 1V45E 1Z4IA 4N8EA 3N8NA 1AT1A 2QMUA 2AXVA 1DQZA 4GQAA 4LDNA 4WN9B 5DWDA 2O8DA 5B3JC 3ZX4A 3UA3A 1LTKA 3HUTA 5AKKA 3UICA 5FOWA 2X7XA 1LNSA 4FBIA 1R3DA 4MYTA 4TXNA 2HB6A 1WTCA 3DLAA 3C4QA 3S5JA 4BVGA 2J32A 1S9HA 1U7ZA 4DR7B 4B4DA 1Z6XA 1J4AA 4MIEA 2QTFA 3RE1A 5ALMA 3VPGA 1BAPA 2F3PA 2W6PA 3ZLTA 2PL5A 1LJ8A 1NFFA 1Z88A 4QPNA 2ZIAA 3SM9A 4GMHA 3S3TA 1BOOA 1H0SA 2PH1A 3QG1A 4YECA 1FZQA 3CW8X 2QR5A 3VV2A 3C6KA 4AUEA 3GEBA 1H8EA 1SIWA 3TUIC 4OQLA 4Z51A 1TIPA 2ZBUA 2WTBA 1ZUNA 2OHGA 3WGYA 4EGCB 1U63A 2W6ID 3C1TA 1TGYA 2OSBA 2XHEA 1D0VA 1FX0A 4KXQA 2IODA 1SCIA 3U9LA 4NHEA 2B25A 5IK2A 2CT8A 2EFJA 3FYCA 3QW4B 4NQRA 1JALA 5I6DA 1YCDA 3K9GA 5ES3A 3UTCA 3QLVC 4A5OA 5JISA 1A1VA 1POWA 3MBKA 4QO7A 2Z5VA 3W8DA 3WDLA 4KBYA 1R0BA 2HRQA 5AVVA 1IHYA 1PT7A 3FNEA 1OZAA 3D2CA 4ZHSA 5CDSA 7MDHA 4KN5A 5GAHi 1PCXA 1KOJA 1ITZA 1R4AA 2JBAB 2PV7A 1WD5A 3EGVA 5CFRA 3HEBA 3LISA 2W37A 7MHTA 1RVDA 3ZDEA 4BQQA 3ABSB 1ZQ1A 4LOKA 3KUXA 5T4EA 3U81A 1RC1A 2QVBA 4A6EA 4I9GA 1WUIS 3L7LA 1XPOA 2QN2A 4LWZA 2ZVQX 3TZCA 4COOA 3N6XA 1ZUHA 3NXHA 4MULA 2AV6A 2OWEA 3L4SO 1NLMA 3IR7A 2OR3A 2GF9A 1EU1A 2A8YA 5ENZA 5KBYA 1WSAA 1PD0A 2DCUA 2H63A 2I3GA 2C4KA 2OXCA 3CH4B 3EWNA 3FVWA 4G5OA 2ZKIA 3OA0A 4NABA 4BLOA 4KREA 1LDYA 2YYAA 3FZGA 3O8QB 4DYHA 1FCJA 1FTYA 1ZONA 1NLUA 2R8OA 3NBAA 3AHFA 2ORYA 4BVBA 2FUKA 1Z3CA 4WTOA 5I8ZA 2BW0A 5E95A 4C88A 5JHGB 3KL4A 1F8XA 2CUZA 2EZ9A 3A0UA 3CLTC 3F9IA 3GWGA 3OZBA 5AJVB 3U7FB 4QDJA 4ZI7A 4OQFA 1D9ZA 3AFHA 1Z5ZA 1TM3E 1J9EA 4JYMA 4PR0A 3VSCA 5T67A 4CLOA 4IHJF 2WU3A 4DCGA 3DWIA 2C4VA 4EG4A 2B99A 3DKKA 3I32A 2IVGA 4GX1A 1OFIA 1FXWF 5KYTA 1U8AA 3DWGA 4TUYA 3REFA 1P9OA 5B64A 1ZOLA 4UVIA 4II3A 2JJQA 2UZ4A 4MCAA 4QXMA 3OLVA 3ETJA 1HT0A 2XWSA 3HA5A 1Y8CA 4TTTS 2AXEA 5KNBA 4YARA 4RA6B 1C7QA 4R0MA 2MHCA 3GRCA 6ADHA 1CUEA 3JYLA 4RMHA 4WLUA 2XUKA 4J7XA 2HK6A 1H5QA 2AC7A 3D9QX 4I6JA 5LUAA 1I4LD 3FRIA 3HSYA 3QHQA 1SBCA 3SS9X 1RXWA 1O1YA 2WSSD 2Y27A 1ULHA 5THXA 1OAAA 2FH5B 1KZ6A 2H48A 1CUYA 4UHBA 1AZWA 3E6AA 2AOXA 2AH5A 2VXBA 2VRWA 3F6BX 2OCKA 3R4VA 4KKXB 3CH7A 1VPWA 4NATA 3OF2A 5GQSA 1L7MA 2GEVA 2OCLA 2Y6VA 4QLOA 3FPEA 3U3RA 2GZ2A 4BEBA 2YJGA 3WVNA 4MCXA 1SPXA 3QJGA 4X63A 3I62A 4MUEA 1HOTA 1V9CA 3TTYA 1KK1A 1OT5A 2R5NA 3FTQA 1VRCA 3W5JA 4BP1A 1QWSA 3H5TA 1XLUA 2TMDA 3Q4GA 4TWZA 3UAGA 2BI8A 4PLZA 3S1LA 4A0HA 1D2MA 5CVUA 1BX0A 3AXTA 4I14A 3LA6A 4PGHA 1KKMA 3RSSA 4D0RA 1DW9A 4G5HA 4WXEA 2OQ2A 4PYQA 5CDFA 4JYAB 4BS9A 2R6ZA 1QVZA 4F8YA 1R00A 2RGEA 3MJSA 4YJKA 1AMNA 2PXHA 2RMKA 5A4JA 3W4IA 1Y80A 1G2IA 1D7OA 5A71A 5EYPB 4NDWA 3IAHA 5CB4F 4EECA 2E21A 3RIHA 1G8GA 3LD9A 4XYLA 5JYEA 3EVNA 3ND7A 3TLBA 2X2FA 3ASZA 2ZUVA 4G4IA 4MGZR 4C4AA 3ADKA 3OE7D 2BIFA 3B53X 4P92A 1GKIA 1S89A 2VJLA 3NNSA 3P20A 1HMYA 3N0VA 4RKEA 4E6EA 3RANA 4E03A 5KOIA 5EVCA 1NDQA 1TD1A 3TB4A 2CLLB 1WCWA 5HUJA 4DHEA 3NHWA 1JDSA 5EIXA 2HA7A 3WX0A 3ESAA 1JKMA 2YIDA 3W79A 2CLCX 1B00A 1Q92A 2HF9A 4UBLA 1HLDA 5C8YA 1EGAA 3D4BA 3IMKA 1MVLA 3L6CA 2J48A 1TCVA 3SC6A 3REOA 3VO1A 3D31A 2JVKA 4FDUA 3GXOA 3CO0S 3PRYA 4M49A 5EEHA 4BZPA 3CT6A 3GCXA 4RAQA 1BD4A 3NUZA 4I4IA 3IKLA 5DGXA 4FJ2A 2IXEA 4JJGA 2W58A 3BGVA 2H2AA 4OHPA 4YUWA 2G67A 2QRQA 3ORSA 3B1FA 1LCCA 5KNDD 1EDBA 3DV9A 1E5DA 1A82A 1JPVA 1A9TA 1PN3A 2Y1CA 3J81A 3V9AA 5EE5B 1AOXA 3IVGA 3VDNB 2YICA 2IDZA 1HM5A 3NUQA 4YS6A 1OVMA 5TY0A 1PW7A 2QAGC 5BQOA 4JEHA 4RSRA 3C14C 4HKTA 3PHIA 4EPVA 4H7FA 2Z6VA 1O6FA 3TSZA 2YCBA 1TTQB 5BXYA 1HY3A 1S7GA 1VLMA 3CR3C 1FFDA 1SXJC 3GLUA 1ZRNA 1C0EA 3DUFB 3ESXA 2FX5A 3E27A 3ROQA 4V0MA 6Q21A 1E4VA 3WK9A 1E1LA 4MARA 3WFIA 3PC6A 4HAXA 3MW8A 3A6GA 3QE4A 1VE7A 5FPYA 3PXEA 1ODCA 1TYCA 3ZHXA 3I9MA 2FWAA 3QVTA 4DR3B 1Y9JA 4BV2A 1URPA 3OJLA 4CKCB 4J0KA 4G5RA 5F2NA 3AM4A 4YAUA 4OMUA 1WXEA 3TVYA 5BMVF 1UMKA 3H2GA 5SZHB 3NC1C 4F3CA 3WKAA 3A9ZA 1DUVG 5THKA 5TS2A 1KDYA 2JFGA 3X3HA 4YQFA 5DEIA 3R5FA 1ETHA 1T10A 3N2LA 2QAGB 3L41A 4W9NA 5DN9A 5B1IA 4E2FA 1A04A 3D7KA 3G5MA 3LZ6A 3GIDA 2I76A 3QK7A 2B7BA 4EITA 4YO8A 2GSDA 2XXPA 5KKAA 5FIUA 3W06A 4LXTA 2I7DA 2BFFB 3NOQA 1XYGA 3VR5A 5ECWA 3HJBA 1ULTA 3GRYA 3PE6A 2IOYA 4XX1A 4AWBA 5HG0A 5IABA 3UWDA 5JNWA 4FTWA 4G2TA 1YZTA 2DKOA 1E99A 2KBFA 3RJ9A 3GJ4A 3GPLA 2PD4A 2WMOB 3VPBA 1R12A 3FDJA 5IBCA 1WR8A 3NLLA 2G9RA 2O3QA 1QO0A 2BCJQ 1YQGA 2GN0A 3QWFA 4L0CA 4MEBA 4IH1A 1V4NA 2AR0A 4KVZA 3RU7A 2JCXA 3SYMA 3IIIA 1YGPA 2J9RA 3EIQA 1RDFA 3A32A 4TPKA 3SYNA 3TTVA 4MICA 2FR8C 4BMPB 2XMBA 3OIWA 4WUTA 1ABEA 1VHJA 3NHFA 1W5EA 3BGSA 4G5FA 5AM4A 1G7RA 2Y67A 3BA6A 1CUXA 3L0ZA 1YH3A 2P78A 5CH8A 1ZBQA 4AO8A 4YG7B 2JEOA 3KHSA 4JI2B 1RQXA 4Q4DA 3QJYA 4GPAA 1GKYA 4LDRA 4DC0A 4UOZA 1U90A 3THXB 1WW2A 2V7EA 1O5IA 3CNQS 1Q0PA 3CXRA 3DOEA 3HWX1 2Z6AA 2R68A 4DIBA 1T6BY 2PFKA 3LLUA 3L0PA 4GGMX 4YJ3B 2ZIFA 5FJIA 3TLCA 2D1FA 1F2TB 3ZN2A 1GCIA 1OJ7A 4B3BA 5MN5A 2D5VA 3SDSA 2M6RA 4LQCA 3MGAA 3GJQA 4UQPA 5AKJA 5H80A 1NASA 1YZQA 2HO5A 3U80A 3V4OA 1YUBA 2DBZA 2FPWA 4DCUA 2VH2A 1I24A 2HLHA 3FVRA 4S1PA 3S2ZA 3SPXA 1Y7PA 3QFIA 3W5CA 1ZZCA 1HORA 4GPBA 2VHXA 1TB4A 3SEZA 3CNEA 1CHDA 4R9VA 1BWRA 2QL5A 2C2GA 5NLLA 1W76A 1XD9A 4ZVQA 1ADRA 3EY9A 4TXHA 3E9YA 5E6UB 3WG9A 1S2NA 3MRTA 1MJGA 4JYPA 3AVYA 2HBZA 2LYKA 5L3SB 3NDJA 1VSQA 4B3DA 3VTAA 4GXTA 4G1UC 3VC3A 3JQ7B 1QVAA 5EWJA 3UPUA 1E3WB 1YL5A 1Q91A 2GVNA 4UDYX 5D5HA 2NVUB 1KMCA 1NMXA 4PYKA 3P9NA 5FTWA 3WLFA 4CETA 4OQYA 5M5BA 2GFIA 2HA5A 3QU2A 1QYXA 5JOQA 4FSHA 3CISA 3OX1A 4MQFA 4HJXA 1Q83A 5DMXA 1YQ9A 4DLYA 1W88A 3UKDA 3R3HA 5K8UA 4MCHA 3QE0A 5KWVA 2YHIB 4HAOA 5J63A 3IKMB 1ZR4A 4Z5CA 3LF1A 2UYQA 4JBGA 2IH5A 3A1NA 1FTGA 3RJ5A 2JAXA 1A7KA 1FDSA 1ZWLA 3C3WA 2R8XA 2VYND 1NXXA 3I73A 1PIWA 3AO0B 3IUPA 5DGTA 2FUNB 5DLPA 4CLRB 1DAEA 1PAUA 2QRVB 3GR6A 3IJPA 3DPUA 1UXOA 1XEAA 3CLSC 1MQ8B 3IP6A 5EINA 4Z7NB 1H2ZA 3GZNA 4I1OA 2RHRA 4NOMA 3G9QA 3IVXA 3DG9A 3H1TA 2HJHA 4FLMA 4RJIA 4F5DA 2A35A 1C8LA 1N2JA 2Q2OA 2XA9A 3WMFA 2DCMA 3A9VA 1GUZA 2VOEA 4M7WA 2FU5C 2UXBB 1UPXA 1YBFA 3HSSA 4NU5A 2FZEA 1FE8A 1YE3A 4OATA 1R8XA 2WRZA 3MWDB 3I1IA 3HJGA 4E30A 1QGUA 1VKHA 1O8CA 1FDOA 2E1RA 1L5YA 3FFTA 4IDFA 5HS4A 2FV8A 2QE7A 1XRPA 4GBMA 4A73A 4YR9A 1T2NA 2DPXA 2Y9MB 5BSEA 3ITKA 3C6XA 5BRNA 2Q3FA 3FD8A 2VWQA 3CSUA 2XMQA 3C0KA 4YRAA 1USWA 4OMFG 5C8XA 1E3EA 4FFOA 1EB8A 1G6OA 2J0EA 2Z8YA 2FTKE 3DXZA 5B55A 2ZSFA 4DREA 1T8RA 3WGMA 5IN4A 4OP2A 2W48A 1T9ZA 1WV0A 2B1RA 2FMFA 1N1DA 2H51A 1H6DA 3KAKA 3KD3A 2QSYA 2VPIA 2LYLA 3QEAZ 4NMMA 3M9XA 1B1CA 2GAAA 4BLQA 2QSZA 2GXQA 4K8OA 4GOMD 3FHCB 3I3OA 1M2VB 4A16A 4D92A 5KTMA 2AN1A 3QKSB 4DN6A 3HGMA 2YN0A 1ZUD1 2GPNA 5IT4A 1GVHA 2FEPA 4L5JA 4CODB 1W2WB 3PNYA 1JLRA 2ZYDA 4KQFA 1GQOA 4BB9A 5DP1A 1V16A 4XX0B 4N3NA 2WT9A 1UKAA 1VOTA 4PGAA 2HZBA 1CDZA 2WM8A 4M7PA 4BRZA 2VDQB 2WM2A 1SXJA 3BK2A 1BXRA 1Q44A 4P54A 5LC1A 3ZYCA 2ZIXB 4L4XA 1A9OA 4N4AA 2XVYA 3V3TA 2R7LA 3ENZA 1JQKA 5LQNA 4DCPA 4QPPA 2E89A 1BHO1 3IHKA 4LOHA 4XYEA 1PHPA 3GJ7A 1TQ4A 3RVPA 4G07A 1YRQA 3PQ8A 4ROSA 1OFUA 3OTOB 3H99A 2W6OA 1A2KC 2EDAA 1LWNA 1P5HA 3CKLA 5F2KA 4XB2A 3RIGA 3ZIDA 4EVRA 2QTMA 4OAPA 3EZ7A 2Z6QA 4IM7A 1CWUA 2FWMX 4PLGA 2IYRA 3RGGA 1DAFA 5CURA 4ZEVA 4DLTA 3CLSD 4Y1RA 1M34B 3HDHA 1MXFA 2B6HA 1QYRA 3N76A 3L6UA 4MPRA 4EFMA 2RH8A 4HD8A 4QM6A 3DE5X 2Q99A 5ALPA 4TLLB 4NFSA 3THXA 2ZBPA 1DWKA 4JQSA 2NU7B 3MWLA 1IMJA 5ECDA 3UF0A 1T4CB 5FWXB 1XP8A 3NBZC 4DA8A 1DKMA 1LDMA 2OUKA 2WZCA 5A9TA 5KNCD 3B5EA 4K28A 1RWPA 2L42A 2XW6A 3H87A 1Q1GA 5REQB 1XRSB 5C4IA 5AKXA 4DUGD 5C35A 4L0QA 2LLVA 3MAAC 3PKZA 1E3OC 5ALOA 5I7FA 1GZ4A 3ADOA 3BCUA 1FYXA 3DS8A 5G2OA 2CVQA 3SEQA 3FKQA 4OL0A 2PXUA 1LI5A 3D6AA 1WDWB 5FO1A 2KLHA 3AC0A 3WK8A 1U8TA 4FUQA 4YCSA 5JQWA 1SFRA 3D8RA 3CPHA 2VNHA 1C4XA 1OXVA 1JGTA 3AERB 3K0FA 4BJ3A 5IJWA 5K6AA 4Z4FA 2QJOA 4MVJF 1MO2A 1QKJA 2VYQA 3I42A 3FDXA 5EHGA 1Z0AA 1V2HE 1L8QA 3UJPA 3KVNA 3LFHA 1MN6A 4Y1EA 2XB6A 1K8RA 2GYWA 4B3GA 1Y1TA 5EJ5A 4D5GA 1GA1A 2BFCB 1IBRA 1PR2A 3T95A 4F2HA 9GPBA 1E59A 1DRJA 4J8PA 2CNDA 3HBMA 3DFIA 2FY8A 5DHSA 5EQFA 4BWGA 2WP0A 4Z58A 4C05A 1HURA 1D4OA 3BULA 1VFNA 4TROA 1JAHA 5DK6A 4Z4HA 2F00A 2J31A 3FSGA 1T25A 1Z4QA 3WGJA 2JGDA 4FMCF 2X0IA 4MV1A 2QVCA 2MMGA 5JCXA 2UYOA 3VPXA 1XDDA 1TCCA 4M21A 3K16A 1KS9A 2QN3A 5CLIA 1VIYA 4KR3A 2ONKA 1JR3E 3L0DA 3LY8A 4E5NA 2C5BA 1Y1KE 5I51A 2X9QA 3TZ6A 2PKCA 3IE1A 4AZSA 1K97A 3UWPA 3AR5A 1ZN7A 3TQRA 4HDQB 5G1OA 3TRFA 3FG9A 4R81A 3D6JA 1UJCA 4BJ1A 1ZCFA 2QRVA 4Y67A 5D51S 1INLA 1CZLA 1D1QA 4JI6B 3TRIA 3EMBA 4XX0A 3QNUA 2AT1A 3O73A 5IH7A 5C32A 1HT1E 1PEKE 5CK5A 4XFJA 1AGRA 3HGQA 5DNDA 2NPFA 3DMRA 3EPJA 1JHAA 2NO4A 3OHPA 4OO3A 1QDEA 2C2HA 2C54A 4YFYA 4CLXA 1KYYA 4U7JA 3AXSA 1XQVA 1DKOA 1UK8A 3C6QA 3T54A 3F4LA 1GTSA 4KJZA 3OEYA 4DJEC 2ZVJA 5GTDA 2OOSA 1WF3A 4HS4A 2EJVA 5JVDA 2GSWA 5FNVF 2WSSA 3AVOA 5DYYA 4O8ZA 4E5KA 4YXWD 5KYGA 3ABIA 2R7MA 4P2GA 1T1RA 2NXNA 4MKRA 1L5GB 1GGJA 5P21A 2C42A 1C14A 2IELA 1RYHA 1NVUQ 2YXNA 4LJ5A 5ALQA 1L5KA 3CLUD 3DLHA 3AILA 5JDIA 1MORA 3IEXA 4IIJF 5FOXA 3U4DA 4GL4A 4LV6A 3LUAA 4P81A 4NBRA 5AUPB 121PA 4A9AA 3T7SA 4YJFA 1T24A 1GV1A 1VSVA 1T2EA 4M0CA 1YL6A 4QODA 5JWRA 3L8MA 1QV9A 1B1AA 4KQMA 1J2UA 1TUEA 3PQ4A 5BR7A 4KH1A 4NECA 1I0ZA 3EYAA 4MVJM 3A1WA 3RUDA 5IWCA 1YS2X 3U4QA 4QYMA 1YNOA 3BC1A 5AIBA 4U0JA 2W2LD 1MR3F 2BM9A 2B5OA 4WMLA 4R1PA 1ZOIA 2B8EA 1OGYA 3M6MD 3ZNQA 2ISQA 2GZAA 4IV5A 3V8RA 1KHTA 5IUKC 4XFKA 3M7IA 3T1OA 1RJEA 1SKAA 2AG5A 1DRVA 1T8SA 1W34A 4CQMA 1QE5A 2WTUA 3LCMA 5CDHA 1NF8A 4D6YA 4X1IA 2HOQA 2RGCA 1RFGE 3KZ3A 1Z35A 1N2CE 5BW6B 2E5LB 3D59A 1FW6A 1FSPA 5JZ9A 1L4HA 4BE9A 1M2HA 1U7XA 5KSZA 1J1ZA 2HRCA 3KZXA 4C7OB 2PUGA 1T35A 3PIRA 1ZK2A 2BDUA 1HZJA 1P9NA 2GPTA 1E0DA 4EGJA 1VG8A 3IV9A 3NJ4A 1B0PA 3FPBA 4BCCA 5HTOA 1Q21A 3RIMA 4UEKA 1RQ2A 4M54A 1OKKD 4OB7A 5IAJA 3LYLA 3D8TA 1WCYA 3T4PA 4MS1A 1LQUA 4ZOCA 1MPTA 3QEOA 4BFZA 1HX7A 2FDXA 4IIXA 4C0SA 4DV0B 3W77A 2YV1A 1VCOA 3MLAA 3NHRA 4RIHA 3RV4A 2PUTA 1BXGB 2GZDA 5JMTA 2C7GA 1EINA 1G19A 3T7RA 4R31A 4HRAA 3N86A 1CRLA 2JAOA 5LMNB 1TMOA 1XROA 3OCWA 3VVCA 4JR2A 1YK0A 4H0NA 4AG5A 3KPUA 5TARA 2IQIA 2XGSA 3SLKA 5KJEA 4JR0A 4HJRA 1J24A 5C51B 1MTOA 4AKGA 3UHAA 4RVDA 2HTFA 2PQ6A 3AHIA 2RAUA 1X87A 2VAMA 1GRRA 4M89A 1SKUA 4ZTBA 4C1BA 1SOWA 4DV7B 4MB2A 4QYXA 1VL1A 5BN5B 3BBLA 2H2HA 5TGTA 3OJOA 1NQOA 1RAAA 3U7RA 4C9BA 5FUYA 2O1WA 2PZAA 1R27A 4MLZA 4Y2GA 3ETHA 2NLOA 3KEQA 4EPTA 3K70B 1WF6A 5K51A 2C88A 2FPUA 4QJ3A 1LD3A 2XF2A 2C4MA 3BTOA 2H4JA 3PITA 3O0TA 1EDZA 3KYJB 4MR9A 3E2PA 2YRXA 1LQTA 2X4GA 1GL9B 3OVMA 4X71A 3UUGA 5LWHA 3NP7A 2GBIA 2CXSA 4QGBA 4XGIA 5GONB 1LC0A 2JH8A 2X76A 3ANLA 4LQLA 2EJCA 4NARA 3NTUA 4DADA 2LBPA 1V4VA 1O54A 2Q6VA 2I7VA 2OY0A 1NW5A 1A9QA 4FYXA 3UPDA 2B30A 4HDNB 1GKUB 3RQIA 1MO3A 5TNXA 3GC6A 3TQQA 4DE8A 2Y99A 2A88A 3ZS9A 1X7GA 1N9GA 1QZUA 1JP7A 2PBFA 1AKWA 4O4HF 5E4YA 3DJFA 5ITVA 1CJVC 3S2FA 4JLMA 2BR4A 2FSUA 3FFAA 4CLHA 3IAXA 1CF2O 3A6JA 3IE2A 4ZMSA 4TYWA 2X9GA 2HEGA 2KE5A 4F6RB 1P81A 4FZVA 4GVLA 4LS3A 4TT3A 4Z1MD 3UC9A 2OL4A 3OJFA 4L75A 4CMKA 3MBIA 4KI7A 4R2KA 3EPPA 5GM2A 3IQEA 3GGDA 4BLUA 1CB0A 2J07A 4HDRB 1HT2E 1JVSA 1RZVA 1KJJA 1ZSNA 3ORYA 3IELA 4Q6BA 2GN4A 5ITZA 3HKBA 1A4RA 2ES4A 3IOMA 3KD2A 3NBXX 4ID9A 4X00A 1W96A 4MO9A 1IZZA 1HE8B 4LCJA 2WJGA 1XRQA 1IJFA 2E4WA 3RAPR 3C4VA 3WLQA 4EA8A 2X8AA 2XGOA 3K3PA 4KXFB 2PRKA 1XN4A 5ENVA 5TIIA 3SX0A 1M2GA 1NQVA 2HK8A 3GUCA 1WP9A 5FBRB 4TKLA 2PXFA 3W2IA 3GT0A 1PJTA 4FEAA 1AKUA 4PCAA 4YV1A 2NGRA 3U7EB 1Y42X 3QP9A 4F9GA 1PVDA 3D6FA 4MTLA 1UC5B 2ZBDA 4NRDA 3OSZA 4MLDA 5E7QA 4OK5A 1AB6A 2FRDA 4MQEA 1NRXA 1T36A 1HYEA 1K3FA 1HDEA 1M3SA 2HU7A 2V4ZA 3B89A 1EVEA 1T5LA 3W5BA 3A26A 4COKA 1WZNA 3MMSA 3WO0A 2ATIA 1GGKA 1KC3A 4OQZA 3P2MA 4G5YA 4CM4B 1DMRA 1D3AA 2I1LA 3HCPA 5ECYA 3F5DA 4IXDA 5FV7A 1NLYA 5LCXA 1DJLA 1EYZA 4UXHA 4IG9A 2WJJA 1UDCA 1XAGA 3MMZA 1JNYA 3SD7A 4A0SA 2GPAA 2AF3C 2BAGA 2QD2A 1LBHA 2V7QD 1LSOA 3E23A 4D46A 5AO9A 3MZ0A 5KMGA 2GRUA 4GDMA 3ONWA 3I23A 3UTDA 1PRYA 4CCAA 3DAHA 3MHTA 3H7IA 4MJXA 4KUGA 2NOAA 2XTJA 1Q1NA 4BNVA 4OV6B 5IKEA 2EFCB 3C3KA 3R5KA 5JDCA 1XA0A 2CGEA 3LSYA 4O8BA 2WNSA 4CLOB 1VP3A 1FDTA 2IZ7A 3N2NA 3K4HA 1IPFA 4QUJA 1AV6A 3LCVB 1KU6A 3B36A 4JVOA 3WDKA 2Q6OA 2QE7D 3KIPA 4H1VA 4TKMA 5ALRA 1IN6A 1LVHA 3SKVA 3T5AA 4OLBA 3DE1X 3HFJA 1ZHHA 2NU6B 4IQ8A 2WWTA 3NOOA 4WQMA 5D3QA 4WL0A 2YHSA 5D7NA 3T7DA 1EE2A 1N6HA 5B7NA 1OREA 2REOA 3GGPA 1M0EA 3ZU3A 4HLQB 1FP1D 4MHTA 1Z0UA 1Y5NA 2XXAA 3LT5A 4PEVA 3ZD8A 5IFKA 3WAGA 1DEOA 5LP6C 1TM2A 4HDNA 2HREA 4OHOA 4AKHA 1OBVA 1GDTA 4NDNE 3T1HB 2HFKA 1SIBE 3DPSA 2R7NA 2RBEA 1MBZA 3BCSA 2H2DA 3AKEA 2G7MC 4LI3X 2O8CA 1MB9A 4JU8A 2BFDB 3M6IA 3WTCA 5JSYA 2YKGA 5LDGA 3ZJTA 5AM0A 2PGLA 5JH7A 3YASA 1GKKA 1B6RA 2ERCA 1ODKA 2FPXA 2XOKA 3GNSA 3R0VA 2CE2X 3PT9A 4ZT5A 5LR6A 1OFTA 1P17A 4XGKA 2EERA 1OLOA 1WDMA 1QANA 1U8CB 4XJXA 3GLGE 3PQFA 5DP2A 2OBMA 2YYSA 3LHFA 1DT5A 3PXPA 1NW6A 5CYGA 1UP6A 3LBHA 3B60A 4PBRA 2ODRD 1PQUA 1HBJA 4NSNA 3EUAA 2PKRA 1ODTC 4UBKA 2P4SA 4ENWA 3AG6A 3DF7A 3HACA 2VL7A 1A5TA 5JALA 1MGOA 1U6IA 4AMVA 3KYIB 5FWYA 3SK0A 4J29A 2GN1A 1TLTA 2I6XA 2XUZA 3OWHA 4HFJA 4OQXA 4Q4LA 1J0AA 4Z9FA 1IJEA 1SZJG 2XCUA 5K2MA 3IUSA 3JARB 1RBMA 1RAGA 1V11A 1DXOA 1K2WA 2HHAA 3NFRA 3O90A 4CN8A 1KGSA 4A0FA 2Y1WA 2WMNB 3D6VA 2Q2VA 1RWVA 3ACCA 3BREA 3G1UA 4J16A 1A88A 5CJPA 3SEAA 2H9IA 1K8ZB 4KQEA 2VNAA 4KX3A 2J46A 2YXLA 4O2BF 1E1RD 4WCDA 1X2BA 4LNUB 1Z6TA 3ILVA 2ERYA 4G4SP 2PSJA 3SVZA 4RIEA 3VTKA 3QPCA 2BTOA 4KV9A 1R4NA 2ZP1A 4V0LA 1W88B 1KQNA 2Y4NA 4XGNA 3H5WA 3QY9A 3WLAA 3ZGNA 5J2TB 2HF7A 3SZUA 3TXAA 3USCS 2ZJAA 1O87A 2QN1A 3ELYA 1JFLA 4AK9A 1BFDA 4FMBB 4HYEA 4TN5A 3V46A 2RIPA 3EPLA 1KQFA 4BVKA 1PK7A 4FFDA 4NE2A 3D1NI 4D9IA 1PJRA 1RLOA 2HWXA 2WAYA 3BWMA 3P0FA 4QTZA 4MVJE 4TRNA 2VK4A 3OQVA 5DOZA 1D8AA 4BGEA 5JXGA 1GNRA 4B76A 1V3TA 3I9NA 2X58A 3DQPA 3KUDA 4ZT6A 1UPTA 2D59A 2ID8A 2I4MA 2UAGA 4Y6SA 3WAJA 2FW0A 1PHRA 2BFOA 1H69A 2GGSA 2X4DA 1V2GA 4UDNA 5SY6A 2OGUA 3RHFA 2A7QA 3GZTB 4MRVA 5CIQA 2CZQA 3T9AA 4E2XA 2OMEA 1TJ3A 5LZ9A 2QVGA 1K6IA 2FZ4A 3GG2A 1Z0SA 3MLEA 4CKCA 2V7UA 4TL6A 3VBEA 1BW9B 1ZRMA 2F1RA 3HHPA 4YTEA 3ZQKA 1UFRA 4FGWA 3DDOA 1HXHA 3PXCX 1P2BA 1V8PA 5EFOA 1SEVA 2JLQA 5BT8A 4F9EA 3JWEA 1KDPA 2GTHA 1E1QA 5CAEB 1ISJA 1RLUA 4DM3A 2R1VA 2QN8A 5TEVA 3FYSA 3F8SA 5D3ZA 4NS4A 3NHZA 5SICE 4I1UA 1E1RA 4N5LA 2XT0A 5JPIA 3FMGA 2GD6A 2PXTA 1V96A 2P79A 2W4MA 4O33A 5KNLA 2X40A 4JVMA 1EFRA 3HV0A 1FUUA 4R7ZA 4WVFA 1TADA 2P68A 3HB0A 2QRKA 4S1OA 3W2GA 1JKJA 4HDKB 4OPMA 3DB1A 1YJQA 3QF4A 3PUHA 3ZDYB 4JY7A 2NTVA 4CMAA 4CL8A 4DPKA 2ZWIA 4IDNA 4DLZA 4I55B 1V7CA 4FC7A 1RQGA 1I2MA 3CEAA 4FM9A 3WLKX 2P5UA 5AVKA 4OOFA 5JQGB 1PK9A 2YVLA 3Q9SA 3D6HA 1BEZA 4DA9A 1FFCA 5CT9A 1VKZA 2PUCA 2ZTMA 4II2A 1U1FA 3V4LA 1K8YB 5MN4A 3K9HA 2PXDA 1LZKA 1OX5A 4GYWA 3C97A 3GJXC 5IAEA 5JUWA 3NTQA 3MT9A 3G9XA 3VQTA 4AF6A 2QZZA 3CECA 2JEYA 2ZXUA 2D4HA 3BHJA 2H3EA 1ZBDA 1OYOA 2WF7A 3WGQA 3WYCA 8OHMA 1ADBA 2YWGA 3GCWA 4GRIA 5EE3A 1Y3CE 4O63O 1UM9B 3BWXA 3JSAA 3QKIA 4IDDA 1Z2DA 4R2JA 3PP8A 1ECFA 4P5DA 4BRWA 1B8PA 2JDID 5B7GA 5KINB 3VYVA 2BL4A 2RG1A 4X65B 2UYCA 4R8LA 4YHBA 5H59A 4ZYZA 4GM4A 4JDPA 3T5TA 3VHXA 4BNDB 2VBCA 4DANA 4MGYR 4C5AA 2B78A 3GDGA 3HRIA 2C2XA 1CDDA 3WMWA 3UT0A 2CJPA 4MW4A 1QQ6A 3JYPA 5FFFA 3LZDA 3RRMA 3SI7A 1GN8A 1IB6A 1SVKA 4C07A 1Y8RA 5EJGA 3DOCA 3RYTC 1IAVA 3ZCPA 4W1SA 5DM4A 4J3NA 2XB9A 2XQIA 3CX7A 3MTQA 1XNQB 1RADA 5LM3A 3UXMA 1Z12A 3N07A 1XJQA 2N0SA 5HEKA 1V5FA 2D2FA 2BY4A 4U3JA 4EF5A 1YA4A 1KNXA 4MP8A 5CEFA 4EZBA 3GJ0A 4LYGA 3MCAA 3O38A 4P08A 4N0PA 2C82A 1NMEA 1RPJA 2MINA 3G2MA 4HPWA 4KBFA 2H1WA 4MWCA 2XNCA 5G1PA 4EW1A 4XVCA 4FXPA 3ZUPA 2VN8A 2IEGA 4Z7OB 2PRSA 3BAZA 3BE4A 5EJEA 4N0DA 3RVJA 2CXQA 1R15A 1I3KA 4DILA 2OSVA 3W3AA 1GGHA 4H3KB 3VOSA 4D99A 4G41A 1FJ2A 2W4QA 3CNBA 1T6NA 2EBWA 1EQAA 3FROA 4U2GA 3R8CA 5HX7A 2W2QA 1W4LA 2CXHA 2G9QA 2ZYSA 1U8XX 4CBVA 2B20A 4GYKA 4CEIB 2W70A 5AHKA 5FX2A 1GPLA 4R7TA 4N54A 1E6UA 7REQB 3OJCA 1RAEA 3IAFA 2Y0DA 3H9CA 1KOFA 3G5TA 3OOHA 1G17A 3O8NA 4AJIA 2GZUA 1Z7WA 4JBLA 1L5WA 1E3WA 4JI1B 2J4CA 3H42B 2LYQA 3PFIA 3EUFA 3B6KA 4F11A 5K6AC 1E3IA 3AI2A 4LWOA 3ZH2A 5J2UA 1MABA 5KCMA 1CSEE 3V8EA 3HR7A 3KHKA 3LYHA 3P94A 1PDVA 3G6WA 1IM8A 5GV7A 4DUPA 4IO1A 1U99A 3TTWA 2Q1XA 4LJ7A 1TVMA 1SUWA 4XSGA 4E70A 2CNOA 1RPTA 4LF6B 1FQJA 4C21A 4DZZA 3S8EA 3ZQUA 1E92A 5BURA 4JWKA 4V2IA 3RIYA 2IS4A 1ZHFA 2JFQA 2RE8A 2YW2A 5DCYA 2BCEA 3WFJA 3VVBA 5FQOA 2WWFA 2XDQA 2QOEA 4CM5A 4RULA 5DNAA 5ESRA 3U40A 3WRVA 3GJZA 3PPVA 1HLGA 1F6BA 1N0VC 2HDOA 2R4TA 1E1NA 3S8MA 2ID4A 5AVWA 1FA9A 2O3JA 2Q3BA 2ILVA 1ZJZA 1PT5A 2EJBA 3ZOZA 1MABB 3MD9A 2H57A 3N1UA 2VF4X 3B1JA 4RQBA 4BATA 3NXKA 5A3SA 1U2QA 1TO6A 3F49S 1TI7A 1LMB3 3T3NA 2PWZA 4ZV7A 3BIOA 4BWVA 3M4XA 3RS8A 3AWDA 3MFQA 4LF8B 1D0IA 2B2XA 3D8UA 1GPKA 2DR3A 4JHXA 4MVJP 3F6CA 2GVZC 4B4OA 4UVDA 5J5VA 2YJTD 3ANSA 1GG9A 2I2FA 2XTMA 1BS9A 1X7WB 2XTAA 4UTNA 3AUYA 3BL6A 4EJFA 4B5LA 4XJSA 2P1RA 2NU6A 4Z7JA 2WKRA 4NNOA 2IL1A 3H4VA 3GYGA 3A1TA 4L6CA 2PGOA 3LPAA 1RBZA 4QGGA 4L9RA 4FW9A 3DCIA 5IM4A 5K9ZA 2LCIA 4ETIA 4WOBA 5B30A 2ESRA 3M8KA 1P2FA 4BQPA 1LV8A 1UADA 5ECGC 1GU0A 1XFDA 4FOPA 2F43B 1QMPA 2IUFA 5JCZA 3U1TA 3AHHA 5FRDA 2C59A 3L6BA 1RBQA 5EZSA 5ARBA 1O08A 3P0IA 4L73A 5FAXA 3TELA 2PXKA 2W71A 4KOAA 4Z8XA 3C43A 1T9HA 2Q21A 2JI4A 3TXXA 4PZLA 4EB6A 5CX1A 2CF5A 1VPTA 5DW0A 1RXSA 3F90A 1ZVVA 5E0KB 1KJZA 4JIMA 1OVGA 1R5NA 2OGWA 3O8DA 3ONVA 4ISBA 4MCIA 4YP1A 4BFVA 3FYMA 4QTXA 2OXEA 1M2KA 1YACA 2C95A 2QUAA 3VPAA 4FOSA 4KIGA 5EC8A 4ZOQI 3IRVA 7GPBA 3JSXA 4OI0A 3L1IA 4PWYA 1JTFA 1X1RA 2WIJA 5TPZA 3EUEA 4R68A 2ZAMA 4IQ4A 3VX3A 2JIRA 2AW3A 4J76A 5ICSA 2O50A 2VT7A 2C83A 4L6IA 4MCJA 1QIEA 2R0QC 8MHTA 3LWNA 1XMXA 4LSWA 4QU9A 1UDBA 2HYIC 5C8ZA 3E61A 5KJCA 2GCOA 1O3YA 3ZD7A 2R1ZA 5DNWA 2AG1A 2O6LA 1VYUA 1AK9A 2GKSA 3W6NA 5KREA 5KQMA 4ND8B 1ATZA 2BFEB 4TSKA 4TV8A 4EW6A 1ECBA 4TV9F 4Q19A 1SQ6A 2RKOA 3U4AA 3AVWA 2Y1XA 2ECOA 1OZFA 2ZYIA 4RW0A 4URWR 4YVFA 2Q41A 1OX4A 2Q5CA 5T6MA 3G8CA 2CHEA 1XZPA 4PZ0A 2NXWA 1X1CA 1TFRA 4LBYA 5FFNA 3WL4A 1FS4A 3OWOA 4BE4A 2UZ1B 5CFLA 3CH6A 4PO3X 2JVLA 3W7BA 3L7DA 4NFHA 3VR0A 1TMKA 1GZ3A 1ZMBA 1TK9A 4F9TA 3BTVA 3RS3A 5BRJA 4EVIA 3FOEC 3SCZA 3AFGA 1KZYC 2FWPA 5KOYA 3MSCA 2F67A 3QW2A 2F59A 2ZI9A 3LMKA 3G0GA 2AZDA 4E7PA 3KUKA 1SK8A 2XMSA 4TGLA 3SF8B 4Z5DA 4M8NE 4DCTA 3U3XA 5EY5B 5JCJA 1Z7BA 3D7LA 1O97D 3CVOA 3KTDA 2NWQA 4MHSA 4RXTA 2CDBA 4TVOA 5DGCA 1B23P 4TX1A 4I8TA 4JZYA 3BMQA 1TQ2A 3SQXA 4BLRA 3ND8A 1XTBA 3G2NA 3QVJA 4FOTA 3BIFA 1DL5A 2YWBA 5E6SB 4K26A 1IBMB 2R1VB 2R44A 3V1TC 1OWNA 1ZGGA 3R1IA 5B1EA 3HYRA 3DZKA 4EUEA 4H6XA 3KQOA 4HSEA 5BSGA 2GZHA 1H8HD 3R5XA 4IVNA 4LTDA 4J94A 5CW1A 3GJSA 3OM8A 3HYLA 2WFLB 3DZCA 1I8TA 5HRUA 3ECSA 4W5QA 1KF0A 2OO5C 2OXFA 4KAJA 5G0VA 4ZEXA 4MR9B 2QN7A 4NBTA 1NPTO 3J81k 3FTNA 1T29A 3LYAA 1HQKA 2FQ1A 3AR9A 3PDIA 4G84A 4L4ZA 4KPUB 5ENDA 3L4KA 1VHDA 4OX9Y 4B7AA 3R3VA 4JN6B 4EJ0A 3CSDA 3HXLA 4ESOA 1G98A 3S27A 3GJ6A 5G4KB 2QEQA 3K2IA 4C0HA 4DR5B 1O6GA 2X14A 1OX6A 3J7AC 1OAOC 4ZP1A 3S8QA 2C2WA 2ZM6B 1L5OA 1D2AA 3LHSA 3FOBA 1JG1A 1MX5A 1Z0DA 4IOMA 1C29B 1E6WA 4WNAB 1DLIA 3Q7TA 3UIEA 4D74A 1U9CA 4BNWA 1HDGO 1HSZA 3S1SA 3JVIA 1G0OA 4E94A 3TK1A 1T0UA 421PA 2CB9A 2I5PO 4FN4A 2B8WA 3C15C 1ID1A 1H0RA 4L16A 4B3SB 1NSFA 1OSNA 2C97A 1PNOA 3ESBA 3QOFA 1FFHA 1BDMA 5L4SA 3KJQA 3WDSA 4H1UA 2Q0XA 4C0QC 1FVHA 2EBUA 5JPDA 1QFZA 5L45A 3OPYI 4WZBA 3NWPA 5U4XA 1X77A 2GA8A 2RCNA 2BBTA 2XMPA 2VDRB 5I7UA 4KWHA 5JO0A 1SBNE 1FJGB 3AEUB 1C3JA 3IUNA 1KO4A 1PDOA 4HB3A 3GUVA 1Q50A 4LXQA 4WINA 1K1EA 3G2JA 4KHPB 1JWBB 3GAAA 4LDAA 4X3PA 1NXSA 4EGFA 2O8DB 3TMKA 4GGPA 5JH7F 3RZZA 3UJDA 4ENQA 1NW7A 2VWGA 1ZP6A 4HLNA 4IQGA 3SHTA 2K6GA 1H2HA 4S0XA 2PL3A 4L0MA 2B4TO 3MHPA 4PXYA 2HD4A 1TU3A 1RAHA 2J8ZA 1JQAA 4HNGA 2DTEA 4I5DA 2Q27A 3I5UA 1DDIA 4ZQHA 3TRKA 4OMCA 4KFUA 4XM1A 4NZPA 4M4SA 2HPZA 1XU7A 1R6AA 2GN8A 1G60A 4EO9A 5LQUA 1JAZA 3H2SA 5AI6A 4Y1GA 4WKOA 2A5GA 4HAUA 4EAAA 2AKYA 2NZJA 3TSWA 3WWZA 5I7VA 2YFQA 2WM3A 1RWBA 1PKEA 2QMEA 4OGGA 4CQMB 2X5KO 2RC6A 5DNUA 4NDAA 1FUYB 4RD4A 2REQA 2PFSA 3H9BA 2IW3A 3GY0A 1Z6QA 2O0MA 3VJKA 4BLTA 4YMGA 5JC1A 3L6EA 2UZ0A 3HLKA 1SRRA 1N1GA 1WPQA 3GP5A 5FL3A 2NUTA 4INJA 4LY9A 5FR1A 4DCMA 2LGJA 5EXEA 3DKRA 4PTZA 3I9JA 3TKYA 4I3HA 4AZVA 3RS0A 2B5AA 2G1PA 1D2GA 1T9DA 1T43A 2ILTA 1I7LA 2WFMA 1GXSA 2ICPA 3A6HA 3GGSA 1N92A 1YFKA 3MCUA 4JLWA 4MH0R 1QOPB 3M6WA 3ZGVA 2Y0BA 5CD9A 2JI7A 1W1UA 4G9BA 2OZEA 2G3YA 4N7BA 2WR8A 4BO3A 4R8RA 5DYIA 3OZGA 5AHOA 4ZAWA 4ZICA 3F0TA 2R6DA 3SHFA 1CQWA 3JQAA 4KMRA 2BR5A 4JP2A 4CEJA 2D1RA 2O8EB 1NXVA 1IUKA 2IP4A 4BC1A 4BFWA 4OSOA 3STWA 1Y6RA 1AUXA 1I7QB 4IJKA 1DI0A 1HT3A 2IYZA 3TDMA 1TJ4A 1H94A 4LW8A 5ER6A 5E3HA 4FILA 3WWEA 4PONA 4DTIA 1QIHA 1W35A 3KXPA 4Z6KA 2EKLA 1OLXB 2WWWA 2VJNA 3CX4A 1XN1A 3S28A 5L6LB 4NTZA 1IONA 1GPAA 1UZNA 5HQ3A 2NZVG 1HLFA 1EM8B 2QG6A 4WLNA 2GKOA 2XUQA 3K1AA 1TGVA 1PE0A 3E70C 4B6FA 2EFEB 4HFNA 4C4TA 3H5VA 2Q8NA 4GUAA 4BB5A 2W4IA 5BSTA 1EK2A 1L5SA 2B37A 1PQPA 3FDZA 4UXJA 4BX8A 1U3FA 1V0JA 3E8MA 8AT1A 3TW4A 1XT6A 3D81A 4URUR 3EE6A 3ISTA 2C77A 4GICA 5ALJA 5IFLA 3SZOA 1J25A 2RHTA 1V8FA 1NMZA 3CZCA 4X3CA 2XE4A 3AB3A 4JMPA 1N75A 4OSPA 1TYDE 1RWQA 1QQ5A 3EBOA 3PFWO 4KGZA 2PLWA 3I8XA 1CJTC 4CGZA 4D8YA 4DKXA 1KJNA 4DV3B 1AGYA 4G0YA 3SHVA 1T5DX 2BFWA 3KLMX 3ORFA 4N6NA 1PP4A 2PX2A 4LEIA 2HCSA 2HLDA 2YINC 3GJTA 3KJEA 3R5SA 4LRXA 5ADVA 2KSQA 4I50A 1CD5A 4OBXA 3IQGX 4FKZA 4UMDA 2OZVA 1XQYA 4LZLA 3U7HB 1N25A 1QRRA 4IDAA 4CMEA 3E22B 3U26A 1UBNA 3AVXA 1PJSA 5EIBD 3KR9A 3SZRA 4AX4A 1LRLA 3CRQA 5FBWB 4TQGA 5EHNA 4YO7A 1KYVA 4EVQA 3MUOA 1P1JA 4QOHA 3A11A 2A6CA 4RQUA 4PF1A 1DBRA 4H60A 4ILKA 3DO5A 4JJKA 5BSHA 1DAHA 1KJYA 3L5OA 2JFXA 3NTVA 2WHPB 1V48A 4Q4JB 4RF5A 4GKBA 3G2IA 3K0KA 3K30A 3NRBA 2ATEA 3JTMA 3H9JA 3PYXA 2CBZA 5DW3A 3O2SB 2I2DA 1XCGB 1ODJA 4GXNA 4BU0A 1E7WA 3LX5A 1FYFA 3AETA 3UMMA 3S8YA 1Q7EA 1MRZA 1F12A 4M1OA 3T3IA 3RB8A 1GZUA 2F3RA 1YB6A 2C1ZA 2OUIA 4JS0A 1R66A 4MR7A 3WICA 3KT6A 4IQFA 5IPFA 5JSQA 1DULA 3UFDA 1H23A 1R4MA 1S2GA 2XUPA 3EH1A 4D8UA 3A1SA 3ES9A 1QAMA 3MINB 1M76A 1X1SA 1O95D 2A57A 3CBGA 4K9MA 1MJNA 1LQCA 4KE7A 1SU6A 4OREX 1P1BA 2ZGVA 3JQGB 4MTCA 4OM7A 1HWYA 4TZ0A 3OA2A 3WYAA 3TBHA 1R8YA 3PQ5A 2NW6A 4LVCA 1QO9A 1OXMA 1JSZA 2AJTA 3DEHA 4L8YA 5CYFA 2QQ0A 3BE5A 3CQ9A 4FHGA 4B6QA 2IOFK 3BMXA 1JA9A 2D7JA 3H6GA 2W42A 5LXTA 4IKEA 4JV5B 3GT4A 2V4MA 3LHDA 2Q1TA 2ECFA 4D98A 1KYXA 2WE7A 4DGSA 1TJPB 1N2XA 4U9HS 4N47A 1XF9A 1VXRA 1WMBA 4MRMB 4NI5A 1LBTA 2IU4A 1NYRA 2W9XA 1KIAA 1VSUA 2AWNA 4OXYA 4QUGA 1E4OA 3CM0A 4LF9B 2C1EA 5HILA 2GAFA 3JASA 3F71A 5A4MS 4YJGB 1JMYA 3UJNA 4K6FA 4CKWB 4MZDA 2QROA 2WYHA 4XYBA 3HN6A 2LWIA 4YASA 4HVLA 4TM7A 3PX3A 4XYMA 1EWKA 1KFJB 1Y7TA 1PJBA 3I39X 3O8LA 2AUNA 4GE3A 4N39A 1U8ZA 1HTBA 1HQCA 4LGVA 1O57A 4PVDA 4B1FA 3AKCA 1VTKA 4TZKA 4ZYTA 2F1OA 2ZULA 3TNJA 3CEHA 4O4HA 4MIKA 3LK6A 2V1UA 1Z0IA 3HP1A 4KPGA 5AM1A 2WQZA 2FZLA 3U1VA 3TNYA 5K8VA 3FPAA 3OLCX 2BFBB 1HYGA 4WACA 4Z4CA 4ND3A 7AT1A 5DI3A 5EQDA 4GBJA 3EIXA 2J08A 1VL2A 3G0HA 3EZYA 5GPBA 4XM2A 2XOXA 2JZCA 3A9RA 1Q0SA 4GOJA 2BSAA 3OOJA 3G8YA 1UANA 3Q3IA 5H68A 3VR6D 1XWFA 2K7FA 3B12A 4MW6A 3WLLA 4F3NA 1CRPA 4OA8A 2AWOA 2PUJA 1X57A 3AOEC 1FFXA 1PERL 2QXTA 3I2IA 2VJQA 3RARA 1DJNA 4BX9A 2QAGA 1E6KA 5EWMB 3OZRA 2H2WA 3DEYX 2YJ5A 1C30A 2FR0A 3TRHA 2O2IA 4QAQA 2FJPA 1E0AA 1JT2A 1SHZA 4MWBA 2ZRAA 3OQOA 4OSEA 1I2AA 2Z43A 1P1KA 1Y8RB 2HSDA 1A9XB 1WCXA 2IXTA 2Q1UA 4FP9A 1COWA 4H4EA 4JCOA 2HSJA 4UM8B 4OI4A 1B26A 4JQDA 2NZUG 3CNHA 1XD8A 1JSCA 3M4JA 4OQMA 3SQMA 2PBZA 2WUWE 2LUOA 5CIYA 3CURA 3IBFA 3KELA 3V4VB 4YIHA 5MGNA 1RACA 1X15A 3GIWA 4YY3B 3H97A 1B0AA 2HWKA 2YFYA 3IDFA 1ZINA 2QJTA 1ECGA 1P9LA 1U8FO 2WTMA 3FMOB 3HDGA 3G7NA 4X90A 2DB3A 1K3TA 1EQUA 1LVGA 2QLTA 1XZIA 3H17A 4EGAA 1U7TA 2V65A 1PFUA 1CQIA 4RBNA 4YLYA 4RF3A 1ORDA 3II6X 1ELOA 4IIHA 4M9RA 3WE7A 3L7AA 1AK1A 1ZICA 3QKSA 1BFUA 4BN0A 2FW7A 3EZFA 4IJ5A 4JUAA 1TZKA 2VC2B 1PTJC 2EKPA 2ZLBA 1P5RA 2FE4A 1ETUA 1IHUA 1SCJA 2DWPA 3PD0A 2IHNA 2I9PA 1O9BA 2I6GA 3OIDA 5IYZA 5D3MA 4EFDA 3B7PA 1O58A 2EF8A 1YAJA 2XXJA 2Y0EA 2YNMA 3ZWBA 1FYEA 2GBPA 4A26A 2XZLA 5AIAA 2GR9A 4QFDA 2WZBA 4D9EA 1FUEA 3QBJA 3OMTA 4H35A 2IBSA 5L3SA 4LBZA 5GIPE 2FA9A 2A5JA 2HQBA 2WUEA 3O4JA 5CA1B 1E6CA 1RWWA 2IIQA 1PZHA 4IDHA 1QHHB 1NNEA 2WIGA 3EVAA 5FBHA 4HZIA 4PFQA 1DKLA 4OYHA 4LJ6A 5TPWA 2PX3A 2QM8A 3DEFA 3KQWA 3C45A 1DJMA 1P31A 4OYLA 3SF0A 4JHLA 5BO5A 5KOJB 5ISMA 3AB8A 3AP3A 1YKFA 4G89A 4HRXA 3SSOA 2EC5A 4RVCA 3DMYA 4GC9A 3DNVB 1Q5PA 1VLJA 3A1FA 4JT4A 5A7HA 3T7JA 1SA0A 5JTTA 1TEXA 1GQRA 1MOPA 2MMCA 3S4YA 4CWAA 1QQ7A 4YRMA 4C78A 3ESDA 4G0QA 1S8AA 1T9CA 2F90A 5KMGB 3V1LA 1E9BA 4B17A 5A04A 5FEUA 1X7XA 4MROA 3UFXA 2Y68A 3K1YA 4ENTA 3MTEA 5FOSA 3KKMA 1ZVMA 3ENVA 2MCFA 4AJ4A 4F91B 3G13A 4CLRA 1LLFA 5HIAA 2F17A 1T2DA 4EKGA 4MUFA 3U16A 1R88A 2VSXA 3H4IA 3QWHA 1HKUA 1NWCA 4I4NA 3RGWS 3G59A 4DBLC 1UXIA 4HH1A 3VJMA 5CJJA 4EJ6A 4C01A 1Z6GA 1IG3A 3BRSA 3NV9A 2BUCA 6CHYA 5JVDF 4KR2A 3IQDB 5GOTA 4FFRA 3KYCA 5E7MA 4PTLA 1P8AA 1BJRE 1F51E 1XQ1A 4MQFB 5FUQA 3X2EA 2G7ZA 1CUDA 4UEJA 3ZY3A 2PLNA 2PPLA 5IUJC 3MAGA 2XZDA 4K03A 4C08A 4OJTA 2Z4SA 1LEHA 4PGMA 2ZPAA 1O96A 2DKNA 1JHMA 2MOKA 3IR5A 3IFSA 3WIUA 4LSMA 1NN3A 3CG0A 4DZRA 1RI2A 2DU8A 3B20A 4NOJA 1AO0A 1RLMA 2WD7B 1R10A 3RFXA 3WLSA 4G4SO 1XVTA 2EJUA 5E9QA 3TR5A 4C1NA 1N2IA 2D2IA 1E63A 1JJBA 5JSHA 2IU3A 3B82A 2BOVA 1RYDA 2ZUSA 3FGZA 4MQ5A 5JBIA 5IXJA 1UKEA 2DJIA 1KMHA 2PZEA 3FYUA 4X0EA 3C87A 3K94A 5JROA 2I4LA 1NVBA 2GD0A 2FUG6 3H2KA 3INRA 3LT4A 4JUFA 4P7JA 4W8OA 5EZ6B 5ICGA 5KTPA 2PXVA 1TCUA 2QM7A 3FM9A 1XZLA 2NUPA 2PEZA 3P4UA 2KPJA 1KJIA 4J43A 4M53A 2PRYA 4PX5A 4R40A 3SQLA 3VU9A 1CP2A 4BNKA 3QH4A 2ID7A 2J3IA 2GD2A 3FUTA 3FGOA 1G0NA 5B58C 4KQXA 1ZC4A 3QKRB 3QX9A 2XUOA 1E8NA 2Q2WA 2V97A 3M3PA 5J4KA 3PNSA 2XBMA 3BIWA 5FPPA 1JDTA 2TECE 4I36A 4UCXA 5KSPA 1ESZA 1RYZA 1TEVA 1G6KA 3BRWD 4FHEA 3K0HA 2QV7A 1VYVA 4J1TC 1ZZ6A 1VGVA 2BFMA 4BO0A 5C5EA 3GD7A 1YS6A 4I4LA 1KWKA 4B2IA 1D2CA 3AUXA 1ANKA 3B9BA 3PEUA 2ZI3A 2XKKA 1O4WA 3LY5A 3PJGA 2F9LA 1EJBA 1W0JD 1ZQ9A 4MVJA 2YMPA 5J1TB 3CTMA 3V6MA 2CNWD 2IX9A 4WCFB 3FNRA 5CP8A 4F6LA 2I2XB 2RHCA 2YOGA 1KFKB 1XDSA 1V47A 3EVFA 4S2EA 3ZVRA 4RA9A 3TXYA 2OHFA 3PC8A 4EX6A 1AURA 3MINA 3ZD6A 2KLBA 1O89A 2W2KA 4WKGA 1X7ZA 4ND7A 1Q22A 3DE3X 3MOGA 1W85B 1M8KA 3VZBA 3D7RA 2QYHA 5FUBA 3NWJA 1IZ8A 1PD1A 1FP6A 4GRAA 3AKDA 4HN4B 3QE3A 1TVKB 3AP1A 3H19A 4BV9A 2ODQA 4BFYA 4R8KA 1Z22A 4CKXA 3GNTA 2BDEA 3DV0B 2VSOA 2WSMA 4N7JA 1Y3FE 2C2YA 2XCOA 3PUWA 1OQAA 3RJTA 1QLWA 4WUVA 4RENA 3BXOA 4M1WA 1C2YA 3WY9A 1A8SA 3LVBA 3DONA 5GJWC 4KR6A 3EVZA 5B12A 3IHWA 3M83A 3RSLA 5JJKA 2O52A 3WZMA 3VNUA 4Q7MB 2HMYB 2P9JA 3PSHA 2VRNA 4AB1A 5CNKA 1WS6A 4Z3OA 3E18A 4MVXA 4PAGA 3F73A 3BRWA 3SG0A 1E5VA 2PBRA 2IEAA 2ZI5A 1LZLA 3B51X 3DZDA 2M1XA 1QFYA 2IHKA 1L7RA 3A28A 3Q87B 4B5KA 5JCPA 2BH2A 3NTXA 3AI1A 4HY3A 4J03A 4J4BA 2MEZA 4B34A 3X1DA 4A2QA 3ZDCA 1NAIA 2VUIB 3JD1A 1JFFB 1C7FA 4RTNA 1RJGA 3F78A 4C7JA 2V8OA 5ICMA 4BQSA 2PZ8A 3FCCA 4NWIA 4D9HA 4W5OA 3UMYA 2ZT7A 1DE0A 2QRNA 3DD5A 3LF2A 1NW9B 5IYZF 4N9WA 4G8CA 5IT5A 4QYWA 1DWUA 1PGQA 1T1GA 3BHNA 1J70A 3E84A 3HH8A 3PNQA 5AKGA 2FP4B 4GI7A 3JQ8B 2O4AA 4TMVA 4AJ2A 3WWDA 1D04A 4ALIA 3ILYA 1D8TA 3L1UA 3MJ4A 3SOZA 5J1SB 2KPOA 3ED1A 2QU8A 3GU3A 4K6CA 2XYVA 1WBBA 4CKBA 4DRXA 2YBEA 2G8LA 2BMWA 3UCFA 1T15A 1UPAA 3HEMA 4HSGA 5IANA 4EG0A 1XVUA 1TQHA 2D13A 1EBBA 1FX1A 2CVPA 3DTVA 4OKNA 3EQ8A 3HB9A 3QPUA 1DC7A 3G5AA 2OV2A 4IX1A 1YOBA 4CE6A 1G3RA 2Z4TA 2ZPUA 3AM5A 4IDCA 4NH0A 1S3IA 2JI9A 3F7OA 5DCWA 2FCAA 5CW2A 4UM7A 3H65A 1U5BA 1T4DA 2A1TS 1GQSA 2ATVA 3TFLA 4B9AA 1E1KA 2JIDA 4Q66C 1BFKA 1KKUA 2ZS8A 1HFWA 4DPLA 4R1QA 4JX9A 4QDTA 1ZFNA 3CN7A 2BP7A 2B0CA 3TN7A 1EHIA 1Y7LA 3AG5A 2B94A 4MWTA 3S99A 5JTUA 3ZY5A 4JX8A 3LTEA 5DIZA 1Z9BA 1F5NA 3S2YA 3TIVA 3FSGD 4JXZA 1BDBA 3FTPA 1N3IA 1VB5A 2DM6A 1O8BA 1QH1B 3N8GA 4IGKA 3TL2A 3I58A 4IUDS 4WKNA 5EPUA 4BFTA 4CV2A 4JI8B 4ZYLA 1Y34E 2ORWA 2Z6UA 1U5BB 1BDHA 1OHHD 2ZJ4A 2RDMA 3DBOB 4G23A 3RHTA 3KSBC 4O2AA 4EKEA 4A8JA 1RABA 1X9HA 3F47A 3VNSA 3GEEA 5BMVA 2WUGA 2PXAA 5C7LO 3HV2A 3EGIA 1SVWA 2VLBA 3RUAA 5EIWA 2R00C 2R62A 4RHEA 1RXEA 4TLCA 2EFGA 2GZMA 2KJQA 3WGNA 4FR0A 5F7XA 3A06A 1XL1A 4M1YA 1Z62A 4OLFA 4XKJA 2DSTA 4YAJA 4DCCA 1HG1A 1MX1A 1VIAA 3ZKAA 3U31A 4IVRA 3U4CA 4JC5A 4PYLA 3HCCA 4W5NA 2YHAA 3TR0A 2HSEA 4QATA 3GPBA 2O05A 2DBVO 4X4EA 3BWEA 4FOLA 3HHEA 1SG9A 3UYKA 1WXIA