2PUCA

Crystal structure of the laci family member, purr, bound to dna: minor groove binding by alpha helices
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
338
structure length
338
Chain Sequence
TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLEANTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*AP*CP*GP*CP*AP*AP*AP*CP*GP*TP*TP*TP*GP*CP*GP*T
publication title Crystal structure of LacI member, PurR, bound to DNA: minor groove binding by alpha helices.
pubmed rcsb
source organism Escherichia coli
molecule tags Transcription/dna
total genus 116
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 1997-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2pucA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pucA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pucA02
3RVQA 1ZZ6A 1DZ3A 1FFWA 2HQOA 2PUDA 1WH6A 1ABEA 2H0AA 2FMHA 4GPAA 3ROTA 2L8NA 2YHBA 4MS1B 2M98A 4JQDA 2O4AA 3VK0A 1X57A 3G85A 2GKGA 4D6XA 1QP7A 5IUNC 3QLUC 4JP1A 3LUKA 5TQ2B 4YG7B 4PU3C 3EODA 5TQJA 2QR3A 3O1HB 3R0JA 4JASB 1ZVVA 3C3KA 4JB2A 3EQ2A 2XIUA 3KJXA 3BRSA 1D2AA 5BRJA 1B00A 2FJRA 2AXVA 5IBQA 1LBIA 3JVIA 4F11A 3TMYA 3LISA 2FSPA 3OQMA 3IDOA 1NXVA 2KYRA 1M2FA 5TPWA 5FWYA 2FQYA 3RVPA 3GN5A 2LPMA 3GL9A 2HQRA 1USIA 2FXIA 3A10A 4MS4A 4N47A 1JF8A 1U04A 3ZHMA 2MSKA 2PUEA 5FWXB 4J1WA 1GCGA 3IP9A 4Q6WA 4YLEA 4Z9AA 4W5TA 4RK5A 1RXEA 2PKXA 4QPJC 3DGEC 1VRVA 2XJ3A 2JVLA 2PUAA 1UTXA 1RPJA 4KVFA 3FFXA 5BRAA 3B7HA 2HPHA 4MR8B 2MYUA 1T34A 1GT0C 2OQRA 2R48A 3A3KA 4X4BA 2PUGA 4LX8A 1BVHA 2KZ8A 5CNMA 4YARA 1MB0A 3LOPA 3OMXA 3RVMA 3SNKA 4O1IA 2HJ9A 4KK4A 3O2QB 3QELB 4JOQA 3K4HA 2IVBA 2JB9A 3CHYA 1QO0D 2WWVD 1SXIA 4YBAA 3QLTA 3LFTA 3HO1A 2A9OA 2XSDC 2MQKA 3RVKA 3UFDA 2L2QA 3G7DA 3KYIB 1BAPA 3VNAA 5ABPA 5IEJA 4RZSA 1WH8A 4JCXA 4L4UA 4RKRA 5KQLA 3DNVB 4H60A 4F8JA 1DJMA 4XAQA 3URMA 3RH0A 3CKMA 1USGA 4IILA 4F12A 4KFCA 1PERL 2NZVG 1TM2A 2CWDA 4WT7A 3FMYA 1SRRA 3HZIB 4ZMRA 2RDMA 3O9XA 1KRXA 1NEQA 2XCJA 5ED4A 1MAVA 3N6VA 4LE0A 4KQ9A 4RSMA 2JVIA 3HS3A 5EWLA 1H9CA 5HM6A 1Z18A 2ZWMA 1JFVA 2ID9A 3CS3A 3GYBA 5JNTA 4W5NA 3CLKA 3JPYA 3SQNA 4B09A 2MYNA 4L85A 2WY2D 2IU7A 3BILA 4O5AA 4ZYLA 1LMB3 2JK1A 2L19A 2M1ZA 4MS3A 3HK2A 3GRCA 2KEJA 2PL1A 3FYAA 4TMYA 1PNTA 4Y9TA 3GV0A 4F3TA 1CJGA 1LQCA 1SXGA 2HQBA 5DLEA 1POUA 4IF4A 5IX8A 1ISRA 1BA2A 1E6MA 2H3HA 1JFSA 3GN5B 1RZSA 1JYFA 2FQWA 1Z16A 4JCYA 1JYEA 4JAVC 4WUTA 4MR7A 4KPYA 3F6WA 1KGSA 1DCMA 2FEKA 4XASA 4YRZA 3N75A 3IP7A 4Z4EA 1CEYA 2LCVA 1PNRA 1PRUA 3CECA 4X4CA 1W25A 3LUGA 4KMRA 2QZJA 2KEKA 3N0WA 4GQMA 1ZZ8A 3MYYA 1LJLA 4FE7A 4KZKA 5PNTA 2PPXA 3RVRA 4MCXA 1CYEA 1DWKA 2ICTA 4N0QA 3H5LA 4H3HB 4FB4A 2DRIA 2WB4A 4G0XA 4Z4HA 2HINA 1DBQA 3OO1A 2JBAA 1YS6A 3QEKA 2A9QA 1JX6A 2IVQA 4X4IA 2FN8A 4LDAA 3SM9A 3HEBA 3DBIA 4M88A 4RK0A 2LIVA 2R1JL 1ZUGA 1ADRA 1YS7A 2ICPA 5JNSA 3F6CA 4PE5B 4DQDA 4TLLB 7ABPA 4NCBA 1PEAA 3I5AA 2IOYA 3QLVA 5K98B 5B3JC 4X4HA 2B1JA 5C5CA 1YTUA 1W9HA 4ML3A 9ABPA 1AB5A 1HEYA 4O1HA 2B4AA 1U2QA 1XHFA 1ZGZA 3OLZA 1PHRA 2GI4A 3IPAA 3JVDA 4Q6BA 5DKFA 4NQRA 3T38A 3B2NA 4Z58A 1DCKA 3O1JC 1KRWA 1ZITA 2QVCA 1TMYA 2A9RA 3BREA 4RV5A 3TO5A 1Z2DA 2YHAA 2I6FA 3CFYA 4G0OA 3SY8A 1ZZ9A 3OMWA 2BNOA 3O21A 3BBLA 3D02A 4F8DA 4GNRA 4Z5CA 3UKJA 2MYTA 2O49A 4JB0A 2CD7A 1Z2EA 2FMIA 2ID7A 1P6QA 1USKA 2Q5CA 4N0PA 1L5ZA 5T3YA 1JL3A 4OTZA 1RXIA 4Z4FA 3N0RA 5E3JA 5HSGA 1AB6A 3NNNA 4KK3A 3S99A 1K68A 3RVOA 3F51A 4OB4A 1PEYA 1ZH2A 3QEMA 5EWJA 1IC8A 4FE4A 2EBYA 4HNSA 3H6GA 3QYXA 3NNDA 1RZRD 4IMIB 3CG4A 1OXBB 5EWMA 1SXHA 1LJUA 4MR7B 4D74A 3KTOA 1CHNA 2LP4Y 3NNSA 3VNBA 3CNBA 2NZUG 3ZHIA 3IPCA 3QQ6A 1DP4A 3M6MD 2PMCA 3IP6A 4RS3A 1NXPA 2O38A 1LCCA 3F7NA 4LDZA 4X4FA 2FLWA 4J1XA 1APBA 2QV0A 4G86A 1TVMA 2MSLA 4WXEA 5IEBA 2EF8A 3HVRA 4H3KB 5JS1A 4RY0A 4YP9A 4N03A 3TB6A 3GBVA 4G0MA 2WRZA 4W5OA 3EQZA 1MIHA 3S8QA 4MRMA 5IUKC 5DGCA 3G1WA 3HUTA 2BNMA 3QLUA 1XWWA 1OSLA 1FSPA 1D1PA 4ETIA 2P4UA 4I8TA 4OATA 3F52A 1EWVA 3OLYA 3OLXA 3EJWA 1LCDA 5DCLA 3A0RB 4I6RA 1JH9A 3LUDA 2E4VA 2IUOA 3O2SB 5CNKA 4NV3A 1QKKA 1IIBA 1SD5A 4MR9A 3CROL 3CG0A 4YG1A 4XXHA 4EVRA 3TRBA 2FW0A 3T95A 2AW6A 2LYLA 3O75A 3HUUA 1EAYA 1PUXA 1Z13A 3FDFA 4X4EA 1JWLA 2O20A 1Z12A 3LUFA 3QX9A 1WIZA 4RY8A 5KQMA 4W5QA 1E2BA 3LKBA 1ZAYA 1MB3A 3FFWA 5CHYA 2GBPA 3FMVA 1I3CA 1SQ8A 3HXMA 1Y9QA 3NHZA 4TLMB 4YGXB 4Z5HA 3JXDL 2AUWA 2JCGA 2A9PA 4QICA 3EAFA 1L1MA 1C0EA 1FQWA 1LK0A 3GBPA 4KNYA 1OXKB 4KV7A 4PEVA 4O8BA 1YVUA 1JLKA 1ZY2A 2FMKA 4PU8A 2R4QA 5CNIA 3BRQA 3H5VA 5GOTA 2MSWA 1DW9A 2TMYA 3L1PA 2QU7A 4KQCA 4MQEA 2FQXA 4E7OA 3JS5A 4MLDA 1DG9A 2IDMA 4OG2A 3I09A 2W42A 1ZGGA 4NDWA 4FBIA 2WJAA 3BDNA 4Q7EA 5FWYB 1A0OA 5TPWB 3RZZA 4NICA 5EWMB 4PZ0A 6ABPA 2BJCA 1Z17A 2OENG 1VLZA 1OCTC 1ZN2A 3OM0A 1ZZ7A 4MCTA 1R63A 2OFYA 2HSGA 3H5IA 3HDGA 1F4VA 3QX8A 4MS4B 3RVSA 2IPAB 4S04A 4KREA 2IYNA 1QQBA 1HF0A 3H5WA 5TQ2A 2E4WA 1ISSA 1PRVA 1NATA 2PIJA 4PU4C 2IKSA 4Z9BA 5KC8A 2MEZA 2P9HA 4N41A 2LYPA 3QLVC 1ZDMA 4IMJB 1NY5A 1YSEA 1QO0A 1EWKA 4EYKA 3OQNA 4EY3A 2E4UA 1Y1LA 2QVGA 3MQ4A 3KXAA 4G0ZA 2PUCA 3Q7RA 2F8SA 4EYQA 1DRKA 5JNUA 3KKEA 3HJFA 1UXCA 4WZZA 4I6UA 3DZDA 5DTEA 3NHMA 1ZESA 1U0SY 2CHEA 4X4GA 4EVSA 1WETA 3FGZA 4JA2A 3TD9A 1DCFA 5HQJA 2AYZA 1NXWA 4MYRA 1M2EA 4D6YA 5FWXA 1U2PA 4Z5DA 4EUKA 5A7LA 3MF4A 5CNJA 1Y7YA 3PXPA 2F8TA 1EHCA 1YK0A 3RVJA 4YWHA 3LFPA 2RJNA 2PAFA 2AXUA 4Z59A 2CHFA 1MVOA 2R25B 3HZHA 3H1FA 5IUJC 2V0NA 1ZZCA 4RY9A 4NCAA 1URPA 2NT4A 1M5TA 1NXSA 2VUHB 4RXUA 2LBPA 2WMYA 4EYGA 5F64A 2BGGA 2R47A 4XARA 3QELA 3ILYA 5EWLB 4PYRA 3OLVA 2PLNA 4P98A 3I42A 2KPJA 1L5YA 3RQIA 2LYQA 3KLOA 4E7PA 3JXCL 4FN3A 1UDRA 4WWHA 1TJYA 3HSYA 2IVGA 2FVYA 2R63A 3NBMA 2RGYA 4MS3B 4MQEB 5TPZD 1JFTA 3C3MA 1NXOA 1D5WA 3QK7A 3JTEA 3A0UA 4WXMA 3FYMA 3OP9A 1DBPA 1E6LA 2E4XA 3LMKA 1YK1A 4G0PA 5FBKA 1CQTA 1BDIA 3ZKCA 2QXYA 3QF3A 1X2LA 5IULC 1U8TA 3OO0A 1S7EA 2CSFA 4HNRA 4MAAA 5BR1A 3GWGA 4LZLA 5B3JA 4N76A 4PICA 1NXTA 5GQSA 1P6UA 2PL9A 2IPNA 5IC5A 3LTEA 6CHYA 1PRAA 2FEPA 1NTRA 4X4DA 4LE1A 2XI8A 3D8UA 4ETNA 2LYKA 2XDYA 3LUAA 2GZUA 2IPLA 2B5AA 3F6PA 3KCNA 3SAJA 3H1GA 3Q7TA 3T8YA 3LUJA 4MQFA 2J48A 4W5RA 1UXDA 1J56A 3EDCA 4TN5A 4IGAA 1E3OC 2JBAB 2LYSA 4Z4GA 3MLFA 2X7XA 3KLNA 4RDCA 1O4XA 4G0YA 1DBWA 3KG2A 3O2JA 2N9UA 4Z0NA 3DLBA 4MPTA 2WIUB 1VKRA 2NUBA 3Q15C 3SG0A 4HNQA 3C6QA 3H1EA 5KQPA 4YV7A 1B0NA 1GCAA 4UHJA 1GUBA 3G5GA 3N0XA 3EGCA 2FMFA 3GBFA 2H8RA 3MMNA 1ABFA 4QYWA 1LBHA 5FBHA 5TPZA 5C5EA 1GUDA 3MA0A 4RK4A 3RVNA 1ZPQA 1R69A 3P9YA 3HCWA 4S05A 3JXBC 1RIOA 3KSMA 2FEWB 3IVPA 1KMIY 1E6KA 4RXMA 3UK0A 3N53A 3DGFC 1XHEA 4IRXA 3D1NI 3H5TA 4ZPJA 3UUGA 3I45A 1QPZA 1F51E 3BS3A 1RZRA 3KYJB 1JHZA 2L18A 1EWTA 3LKVA 4RK1A 3H75A 3ILHA 3JPWA 3MM4A 4QYMA 2A6CA 5TQ0A 4ETMA 4Y42A 4EYOA 1DRJA 1DC8A 2CROA 3HDVA 2D5VA 1VPWA 2FLKA 4YCSA 5KQGA 1XWRA 1LLIA 3QEMB 3H5OA 5EWJB 4ZMSA 4KRFA 1FFSA 3IP5A 2AXZA 2GRMA 4GHJA 3KZ3A 3ROFA 1EFAA 2FKAA 3C3WA 1YMUA 1GLGA 2LUOA 2GX6A 5T7BA 1DC7A 1P8AA 5KWSA 4MS1A 3BD1A 5JS2A 2KEIA 2AWIA 8ABPA 3L49A 4HYEA 4DN6A 3SCFA 3R1FA 2IV1A 1TLFA 2WJWA 4OBBA 3W9SA 1QMPA 2L49A 1QQAA 3Q9SA 2QSJA 4IA8A 1A04A 1A2OA 1FFGA 2PUFA 3OM1A 3KS9A 3O1IC 5HKOA 1YMVA 3OQOA 1C4WA 3OLWA 3CTPA 4ZJPA 2VYCA 1JDPA 4IVZA 1ZH4A 4RXTA 5JNRA 1JDNA 4LE2A 4MQFB 3TX6A 1QP4A 3OMTA 1P2FA 2JVKA 4I6TA 1D1QA 2ZAYA 3E61A 4RKQA 4EGSA 3LUHA 1K66A 1Z25A 3H6HA 3Q41A 4F06A 4DADA 5BQ3A 4MRMB 3N8IA 1R8JA 4YR7A 4MGEA 5JNVA 3T6KA 1D4ZA 2IPMA 2VK2A 4YS6A 5D2CA 4EVQA 5I4CA 4Z4IA 4OLBA 4RU1A 2EWTA 3QWGA 3KHTA 2LYJA 3F73A 3CU5A 4XFKA 1BDJA 1JBEA 4MLCA 2GRLA 2AYXA 1ZS4A 3LUCA 2E4YA 2JRLA 1AU7A 1NXXA 3SCHA 1QNLA 3M9XA 4MR9B 4RK6A 1Z15A 5KC9A 3E3MA 1BDHA 3SCGA 2JVJA 2L17A 3GA5A 3K9CA 4MR8A 1Z26A 2BNNA 1ZHHA 3HV2A 1M5UA 2VUIB 4RK7A 3U3WA 4YG4A 1ZZBA 1RNLA 2PE5A 3GT7A 3L6UA 3O74A 5KI6A 2MYPA 1NERA 2GWRA 2RJOA 4XLTA 2FN9A 3FFTA 4G97A 1RPEL 4LRQA 3HM9A 3DLHA 3CZCA 3EULA 4YO7A 2PUBA 4Z99A 4Z4CA 2QW1A 1QP0A 2FTKE 4CBVA 3C97A 3CZ5A 3Q7SA 4G0QA 5TQ0B 1YIOA 2NT3A 4OLAA 4PU7A 2OR1L 4UHKA 3CRNA 1S8NA 2PJUA 3JY6A 2WUSR 2E4ZA 4RWEA 5TE9A 3MIZA 3RVLA 3M9WA 3EUSA 5JNWA 3CLCA 4P1ZA 4IWRA 2LYRA
chains in the Genus database with same CATH superfamily
1ZZ6A 4BFXA 3GZCA 3FKSD 4D92A 3QKTA 4YRFA 2OV1A 4GPAA 3ROTA 4RDXA 1EK5A 3NVAA 2Y71A 3S5UA 4OFWA 1QP7A 1QCCA 2J9RA 3CONA 3P9SA 4HEA1 4G26A 1TC1A 1SOUA 3T7TA 3D8NA 3BIFA 1IM8A 1E2FA 1X13A 4X00A 5A3VA 3FTEA 1HDZA 2H1CA 3NCHA 1YKFA 2DHEA 2P2YA 1L1EA 2C5BA 1YA4A 1CZKA 1OU0A 3M4JA 4ZAFA 3V2HA 1BXZA 3CBGA 3PFBA 1IQRA 1P0CA 1W5EA 2IZ6A 3GGGA 2OHOA 4EI2A 1QHEA 3D7NA 4KDEA 4W6QA 1RT9A 3OZUA 3DZHA 3HN7A 2AZTA 3LLSA 4A0FA 2FQYA 1B0PA 4DGQA 3QSYA 1TEHA 1FYXA 3OY7A 3T3IA 2NM0A 4JX8A 4R6XA 1JQBA 5CPBA 3GYGA 4AG3A 3KXIA 4OU5A 4DYDA 1JF8A 1V6AA 2BWJA 3WWYA 3K9WA 3A2LA 1H0KA 1L5LA 2RK3A 5IJZA 2P67A 4YLEA 1JSXA 2GAJA 1PSZA 2HOQA 5KU7A 4P3OA 1T8YA 1WD7A 4KGVA 4NMMA 4Y0AA 1HF3A 2QS9A 3BWMA 3D6JA 1YBAA 2B78A 3V8MA 3IR7A 2YRWA 3BL6A 1JXQA 2WNHA 4FIZA 2X6QA 2JLBA 3LOPA 3CRW1 3NAGA 3UH0A 3KSAC 4B8WA 4Y9UA 4QECA 1L4LA 1P3Y1 2NGRA 4HNAB 4ZEWA 1S3FA 2VPPA 4R9NA 1C9JA 2XZTA 1GKKA 1QGDA 5CVJA 1W46A 1E2DA 1L7QA 1JE0A 2X22A 3D2LA 3F98A 5HKAA 2DY0A 2NXEA 4MZDA 1RHKA 4M1TA 1GCIA 5DGDA 4OJQA 5HTKA 3BT7A 4TYWA 1QHNA 2JFQA 1BAPA 4JJ4A 3MTIA 4C5BA 4G1EB 5AVZA 5ILGA 4LN1A 1FVFA 3OIGA 1GCUA 1QIGA 4JUCA 4M8NE 1ARZA 1UUFA 4RE6A 3DAGA 4RZSA 4QWMA 2QYOA 3PKJA 1A4RA 1UMBA 1R6XA 4P9NA 4PANA 4PG6A 1IN1A 4I4NA 4QASA 2HI0A 4OB7A 3VR0A 1JDVA 3F3MA 1O5OA 1QFMA 4M9XA 1W1IA 2QENA 3DR3A 1A72A 2HSWA 2FWBA 1R4MB 3LRXA 1VLJA 3UMGA 1WXEA 3ILSA 1VHLA 3JATA 3DSRA 4D2IA 5SYMA 2YC4C 2O8BA 1Q95A 3TI7A 1KKMA 2AGVA 4JGBA 4N5IX 4B6GA 2I4NA 3TNLA 1XO1A 4ZQGA 5FTKA 1XRRA 4REQB 4HB0A 4ZYLA 4DUYB 3U5ZB 2RONA 5IT4A 3NVMB 2BM1A 1LMB3 3QWIA 2M1ZA 1FW6A 1OBFO 3WZLA 4IHAA 2E18A 2ZRGA 3UANA 5I45A 2YMPA 1YFJA 3MBOA 1HYEA 1W4RA 3SKVA 1UOEA 1OT3A 3Q8XB 3HGMA 4QGSA 4NY1A 1FC0A 3WDMA 1F8YA 1JYFA 3NS7A 1Z16A 4JCYA 4ICIA 1JG4A 2AFHA 4GM0A 2EOAA 4ZK6A 3JSAA 4B45A 2Y0BA 4NOLA 3QVTA 1N6LA 3QYPA 1MW8X 4X4CA 2N1BA 2PTGA 3HJRA 1GZ3A 1Q14A 5CDFA 2H8KA 4XUCA 2KE5A 4IOMA 2X4GA 2XMGA 3TQIA 4N0QA 1ZS9A 3RRMA 3EBLA 3HEMA 1BQ4A 1HK7A 4G0XA 3CX8A 1BWSA 5A1JA 3M6IA 4RULA 4CHGA 1DRWA 1TRKA 3I8XA 1M6VA 3OO1A 5AUNB 4WBNA 1QRTA 5L7WA 4JBLA 3TAXA 2G9RA 1AA6A 1MA3A 1C14A 1L5FA 5AJHA 5DCYA 4FLEA 1NR1A 3DBIA 4MW4A 3TR6A 5JS6A 2NZJA 1W73A 1R6UA 2TMDA 3ACDA 2VZ9A 4FDLA 5HJ2A 3TIXB 4HT3B 3N8GA 4FYHA 3IE0A 3LDUA 4DQDA 5ALJA 1YS2X 1YJQA 1GPBA 2Q0XA 4RJJA 2DKFA 4J9UE 1A1VA 4X4HA 3VJLA 3L0IB 2QI9F 4FNOA 3IR5A 4O1HA 2B4AA 1ZFNA 2JHFA 1HOXA 4NZYA 2FF5A 4J4TA 1W1UA 4X1KA 2I6SA 1K6XA 3KAKA 4UULA 3FWKA 5E9WA 1QHHB 3TPCA 5J23A 2GI4A 3IPAA 3O4VA 4GAEA 4W82A 4WNYA 2IOHA 3T7DA 2CXNA 4KRGA 3N28A 1GNVA 1T1GA 3L0DA 5FNZA 1JT2A 1WPGA 2YXEA 5E0OA 5KWJA 2ZU6A 1XRPA 1Z6ZA 3LSTA 4U02A 1ONOA 2ECFA 4AP9A 1G4HA 2Y1DA 5BWNA 2ZBQA 4AY6A 3PDJA 4TS3A 1AUOA 3E9ZA 4L1KA 1CT9A 4UBKA 1L5ZA 4AWAA 2I22A 4C2BA 4MEBA 3JTMA 4Z4FA 2XTJA 4N48A 1X1CA 2JA2A 2H9IA 1USVA 3LNTA 3IJRA 1CY1A 3FPKA 4MRNA 3SQLA 4Z51A 1JHDA 3NOOA 2AEMA 2NUPB 2XB6A 3FWHA 3ONEA 4JL6A 1ZC3A 3VU9B 2OBMA 1GZSA 3M6XA 1SEPA 2DBRA 1WEHA 3NUZA 4M6WA 1YDMA 1D4FA 3ORYA 3T1NA 4CT4B 3LQQA 2OCKA 1DUIA 4E1VA 1HT1E 1DQNA 3U4QB 1U1EA 1A7AA 3GVHA 4R2JA 4E4TA 2GTHA 2JAHA 2FG6C 3TBHA 4GHWA 4PSCA 2CKDA 4C6TB 1DP4A 1O5IA 3M6MD 4ZO7A 1CQJB 2GKOA 2IOFA 4MVJI 4YHBA 1SO8A 2BZSA 4N0EA 2XGGA 1V25A 3KPWA 2HCFA 1PQWA 4YP1A 1NF3A 4YRSA 1B8UA 3GDOA 3I9FA 2ERYA 4FB5A 2GJAA 4RM2A 2XYVA 3PFCA 3FRHA 4KH0A 4ROSA 4W1QA 3FPGA 5IDYA 2OXTA 5H9VA 4U0KA 2BMFA 1KMHB 2QJOA 1FVHA 3IURA 5EZYF 4DAEA 1E3QA 5DX0A 2QM8A 3BXEA 3HUTA 1DO2A 1YZ3A 4A2PA 3PQ5A 1ZNWA 1DLIA 3LH5A 3ZC3A 2P4UA 1PLLA 2G71A 3ZNNA 3L3BA 3SC3A 1G6KA 3AO0B 3DEYX 2NNLD 3QMPA 5DNAA 1QDEA 2JKVA 4MHTA 1OX5A 1AS3A 3KT0A 3TRBA 3RU3A 2IZZA 4KYIB 1E0KA 2E5FA 2J1LA 2O0KA 4XSVA 4KFRA 5DEIA 4ZJUA 4YECA 5J40A 5LYJA 1MJ5A 2QN2A 2DEUA 2FCAA 4FUQA 1UMDB 3DZKA 1CW2B 1BHO1 1RWVA 1YZHA 3OCVA 3LOQA 4M53A 1CD5A 5KNDD 1AMOA 1J21A 3RC2A 1DXYA 1OKKD 3H1TA 3E2MA 3FCUB 1WXDA 3O9VA 2PRJA 4TZ6A 1C0EA 1C1YA 4XPIA 3HLYA 2WJZB 4DXAA 5CNIA 5FUMA 4PU8A 2BH2A 1KP3A 4C7OA 1JEEA 3GQBA 4F84A 2MSWA 3NAZA 1RRMA 3E48A 4WIAA 2HSEA 4M9UA 1HA3A 3QU5A 1ADFA 1O97D 4KUGA 5AT1A 5GONB 4US1R 4WXPA 1GTZA 1SUAA 2AJCA 4D56A 3T15A 5HMLA 5KUTA 2Z6UA 5LBTA 2D2IA 4I55A 3WJAA 2QRZA 2V55B 2GM5A 3CPJB 4D43A 1OCTC 2P9JA 4GU5A 4OGFA 3S2IA 4C2AA 3A6DA 2HA7A 5JCXA 1IHPA 1ENPA 4M0UA 1KSGA 4E2YA 5CCEA 2JCVA 2GEUA 4QDXA 4Q37A 1XYGA 4QSMA 3UHJA 3UZUA 2GRUA 3UB2A 5I48A 3ZV4A 2PH5A 2ZT8A 3D4BA 2BW0A 2WTAA 2Y1CA 3IMGA 2FPKA 3OIVA 3TVYA 4JZYA 1YFLA 1OWNA 4DUZB 1UADA 3LHDA 3Q9LA 4MQ5A 4OK6A 1NPYA 3IESA 1C0LA 4X41A 1V26A 2VHUA 1E1KA 1TPYA 1XA0A 3NXKA 4ZPXA 3S2YA 4EY3A 2TMGA 3KZKA 3ZDBA 4WK0B 1PL8A 4HAUA 4OHOA 1BJTA 1I2ZA 2I03A 2F8SA 2IS1A 4EJSA 4DHEA 3PGMA 4X1OA 4DVJA 1N3IA 1SQ5A 1XZGA 3R3WA 3GCXA 4JGGA 1ENYA 1OX4A 3P71T 2C8VA 1E63A 4CEHB 1Z35A 3CUUA 3OG9A 4Q9NA 4RSHA 5F76A 4CL8A 1AV6A 4WK4B 2OBFA 2BBSA 3BF7A 5AW6A 2W71A 3WRYC 4F3NA 2Z9BA 1K2WA 1YB1A 3STHA 3TVTA 3GEMA 3DYVA 1KYIA 2QNIA 2PXKA 2Y92A 4J0DA 3IVGA 4URYR 4KDCA 4MEJA 1OH7A 4DQVA 4KE6A 1SHJA 2GM3A 1IPEA 1G20A 5HQ3A 4KAXA 5KVVA 5TB5A 4UTNA 4TKUA 5JADA 3IQEA 3GJ3A 1N36B 3VYWA 2HNKA 4BVAA 4UEQA 4TYMA 4E09A 4YY3B 1PDWA 2QVYX 5CMLA 3NYWA 1XZPA 1IBRA 2J08A 3KEOA 3UMJA 3ZDXB 1I1OA 2QQ0A 4I2VA 5EWLB 4MKRA 5IDQA 3EA5A 1O2DA 2YFKA 1Z0KA 3GFOA 3VO8A 5DT2A 4J7XA 4E7PA 1D3AA 4BGDA 1TUEA 4XDZA 4F4FA 3OEED 5AHWA 2I9PA 3WB2A 3PUIA 4XEHA 1RADA 3SCZA 1FFHA 3PVCA 1LY1A 4OLAA 3DOFA 1OE0A 3F4LA 4A0GA 4F91B 3C5VA 2NTYC 3MJDA 1BFDA 1LLDA 1O77A 2PH7A 3FPCA 5CTAA 2MCFA 3H19A 3U62A 1G8SA 2H1FA 3FYMA 1UINA 1Q0SA 2HC9A 3LMKA 2QMYA 4OV6B 4WXMA 2N47A 3OZWA 4XKJA 4UVEA 2F8LA 1P0MA 1MX5A 1RZVA 2NU7A 3BJZA 3OO0A 3WK9A 2YYZA 2C2OA 1QF9A 2ZJ6A 2ZJ1A 3K0HA 4HNRA 1VYVA 4ZQIA 4RA6A 4R1QA 3ZEAA 4UHEA 1SCDA 3Q11A 3HB7A 4AJPA 3AQIA 3BFVA 1LGYA 1MRSA 1NXTA 3TQFA 5IC5A 4HDSA 2ZBPA 1G8HA 3KR9A 4UMVA 2Y1XA 2HWUA 3D7MA 5JHGB 3KCNA 4L4YA 1GGFA 4PZCA 3QVKA 4Z0HO 1G38A 2A59A 2ZSIA 4MUYA 4JVSB 5D85A 3SX0A 5CLJA 4WUVA 3IKTA 2WTXA 3LXMA 5FI5A 3AKCA 4H3SA 3SP1A 4J7CA 4GQBA 2M9MA 1L3IA 3IB6A 4XGKA 3TTSA 4ZHQA 5LQKA 2CSXA 2BD0A 4MYHA 3EYWA 1Y7LA 4DUGD 3IJ5A 3EQ6A 1X9GA 2C2ZA 3ZXYA 2O3UA 4JNCA 3A7EA 3VWSA 1JAHA 2R65A 2WOJA 3MLBA 5IBRA 3MW8A 3RHFA 4C7KA 4LXIA 1IZYA 1HQCA 2QY9A 3BWEA 1EB9A 3DMNA 1EFVB 3M6VA 3ZWDA 2FPSA 1CLUA 4FYWA 3G1UA 2DUNA 1RXUA 5DI3A 1KNQA 1WCIA 3I2JA 4UHJA 5SYAA 1PZHA 2VBIA 3ENVA 3RADC 1ZR2A 5AESA 1DBSA 4CKYA 2MSNA 2A9VA 5C5EA 1QIMA 2X14A 3BFPA 1T9BA 4B7ZA 1IIRA 2AVDA 9LDTA 5LPNA 4M0LA 2JJQA 2UDPA 1N9KA 3I34X 4M8SA 3KOMA 4UM9D 1J0EA 2UUBB 2G1JA 5LDGA 3TK1A 3JVVA 4WZAE 3NW9A 5HEKA 4C05A 2C92A 5E2BA 3VU3A 5J3JA 1DKUA 1YVEI 3RHTA 1YE3A 2JANA 5F1OA 4OQEA 3N0VA 4MUIA 5IJAA 1MC4A 5KTKA 3ABRB 5C8DA 4DV1B 2NU6B 4JLVA 5EJ6A 3E58A 2EJTA 1OXTA 3MMXA 4PNZA 1JSZA 1E3WA 2FLKA 3KYCB 5D87A 1PVOA 4PGGA 5LUAA 5B12A 4ZMSA 4N6NA 5DN6D 3OICA 4YX9A 1LJ8A 2HBQA 3PVZA 5ESRA 4EZBA 3PE6A 4MRVA 4R8KA 3VYTB 1NI3A 2COEA 2FRVA 1P8AA 4EJSC 4L8WB 3L8HA 3B2QA 2EFGA 2JZOA 2XNDD 4YCJA 5KIAA 3VNSA 3CW8X 4WLUA 3TTYA 3EEFA 4LBVA 3W4JA 3LDHA 1CUVA 5AQEA 4OBBA 2G63A 3EVEA 3MRSA 2QAGB 1EK2A 1RABA 4NYJR 1Y5MA 4Q12A 2BR3A 5CYPA 3WWDA 5JAHA 2NWQA 1ZL0A 2YVLA 1K5PA 2VYCA 3R5SA 4GC9A 2HF8A 1U1CA 1NNEA 3ER9A 3C7CB 1N3LA 1K92A 2XBMA 4JSRA 3WLRA 1RLJA 3SBEA 3WY9A 4TUYA 5SY6A 4ZQHA 3SE7A 2Z2KA 1UEIA 1ZCJA 2NO5A 3KYDB 3R5KA 1E60A 2Z1MA 5F33A 2ONKA 1PR6A 4OSOA 3G0IA 3UHAA 3VX4A 1EDZA 2GRLA 2IYLD 1VKNA 4IHQA 4XIJA 1OAKA 4M0FA 2JRLA 3VISA 1CFZA 2A0KA 4PR0A 4D0SA 3H2YA 4MR9B 1Z2OX 4B82A 1UBRS 1SCBA 2AJ8A 2PLFA 1CUEA 1OYVA 2L17A 3NHRA 1QFSA 1UZNA 2PKRA 4HZUB 1U8XX 4NYJQ 4OMDA 1R74A 4OQXA 5KYUA 1M0EA 4LJSA 3SVZA 4BJ6A 1ZMBA 2JH9A 2OFXA 5H83A 1BO6A 5KYXB 5J2TF 2FHSA 4HPXB 3ROQA 3UFXB 3PC2A 3FFTA 4G97A 5IM4F 5IAJA 4AYTA 3EULA 3QNWA 4B7AA 3ITDA 4OBWA 4Y2GA 2O7VA 2XWBF 2PA3A 2QW1A 3FPAA 4IUYA 421PA 4E0BA 3EGVA 3E82A 3TRHA 2QUZA 2XAAA 1ISJA 4J7UA 5AXCA 1AMNA 4TTRA 3FMIA 5TQ0B 4UPVA 4PU7A 4WEOA 3SYKA 3BBPA 2V8BA 2CL0X 4AZ0A 1CIPA 4R0NA 4DQ0A 3GCDA 2WUSR 2WHPA 3ZQJA 2TS1A 2W2NA 3T3GA 3ZVKA 1P7ZA 2Q9AA 3OY2A 4YMVA 1M0TA 2QRGA 1IG0A 2R6JA 2KI5A 3OZIA 3ZGVA 1S5PA 1J90A 2Q5FA 2AS0A 1Q12A 1FDWA 3GD7A 4MS1B 3RG2A 3EXHC 1LTKA 2XNSA 3EDQA 3TF5A 3OZCA 4JJKA 2C59A 3MD0A 3P0IA 4JP1A 4L02A 1GPYA 2OPHA 3GZ4A 5EIAA 1F9EA 2QR3A 2ACWA 5G3ZA 3NKVA 2CNNA 2VYVD 4PQYA 5LP6B 3BRSA 3KE9A 4QRIA 4WZAB 1YR2A 2FJRA 4CW7A 3GIWA 2JFZA 4HYQA 5F4BA 3TMYA 4KVGA 3FUTA 2A1TS 4PPYA 2F1HA 2FMUA 3DXZA 4OSEA 3AF3A 3R2JA 1MO3A 1FTWA 2X0IA 2H7CA 2WZDA 3AY3A 3EAQA 3P5BA 3R5FA 5KYVA 3UC5A 5JAZA 1U2EA 4N65A 2JGAA 4GP6A 1Z8HA 5JQWA 4H1TA 3GP8A 3KDSE 2FJPA 3UJ7A 5B5SA 1PZFA 4MQLA 3G8CA 2Q6TA 4BMPB 2XVZA 1QH8A 4AY5A 1FJXA 4D4IA 3MWFA 4QUAA 4UVIA 1V8OA 4MW7A 3FYTA 1E6CA 1QGZA 1DEKA 3B7HA 1V5FA 2GCOA 2OORC 2R48A 3AB7A 5MN5A 4AWXA 3RBXA 1E1CB 3LE8A 3M6FA 5HIIA 4QKQA 5C1BA 1DG1G 1RJEA 2C4HA 2ZWIA 4TOIA 4YARA 2H17A 5D5PA 5DOZA 3F8WA 4O1IA 2XYRA 2BDTA 3MUNA 3ZWPA 2HR1A 1N1GA 3WHKA 3O2QB 3UJ3X 2W00A 3Q8LA 1E64A 2CHVA 4ZV4A 3ZI0A 1PR1A 3V3TA 3PNQA 1Y9ZA 3VR4H 2Z6AA 1TJ3A 4TKVB 3A3YA 2VSYA 3GMSA 3OM8A 4LK3A 4IZIA 5JI2E 4IDHA 1PJ8A 4KXVA 3THXA 4YN3A 1E32A 5BPHA 4NV0A 2UVQA 4Q7LA 3BRCA 2B9VA 2OESA 1PWEA 2O2XA 2QLMA 3NBUA 4JCXA 4L4UA 3ZYZA 4YUAA 4CMJA 1SUFA 5GIOE 3WB0A 3SIPA 4N4AA 4NENA 2W2XA 4DYVA 1PIWA 3TKAA 1ZWKA 3BL8A 4WT7A 1V3QE 3KJNA 2VQSA 3AG5A 5F78A 2C82A 1Y34E 3O9XA 1PT7A 1YFZA 2XCSB 1KRXA 4N6GA 1NLMA 2ECQA 2XX3A 2HWKA 2ETXA 1F0NA 1LVUA 3FZQA 4QGFA 4ZT6A 4BL5A 1PX2A 3G82C 4C0WA 1YHZA 3CRRA 3FVVA 3V1MA 1RYHA 4K6CA 2ZWMA 3NHPA 4AZVA 3UXHA 1YQXA 4IHJF 5ERGB 2BTQB 4UVHA 5DX8A 3R3HA 3EIWA 2JIOA 2VTBA 3ZHRA 4JUAA 2KEJA 3DB1A 4MZXA 5JBIA 1GT91 4PN7A 3ZGYA 2PL1A 3I5YA 2XKJE 3ANSA 3LECA 3RU7A 4Z6KA 2BGTA 3T3NA 3IUBA 1GG5A 4QULA 1VHJA 1ATIA 3OE7A 3QE3A 5DPMA 4WUTA 2IS4A 1XQWA 3M1AA 1KGSA 4KPUA 3AFOA 4YRZA 3HVHA 1ST2A 4ND7A 1MJGM 3H13A 3OAAA 4JLWA 2KEKA 5E8JA 3STYA 5BW8A 4A8HA 5DBGA 1F1JA 4WZBE 4MCXA 2QN1A 2DERA 4ZGGA 1K8QA 1A9QA 4HV4A 4JSTA 4Q5IA 3WQQA 4NC9A 4CL2A 5FA6A 2VJMA 2PMEA 1N7GA 4B6OA 3BXHA 3JZFA 1SOWA 5FPQA 1KPHA 4AFNA 2XQIA 3O3CA 4GOXA 3DUWA 4LEIA 4CQLA 4GXNA 2EKLA 4IV0A 4PFJA 4JENA 4U2BA 1JX6A 3EIXA 4WADA 5C37A 1V16A 4WN9A 3A11A 1JU9A 5HA5A 5C51B 2LIVA 4LYAA 4V39A 2J33A 4HDAA 5J4HA 2L42A 1ZMTA 4QLAA 2FPPA 3I5AA 5K98B 4W8HA 5JCJD 1VPDA 2Q4RA 4YXWD 4U7DA 3G9ZA 2PXHA 1KY5A 1Y6GA 3QF4A 2BKUA 1RKBA 4JV5B 4Z86A 2R5WA 4PQEA 4KSCA 2COKA 4PFKA 4TKZA 5JO0A 1GVHA 1RYBA 1E9VA 3CF6R 3JD2A 4Q6BA 3VC7A 5KYWA 3GNQA 2J3KA 4ZVUA 1JLMA 3NKFA 1TMYA 4KQEA 3B89A 1CERA 3BDAA 4AZ3A 3DCJA 4Q3DA 3H2HA 1B41A 4WSOA 4A6PA 3QPVA 1Z5UA 2XA1A 4CQMA 2ZYIA 2EV9A 4YAWA 2ID7A 4OJKA 5ENVA 4GPBA 4ZVVA 4RGVA 3K96A 3GZJA 3NEJA 4L51A 4OP3A 2UUPA 4B6QA 4C1BA 4D3DA 2Z6QA 3VVMA 3WAJA 1XZMA 1HYGA 5JPIA 1W581 4M37A 4RAOA 2IP2A 3MERA 2Z0MA 3U26A 5BUCA 3EVTA 3F51A 1ZH2A 3PLRA 4OPMA 2R85A 4RZUA 2JAXA 4BE9A 5DK6A 4NTZA 2F3QA 4IMIB 5DWQA 3MAGA 3KAPA 2XKAA 1ZMXA 1GKUB 3I0ZA 3IAEA 1AKTA 3AXSA 3IVCA 3WLJA 1IAQA 1P0QA 3NNSA 1IC6A 1TAHA 3OFND 1MX3A 5BYAA 5IS2A 3SDSA 1OXXK 3IPCA 1JMYA 1I8TA 3SR4A 3GJ4A 1EVLA 3HWSA 5AKJA 5GWXA 2WQ6A 4S0XA 2XQGA 2ZRHA 3ZZUA 3W5BA 2O38A 1AF4A 4LDZA 4J1XA 2BMWA 4X93A 3FVWA 4L8YA 4QT0A 3NJ4A 3FLEA 2MSLA 3HO6A 1Z4OA 4IDAA 4RFSB 4WXEA 5TR9A 3HVRA 4WPGA 4RY0A 4U0JA 4BYGA 4QM7A 1ESNA 5FNVB 1QPBA 1WHSB 2IUSA 2PT5A 1NWCA 3OCZA 1KI2A 1UWLA 2PGAA 4QJ3A 1I7LA 1YGYA 1ZM2A 5KDDA 4NVRA 1C3LA 5FHRA 3Q9UA 2KWIA 3HVIA 4P34A 3OLXA 2Z8ZA 3DBHB 1SBQA 2O0LA 1XEWY 4JJIA 4TLEA 3HJCA 3TAHA 5BW4A 4OQ4A 1KZ4A 1YDHA 2BJVA 4LJ7A 2C88A 5EP4A 3V7YA 3ZNQA 3I72A 3IDQA 2XIQA 4Q3CA 3GJ7A 4XYEA 1Z88A 2Y1LA 1S2MA 3E7FA 2G0TA 4QVKA 4ZOEA 1QFYA 1Z13A 4ZJPA 3DE0X 1DKOA 2O20A 3IL2A 1HORA 2PUTA 5KQMA 4J07A 4FCWA 2V4UA 2IUUA 5DM60 4WZBB 4E13A 3C1OA 3IEUA 3OF3A 4FGKA 1G4AE 3BDVA 4KXLA 4GPD1 5DSTA 4JYPA 3OKCA 5I9MA 1I4DD 1BC5A 4J3JA 4PLFA 2J7UA 4D9JA 4TL7A 4KNYA 2DJIA 3TZ6A 3LX6A 5K45A 1M2VB 2FMKA 1JR6A 3CZRA 3AHHA 3UAOA 1GG2A 5CXUA 4F0JA 1Y5LA 4TTVA 4X24A 2QRQA 4Q9AA 2O8DB 3OSUA 4PZPA 3BFXA 2C4KA 2G6BA 2GBLA 3OU6A 1RRKA 1F9AA 1DG9A 2QP9X 3NWEA 5AR1A 5EUBA 4PXAA 2BMVA 1JPJA 1DKRA 2ORIA 3UXMA 3W7VA 3K6JA 1Q0PA 4D0LB 4A26A 4I19A 4BXOA 1SC6A 1FMJA 1L7BA 1QB8A 4FIDA 5LLTA 1OGIA 4CMAA 2NZWA 5T6BA 4M4SA 4MS4B 3L6OO 5A4MS 2WJJA 3MIIA 3PSAA 1TM1E 2CEAA 3TLCA 4PU4C 3LVBA 4KWIA 4TMFA 5EE1A 3ZOZA 2VRCA 3LCJA 2PZLA 4EX6A 2UVPA 3MWGA 5EKTA 3UMMA 3AKYA 5I9IA 3JZIA 3SJ7A 8LDHA 4EAAA 3IGFA 4EYKA 1ZCAA 5A71A 2NQ2C 3KXAA 3ORSA 1D2EA 1U5BB 4GT1A 3RRZA 3SKYA 1CRZA 2VP5A 3HJFA 2ZYHA 4I6UA 1CUZA 4WLVA 5HQTA 5JS8A 1HG0A 3D7LA 2CHEA 3D3WA 3Q3CA 4X4GA 1P6XA 2C9CA 4GMXA 4QUBA 4ZCQA 5IT5A 1WMEA 2A58A 1ZHOA 4M3NA 4XVQA 4RADA 1FYEA 3DZCA 3EZGA 5M7EA 2Z5VA 1UDCA 2HIHA 2GF9A 3EVCA 4Z5DA 3MUEA 4MIYA 3AFIA 4C89A 3SR3A 1II8A 4HATA 3TRKA 2PANA 1IM5A 1YWGO 3P9RA 4FYMA 3LFPA 1ZOLA 5F35A 5JZBA 1H94A 4WKOA 6REQA 3IT1A 1PFKA 2EP7A 2VHWA 4EH1A 1A96A 3C7AA 4P54A 1RLIA 4PY2A 4QO8A 5DHAA 1EXDA 2R0QC 3DLIA 4GLOA 4UD6A 3ND9A 2IUEA 1JIVA 1GZVA 3ZQ4A 3WE7A 1IATA 4GOMD 3VX3A 3ECSA 4ZVQA 2R7NA 4HLCA 3HYCA 5DMHA 3PA8A 2HXSA 2F67A 3A4IA 4G6ZA 4D5GA 1QRSA 3KT3A 1LPNA 1DWPA 2CXQA 1V37A 3PG5A 3UA4A 4A0HA 4CI0B 1ZN9A 1I0ZA 4IFBA 4LGYA 1NDQA 4FYKA 3VR2D 1HYHA 4GQIA 4A0SA 2LV8A 1OQAA 1RXCA 2DUMA 2IU0A 5HVNA 1U31A 2ZANA 2MINB 1RLUA 5DW3A 1XQYA 2I2CA 4TZTA 1C8LA 4TWAA 4GR5A 1GKYA 4YQZA 2W11A 4CM9A 1RCUA 2PVPA 5T4EA 6CHYA 6GPBA 4OOFA 6AT1A 3K0SA 4N3AA 2GASA 3DE6X 2ZIXA 2XQVA 4C4YA 4DG9A 4E46A 1KMMA 1EP3B 1T24A 3TSAA 4IDBA 1JKMA 2WM9B 5CJPA 2HF2A 3G2HA 4EG0A 4I3GA 3HYTA 1YRLA 4R41A 5TSDA 1AY0A 1YE5A 3MLFA 2DFKB 4HG2A 3E2PA 2ZPAA 4YBRA 4G0YA 2ZIVB 1R6TA 2GCIA 2HHCA 2PYIA 1K0FA 2Y8EA 3GRUA 4FBMA 5B2ZA 5LD2B 1A9TA 2IQ5A 1PS0A 3FMFA 5BQPA 4L76A 4Z0NA 1TCVA 4GS5A 1T6NA 3VPDA 2JFGA 5GJWC 2C9OA 4URZR 3WHIA 1M6EX 1D8TA 2EP8A 3LQRA 4GKJB 5D3ZA 4OK5A 2DBZA 4K6KA 5EHQA 5ALRA 1B0NA 3NWOA 4BNHA 5KNBA 5REQA 3TOXA 3SM3A 1XZBA 3QVSA 4FFMA 2P40A 4O6VA 5GONF 5EIFA 1ETUA 4UCXA 5TPZA 1PS9A 4DQUA 2ODRD 1YA8A 3LAWA 2GBLC 2H4XA 4ZTBA 4ZI7B 5ICGA 3GLFE 3TZEA 4PIMA 1ETHA 5BN5A 2ZYAA 3O91A 1ORDA 1GUYA 3NHJA 4DVGA 3WLOA 4DLPA 3PBKA 2PXEA 3FM9A 3R0ZA 3AGPA 3N53A 2DECA 1D6JA 2FEXA 3C6BA 2RBEA 3MCZA 5EHGA 2WD7B 1XKXA 1PFYA 4HMQA 5EP1A 1F51E 1RZRA 1W93A 2PJDA 3I9MA 3ZU4A 1XWIA 2GAIA 3RJZA 1KY4A 2JKYA 4QO7A 2JIZA 1V48A 5C0OE 4ETMA 5AQ1A 3GLKA 3INTA 4UHDA 1JFFA 5NLLA 2KJQA 1YR7A 1C50A 2H3EA 4YO8A 1G18A 3MWKA 3VO9A 1ANKA 4C4RA 5B58T 4QUIA 1TUIA 1RSZA 5AM0A 3V4SA 5HGXA 4C01A 2W6MA 1RWWA 2GEDA 3D8RA 4EG3A 1O1YA 3BKXA 1X8KA 3IAUA 4OQDA 3MWEB 5BNFA 1SURA 2XZOA 1IVSA 1OIVA 2FW1A 2FW8A 1XXHE 2FP4A 4BO8A 4KOAA 3DZBA 1FFGA 4MITA 3TGPA 4WI1A 2C1EA 4YT8A 4U00A 3VYRB 4JIGA 4K26A 3AG6A 5KO2A 3VHRA 1CIVA 2NOAA 1FP4B 3RSCA 3S40A 1W85B 3CURA 2HJHA 3GLSA 4WN3A 5EINA 1IUKA 3BE8A 4YJ3F 4I6TA 1DAFA 1P0PA 1WTAA 2VDRB 4WZ6A 2HO4A 1KQ3A 4BVGA 4DLAA 4EGSA 3H6HA 3WLAA 8AT1A 5KX5A 3ZTYA 2I4MA 3M5PA 1KYXA 3JYNA 4UTOA 1KRHA 3IAXA 2OOKA 3C6KA 4B47A 2YYYA 3O1LA 4C7JA 4RU1A 3UV3A 4DMRA 1OHHA 2WABA 3CINA 1H2YA 4FFWA 5ALKA 1BRTA 4ND1A 3ZZNA 3R7AA 4Q24A 1JIIA 2IYRA 1Q1AA 1ODJA 5LOVB 1G60A 1Z15A 5HYVA 1S7CA 2G07A 3IMKA 3W5HA 1IWOA 1U0JA 2J5KA 2H2DA 2Q3LA 5EXXA 5FPPA 2GARA 4GWGA 4OHFA 1NHWA 3AR5A 3RS5A 4JI5B 1HMYA 4FD3A 3CBQA 3FCXA 4LPKA 1ZD8A 5CX1A 1IN8A 4LUCA 1PR5A 5TGZA 3SHTA 4MWEA 1C1HA 2VTVA 3VZCA 2YVQA 2PL3A 3UG6A 4HD8A 3EFEA 3DEHA 3A1EA 4MUBA 2PUBA 4Z99A 2YW9A 3GROA 4KUHA 1J39A 3DPIA 2ZTLA 5KINB 3C97A 1EUQA 5JOQA 1RBYA 4PG7A 1Y5IA 4DMUB 1WLYA 3K9GA 4KYTA 3CRNA 1EP1B 3V7UA 3LJKA 3B1ZA 3JY6A 4JCOA 1G5IA 1ESZA 2FFJA 4RWEA 4XWGA 4G67A 2AL7A 4HDKA 3RO7A 3HY4A 1F1BA 3F90A 5DM0A 4LY3A 1TK3A 3V1TC 1NX9A 4IWRA 1NBOA 2WV9A 1E9EA 1P2VA 3MLAA 3OJ0A 3QXCA 1WTCA 1C1XA 2F17A 3O2NA 5G4LA 4V1CI 4XZ3A 1JEYA 1T9KA 2C5SA 1XZHA 4P0PB 2H4YA 5DNWA 2VA8A 2XB4A 1WMAA 2FZGA 3F3YA 1UXHA 3FFAA 1M7HA 2OHHA 4BKOA 2WUEA 4BLSA 1J5PA 1G8AA 1L5OA 3F71A 3AR7A 2VHQA 5FOUA 4CN9A 1XT6A 3ZWBA 4EHAA 3GLFB 4Y6GB 4MUKA 3LIIA 4Y1GA 3EZXA 5EMHA 3I58A 5KWEA 2UXDB 1UMCB 2FFRA 3K4PA 4YFVA 1B00A 2X7JA 2L0XA 3LHFA 1K1EA 1ZISA 1P2DA 3BOSA 3V8BA 1H8HD 2QRVA 2GERA 3U7EB 3ZG6A 1U98A 4OYHA 3DKRA 3MTQA 4R3UC 5D84A 3WK4A 2WKSA 3AUJB 5CPFA 5E0KB 4BFLA 1R15A 3IOCA 1V11B 2IBTA 1GGMA 3ZWKA 1KC3A 2Q41A 3AB3A 3AESA 3Q2KA 4Q93A 5EZSA 4KMSA 2WR8A 2G1KA 2I33A 5FWXB 5ALOA 3WK7A 3IP9A 1Y8AA 2CJYA 4D4JA 3TGLA 1UJ6A 1JJIA 5LP1A 4LF7B 1CP2A 4J91A 1SU6A 3HRIA 1MCZA 5FL7D 1X1AA 4KIFA 1WDKA 1W4BA 2E85A 3FHOA 5JY6A 2IH5A 2IHYA 4G09A 4D80A 4US2R 2MYUA 1XXHB 2OQRA 1SUCA 2KSQA 2HLHA 5D3MB 3BB1A 4PC6A 2O19A 4IJUA 5E2AA 4ZAWA 4JI6B 4F56A 4ZVPA 2HJ9A 4EOGA 1R0RE 4FGLA 4FFVA 2WP0A 1OLUA 3OIDA 1D4OA 1Q21A 4CV1A 5C18A 5EZ5A 3NTVA 5AVTA 1FDOA 2VQ3A 4A2WA 2Q9CA 3QU7A 1E0AA 3COYA 4ILEA 1BE6A 3DFIA 3H11A 2ZE7A 2Z09A 5ANRB 1E3LA 3IPLA 3WI7A 4RHUA 2RFLA 4KQIA 5E4TA 5TNXA 2YRXA 3PPWA 3ZE2B 5IEJA 1QYXA 1T6BY 1KWKA 4O3MA 1MQSA 4H60A 1DJMA 1PD0A 4M87A 5SY9A 3ID6C 3ZU3A 1S3SA 4KQHA 3WRXC 1K27A 1JEDA 4JDUA 3S29A 3QBEA 3Q8KA 1N7IA 4WINA 2WMNB 2J8ZA 4MUGA 1G4UR 2H85A 1L5HA 1DARA 3VAYA 1TEXA 1SVMA 4C21A 1RYZA 3G59A 1BEZA 3HS3A 4U2GA 2Y0DA 4BJ5A 1WU7A 3E0QA 5JCOA 3KTAB 3L1UA 3N74A 4JSYA 3VZPA 2FUNB 5BSEA 5FOVA 2VZ0A 4QC2A 2A1UB 5G0VA 1CJVC 1DKLA 1G6Q1 1S4QA 1X92A 2X9GA 3GC6A 4G5RA 5FFMA 1NQUA 4POOA 3NT4A 3RJ5A 4TXJA 1XN1A 4KXQA 2GO7A 3WGOA 5IKMA 1X1DA 3JQAB 5JT1A 2J6CA 4K6HA 3JAMA 3EVGA 5DHQA 1ZPDA 1BA2A 2WAXA 5EKUA 1DX9A 1XRQA 4LCBA 3B1VA 3V00A 1TRHA 4YNBA 2IT1A 1JYEA 1X1RA 4MR7A 4PPGA 1G21A 5K0ZA 4XASA 3U49A 2VVTA 3IQHX 3TOSA 2X5XA 3I8SA 1UBTS 2V59A 3N0WA 3FWYA 1E7QA 4CJXA 1R9NA 3S28A 2UV8A 1ONSA 4ZQCB 2VPIA 1G9XA 3VR5A 4AKTA 2O3QA 1GY8A 4G5QA 4QYTA 2CUNA 5JI3E 1Y63A 3MWLA 4ZT4A 2OD7A 1NE7A 1P9NA 4QUHA 4UU8A 1TMGE 1DBQA 3RT9A 4Z53A 3H2GA 4DDMA 1QH0A 4FKMA 5AJVB 3K09A 1PNVA 4KLNA 4YAEA 3VI4B 2D8AA 2VKQA 2KHZA 1M8PA 1UC4B 1TQ4A 1T2DA 1TM5E 3EDOA 4DTIA 1FNDA 3L18A 5K6TA 1YVPA 4US0R 2WAAA 4IJ6A 3GLIA 2HA0A 3HCDA 1KMQA 2P8JA 4G5XA 5AVJA 3RD5A 2HRDA 2PYZA 2C2WA 1DC3A 2ICPA 1C2TA 4FINA 4KXNA 4L4SA 3DHEA 3TE7A 1DXQA 1X2BA 4GD3Q 3ZXUB 4QU0A 5B7QA 4EHFA 2EJWA 2W2PA 1ZUIA 2HJGA 4WA7A 4X3CA 1YTUA 1NIPA 3SGLA 1OY1A 3L8MA 4X6XA 3R7SA 4BQIA 4ER6A 2VAPA 1BXGB 1E0JA 1EX7A 4I50A 4WVFA 1O6GA 3EZFA 3LY5A 1PGOA 4IF6A 5C1OA 2ZCJA 3T38A 4B71A 4CLRB 1WSBA 2A0UA 4Y2RA 5CK5A 3PLAE 5GJBA 4ZANA 1G9TA 3FJYA 1WXFA 2DZDA 1RYEA 3CFYA 3EVFA 3EG9A 3G2NA 1LK5A 3BBLA 4B0OA 4F8DA 2VYFA 2WVAA 3LLMA 3ONVA 3QKSA 4PCVA 4RHFA 3L7CA 4B6FA 1CX9B 1PFWA 1J8FA 1DWQA 4DZZA 1MT3A 4D3SA 4CKWA 4GRDA 4U7TB 3T7SA 4G4IA 4Z9YA 1EFPA 5FOWA 3ZJ4A 2JLWA 1WQ3A 1X42A 1NVKA 1G5HA 1UBJS 3P9CA 4O63O 4FN4A 1M73E 5EWJA 5K3AA 2BIFA 5CDUA 1MHPA 3KUKA 3NNDA 4RKWA 1EX6A 1LI4A 4YUYA 4UTRA 4D3FA 4KXFB 1P4SA 1M1YA 2EFJA 4YRKA 4DLLA 4S35A 2G5PA 1OB5A 1SC1A 3F1LA 3VNBA 3OVMA 3DZJA 3KIPA 3PXEA 2GPWA 3GPCA 1KYVA 4HVAA 2GCEA 3CNEA 3QQ6A 4MVJH 3B5IA 4IG4A 2QUJA 2V7VA 3AOGA 4OHKA 4UM8B 2VWPA 2HM7A 2LCFA 4PCAA 3QUSA 1Y4DE 5CLIA 2GEVA 1T91A 4CM1A 1X9IA 1ORWA 2ZR8A 3OFVA 1Y3DE 4QRDA 2OQ2A 2QLTA 5IEBA 2NZ8A 1Y4SA 4FZJA 1U2SA 3EQZA 2WSIA 1C3OB 2OC4A 3C8DA 4G4SO 2FNAA 2GXUA 3FSGA 4Q4HB 4J0EA 4V2UA 5AJTA 4YCNA 3ZDQA 4F72A 5M04A 5K0SA 1F8UA 4GZ6A 3RKUA 4OJTA 3C3BA 1R6VA 2CXRA 3HZZA 4IILA 1VJDA 4OQYA 1U81A 3P0RA 1IBMB 3BWBA 3FKSA 5JCOC 1P91A 2V7TA 4D8XA 4DDUA 5L53A 2M6RA 1O8CA 1ORRA 1ZXLA 3C98A 4YUXA 3MSCA 3WGIA 1PW7A 2XUZA 4DWVA 1EAYA 1IHYA 5TMEA 3T61A 5HIKA 4KRYA 3FOFC 3M82A 1TU3A 4EARA 2FN7A 2R3SA 5CVVA 3T3PB 4DOMA 1LX6A 5HGJA 3L4BC 5FRDA 2X8AA 1SD2A 3W2EA 2GJ8A 3F5DA 3ZS9A 3LL7A 2P0AA 4M9RA 2XCRB 4BO2A 2JGMA 3LC2O 3ZWCA 1IULA 1W1WA 1DULA 4RZIA 1Y8ZA 4NNOA 2XMDA 2R8BA 1TZJA 2V97A 2BISA 1JR4A 2VT3A 3N2GA 2D7CA 2MMGA 2TMYA 4KQCA 1KL7A 4MQEA 4QPDA 1BXRB 2GLXA 4IBOA 3I09A 3PGA1 4CPDA 3IEMA 4IQ8A 3DKPA 2RAFA 2D13A 2J3IA 3JALA 2HXYA 3QXJA 3K09C 4NEQA 2DUJA 3HFRA 3ORQA 1FP1D 2IPAB 2JHCA 4Q3LA 1IVYA 4XD2A 4EMUA 3D5EA 4KWEA 2OECA 4J94A 3TEMA 4Z9BA 1D09A 3W0LB 1BG6A 3HNPA 2E9SA 2QX8A 5E4JA 1SU8A 3OCWA 2IYVA 2YQZA 4IMJB 3L7KA 4EK9A 1P2UA 1O54A 2FZ5A 4MRRA 5FV4A 3PEYA 1CWUA 1E20A 4MVCA 2I67A 1XVLA 3T9EA 2ZATA 3WBKA 1TUGA 5A4DA 3PPIA 1KZGB 2NW6A 2O0MA 4QBFA 1WV0A 1Z5NA 4ON9A 3WXBA 5LDDC 1PI3A 5I7EA 1ESDA 2FJ0A 4PCLA 1WETA 4DBLE 1MJHA 1JFLA 1DCFA 2G17A 3RUPA 4CFZA 5JJIA 2HFJA 4O4LA 3L4KA 3HJHA 3UK6A 3G8YA 3BE5A 3LWBA 2I4OA 3A27A 4C4AA 4E21A 4HNUA 4QQKA 2XUJA 5BSRA 1XZQA 3GELA 1CR2A 3W5CA 2PGDA 4JLJA 2IEBA 2AXUA 3DEKA 3SZOA 3JX9A 3HZHA 4HRXA 2I4TA 4NCAA 2R96A 4LZOA 1WVIA 2VH5R 1P75A 3DW1X 2HA2A 2WZCA 1PG0A 3NOXA 1F20A 1X1SA 4G9BA 4PHFA 2X41A 3B3QA 2RHDA 3QELA 2VYNA 3IELA 4RJKA 3STWA 3DP7A 1LNQA 4U7HA 4OFBA 5D8DA 4DLKA 1ISIA 2VDWB 4LWPA 3RS0A 3D43A 4JYCA 3GVXA 1WO8A 3ASVA 3TNFA 2MHCA 3QY9A 1A2KC 5JC8A 2W43A 4FVTA 2HK9A 1ZU5A 2ZSHA 3ACCA 1OTHA 3KKMA 4RW0A 5DWDA 2M32A 5FLEX 4ALNA 2C7OA 2OWEA 2XODA 2MR6A 3DDUA 4MWZA 3OP9A 5FNVF 3G0DA 2XKKA 4O3FA 4COOA 4CIWA 4DLVA 4Y2TA 2YW2A 3OTOB 4IDNA 3TLMA 3WSWA 2UVDA 2I91A 3A6GA 3G9XA 4IW3B 4LZLA 2HMYB 2VQFB 3EXIB 1YBHA 4CFYA 1SA0A 2VCHA 5CJJA 2GRAA 1R88A 1XR3A 1XTUA 4AXXA 4GZ5A 3ZH2A 4DQLA 4BBJA 4PZAA 1MB2A 1O9GA 3KELA 3LUAA 1YL5A 4CL0A 4C0AC 4DB2A 3B82A 4Q3BA 5EJ5A 1KVRA 2GPYA 1XAHA 2ORYA 4MWBA 4PLYA 3LVRE 4ODIA 4UNQA 5LQAA 2XF8A 2X7XA 3OD5A 4XDGA 4KN8A 3TLEA 1N1DA 2O8NA 5ALIA 2QX7A 3CPSA 4EJSB 5CBPB 4BHTA 4RHTA 4WFJA 2YDXA 1B8NA 1B4DA 4B8ZA 3K4QA 1DRVA 2RGUA 4LWZA 4D9KA 5LQCA 1QCDA 2HF7A 1R10A 2H18A 2NUBA 4NSNA 3ZJTA 3O38A 1YE8A 2B8NA 1F2UB 5L51A 1U65A 3RM3A 3SWWA 2A3NA 2PKQO 1TTTA 4B3FX 5DHFA 3K92A 3KQNA 2RCNA 2D5CA 2Z3ZA 1NJGA 2ZIGA 3P2MA 1GCAA 3B1YA 1U0HC 3FAZA 2BJWA 3BA6A 5E1DA 5FOXA 5KQSA 3ZDEA 3CLRD 4KI0A 2Q6OA 4B43A 1DMSA 1MEJA 4FT2A 1G20B 2VDLB 4O1MA 3A4MA 4EDFA 5JZ9A 1W4CA 1FU8A 2IXFA 3KSMA 1M1XB 4AI6A 2W83A 1KMIY 2ONZA 4U2KA 1XL0A 1VPLA 2IP4A 3TBFA 1AJEA 2EJCA 4CLHA 2Q2QA 4JI2B 3KDPA 3BCRA 1CEXA 1Z5WA 3W4IA 1UFQA 5T4HA 2C7RA 2OHJA 3QYJA 3T35A 2R751 1HSOA 3LKVA 2J0QA 2XXAA 1UDBA 3HU2A 2PSDA 3E9NA 2JLRA 3ZJYA 4RSGA 2VXBA 5U4QA 3BMNA 1LLIA 2PZAA 4BECA 4N5MA 1YHNA 2RH9B 4BV8A 4FJ2A 3DTYA 4KRFA 4WCFC 2P0YA 1V6SA 4BBAA 4UM7A 3N9IA 3ROFA 1UDAA 1E99A 3KSRA 1DEHA 2CNDA 4CMKA 3JASA 4CF7A 2AR9A 1UBSB 4RA6B 5IFLA 1M66A 2O8CA 4QDKA 2BJHA 4UXHA 4LOIA 1TA9A 4HDSB 1ZJ5A 5K4GA 3O1IC 5HFJA 1FSZA 1E2PA 5C7IO 4Y3UA 3U3RA 4J0IA 3SVTA 2FPXA 2JW5A 3A4YA 4FFSA 2ZRAA 3VPAA 1VBKA 1Q0RA 4REMA 2RGDA 4RVDA 4RZ3A 5AOAA 2DPYA 3QVUA 1OFHA 5JECA 1OLXA 2Y93A 1D1QA 2I2BA 4ZRNA 3H8WA 1BCRA 1SWVA 2H7VA 3EXHB 1JDTA 3Q41A 4X6YA 3W77A 4ZHQB 3TG2A 2YKGA 4TYYA 2PV7A 1S9HA 3HYLA 2V1XA 4QJ5A 1SUWA 1WSAA 5BV0A 2E1RA 4TXLA 4A27A 1HLPA 4YPOA 1CJKC 3FVRA 3JZAA 5A9RA 5HKKA 4XFKA 5KNDA 1P31A 1VCNA 1LTHR 3LUCA 4KVZA 2GZRA 4N7JA 3WYEA 4X71A 1QNLA 5CFMA 1OKKA 3N5KA 5DI3B 3RYTC 1ULSA 3WMXA 5EXTA 2ZE6A 4IDPA 4Q7JB 4YRPA 3ZBPA 5L9AA 2J45A 5CB6A 3B20A 3LVFO 1A88A 2WYIA 1BKDR 2BNNA 4LYJA 3HV2A 3D8HA 4U63A 2XMPA 2VHTA 2P77A 4AO7A 1NNSA 2X1MA 1RRGA 3A6JA 4LRQA 4O2RA 4WY2A 2XMSA 1ES9A 3DWIA 4DLWA 4LXQA 1VG1A 5ALGA 1NUPA 4Y1FA 2IDJA 3WYCA 1JBQA 3D3NA 4PHTA 5KCZA 4HDQB 4CBVA 2Y4OA 1F2VA 3CZ5A 3HB1A 1KEKA 2PGIA 1P7CA 3QVLA 2FEAA 4G81A 2B8JA 2ZYVX 2E2WA 1AGYA 1FRNA 3LYLA 3ODPA 4I9FA 1BW9A 4XGIA 2L82A 2OYRA 4E5MA 1FSSA 2AX3A 1A8HA 1E3WB 1DPFA 1PJ3A 5HZHA 5IAGA 2JAOA 1IXKA 1HRDA 3LT2A 4ITUA 4MW1A 1MNQA 4LDPA 3A2MA 4XIYA 2R79A 1MN6A 1AMUA 2LYRA 3C7KA 4P5PA 3L7YA 4TWBA 1FFWA 5CA1A 5B4UA 4BY9E 4Y2SA 3SNHA 3KQLA 4CLOA 2DLCX 1IY9A 1LV7A 2QLNA 3VK0A 3HHPA 4HQFA 4O08A 4ZYYA 1MC5A 3HB4X 5CDYA 3IH5A 5IUNC 1JFRA 3LGAA 1YBFA 1OV4A 4W5HA 3DE5X 1YGPA 3VJRA 4C7XA 3FTQA 2YYSA 3H2KA 3K05A 2VSQA 3ERCA 2P5SA 1FFXA 2G8NA 1BD3A 1K8ZB 3FBGA 4OI4A 2D6FA 2FW6A 4GBJA 5CR9A 5G4KA 3R6TA 4BLOA 4GECA 4MDYA 3CNHA 1KFEB 5TLSA 1E3DA 4RTJA 3WGTA 2Z4TA 2F4NA 4ZI7F 3GWZA 5FWYA 4HLQB 2FGKA 2AI3A 3DH0A 3T3DA 2YXPX 2BE9A 1MVNA 1D2MA 4HLNA 4IZHA 5TJHA 4E3ZA 5JH7A 4M7WA 2VTKA 3MZ0A 4LHSA 5EP2A 2GK7A 1KO7A 4HMOA 3VJKA 1KVUA 1H66A 2DH5A 2QNBA 3NCTA 2R8PA 2PKXA 2IS2A 3AUAA 1QVRA 2XVMA 3AJDA 3P52A 4B4KA 4D1YA 5CT5A 1RPJA 3LK6A 2YTZA 3C5HA 2I4LA 3VQTA 5KYUB 3QOWA 3GMIA 4QQNA 5ENZA 4Z5XA 3WK5A 2SCUB 5JMPA 4UTPA 2JJMA 1EGVB 2WJGA 2W2KA 3I04A 3OEEA 4HAXA 4JKOA 3W2HA 5IARA 1M2NA 4Z54A 4PYQA 4U7FA 1RFGE 5AXBA 1Q77A 2IY7A 4Z1OA 5HM8A 3UBTA 3LBIA 1ZK4A 4JOQA 3GGPA 1U02A 1SZJG 2OZPA 4YR9A 5BSFA 4L27A 3RVKA 1J0AA 3UFDA 2DLDA 5ALMA 5GVSA 1G5TA 1T3GA 3Q12A 4JX9A 2ZIZA 4R7TA 3ITKA 5EMLA 3O7MA 1LWOA 1DOZA 1TLLA 2R44A 4DPMA 1GPMA 3LQFA 2V9PA 2CW5A 4G5FA 4M8KA 4F8JA 3WA7A 4CLEA 3A7DA 2IXTA 1XRSB 1PQPA 4PG8A 1CQIB 1DAOA 1EFRA 1P1HA 1JAZA 1I51A 3OQIB 1OYYA 1LVHA 2I78A 3C6MA 5FLXA 2XDQB 2C2MA 5EHXA 2B34A 5A4JA 1TT5A 4W9NA 5ES3A 5ED4A 1MJNA 1XMPA 1REQA 1XA4A 1T4MA 2ZCVA 3KKLA 1H1LA 1WZEA 5DGTA 3SICE 4W5NA 1EKXA 4A8PA 4EPTA 4HL6A 2VDNB 4DUGA 5LOVF 1WAMA 3P8ZA 1VPVA 1MXHA 1UXOA 3MELA 5AK5A 4RTPA 2ZTVA 1LZLA 4JT8A 4DW8A 2FZCA 4JI0B 2VDKB 4QHTA 1L4KA 1YL6A 3AW8A 3B52X 1XTPA 5HF9A 3PNOA 3T06B 2PCJA 4FYXA 3WXMA 2OO7A 5K0CA 5K0FA 3C48A 1G3IA 3PPVA 2GAFA 3P45A 4L9RA 2BFPA 2NYAA 4C3ZA 1YDWA 1MZPA 1SH7A 1O97C 1HBJA 2HW8A 1W48A 1D6MA 1ZZ8A 3IBGA 4RANA 4UCWA 4FXPA 1FBTA 1FDVA 2ZLBA 2QAIA 4CTJA 2ILTA 1WB6A 4H3HB 4JBIA 3TIVA 5CVUA 2AZMA 1EJ6A 2NZXA 1VP3A 2O23A 3OA0A 5SZJA 3IXLA 1EM8B 1HDEA 4ARZA 4Q00A 2OV3A 2ZPTX 3LM8A 5DYWA 3OD1A 2G7ZA 2QP4A 1WG8A 4CTOA 3H5NA 3R7LA 4QXMA 3PGXA 3EPKA 1ZRNA 3VNUA 3IT3A 1GRRA 1TL7C 1HKHA 4FU0A 4ITRC 4MKIA 3RIHA 4EPVA 1LW6E 4IIJB 4IKOA 4IEFB 3FOCA 5ALNA 2F7SA 5DM1A 4AW9A 1U9CA 2H00A 3DDZX 4KWHA 5F1YA 3ES9A 3RTCA 3KT8A 3QPBA 1FLDA 4FJ0A 4XQCA 2WUGA 4BLQA 5B3JC 4AY3A 1UBUS 3B1WA 2Q1TA 4A6EA 3OIUA 4RQBA 2XNDA 3AUSA 3W2GA 3FZEA 4NENB 3OZ7A 4HN2A 3W7AA 4D8YA 4U6SA 4Q2JA 2PEZA 4XQ9A 4PGMA 5KNCH 4AKHA 1UBHS 3I6YA 4N3BA 3TUIC 5FO0A 4U5XA 1QTRA 3IC5A 2I76A 1FS5A 3QVOA 4MVYA 1GTVA 2YZGA 3JVEA 4U4AA 4IO1A 1RI4A 4LTMA 4DWWA 4IDDA 5DHRA 1G9SA 3W2FA 4O4IB 3TUJC 2Q8QA 3OQBA 4MYSA 3D6HA 4BJHB 2XXQA 2CN1A 2ZQYA 1QQ7A 4F96A 3RRBA 3ROPA 3VH1A 5IYZA 1VTKA 4CM4B 3U4HA 2ACVA 2FJUA 3NHFA 2FSGA 1XF1A 3HY3A 5BSWA 2FH5B 1W8DA 4RYLA 5TGDA 2O5EA 3F5FA 4ND8B 1FMTA 1U8CB 1S2DA 3QEMA 5LIRA 1HI9A 2B36A 1J1UA 4DR5B 3GFRA 3R5TA 3HXOA 4LF5B 1OXBB 3COWA 3MJVA 5HBGA 4YRGA 5EJ4A 4KPUB 5AM3A 2W37A 4BEBA 1Z75A 3R4CA 1XP8A 3GPLA 1GFWA 4TKLA 4A7PA 1Y1PA 2PMCA 2R00A 4BWGA 3TECE 4CNQA 2IA5A 2HWXA 1JQEA 3WAGA 7REQA 1ULHA 2ZJFA 4MCIA 2YIMA 4HUQA 5I8WA 4BNFA 1EE9A 1X8XA 1FU4A 1CS0B 2AF3C 4YP9A 5UKDA 2OHGA 2B30A 3MUOA 3N8DA 5JVDB 3W1EA 3KLBA 4DPKA 4CQLB 2WRZA 3DEAA 3SIXA 1MIHA 2N42A 3W5IA 3PC7A 2MWMA 5BV1A 1Y42X 3EXFB 3A31A 3W2TA 3SPXA 4WNAB 3CX6A 1M2OB 3T3MB 3HR8A 4H6WA 4W9NC 1XAJA 2BFDA 5K0LA 1QQ6A 4BV9A 1VBNA 3IEPA 3WL6A 5GZ1A 1JH9A 1PWYE 2GPJA 3O2SB 2QK4A 1FIUA 2A5FA 2HU5A 2WBLC 1JJBA 1GG8A 1RJWA 2G0NA 2YY5A 4IS3A 2QVLA 4FOTA 5JD3A 2CLSA 2V7UA 4UAJA 3RASA 1QZXA 4XX0B 2PX6A 4CV2A 1A5TA 2Y1OA 1YFKA 3UJHA 2E6UX 4RY8A 2QM7A 3KHSA 1KSJA 2G80A 3LKBA 5CLHA 2YNMC 4DIEA 2VYVA 5AW0A 5C8YB 4YALA 1KEWA 1LLCA 4ZOLA 5AUQA 5CT9A 3A6LA 1DB3A 1Y3IA 4A0RA 1TEZA 1QRRA 1I2AA 1VCIA 1GEEA 1LB1B 1NUAA 3MJHA 2J3QA 4QGHA 1N57A 1RE1A 2IOQA 4ENRA 3J80A 4ALJA 5JMWA 4X91A 2NAFA 3F78A 3GRVA 3QHAA 3FBTA 5GOTA 1USUA 3EIHA 2HSDA 1RFLA 4EITA 1EPUA 4ZMBA 2G28A 2PX2A 3T4PA 1Z5OA 3PEEA 4IJKA 1OXUA 4B6EA 5A6SB 1M83A 1D7OA 1FXSA 2C96A 2OBBA 3UWOA 3ZYCA 2XHZA 3G13A 4C43A 3RYCA 2EVWX 2P2DA 1F7VA 1ORIA 2C2KA 3UV6A 4D0RA 2HV8A 1I6MA 4CKEA 3X44A 1R63A 5CB4B 4G8JA 4BX3A 1ENZA 3AJEA 4C5CA 4AL4A 1ZEMA 3SR0A 1YS1X 1ISSA 5CUQA 4RE5A 2B7LA 4P5EA 5A02A 4G0NA 2GO1A 5CFZA 5JJLA 5LIPA 2I3AA 2V65A 3F5SA 2O5RA 3GJXC 4FC6A 2C5GA 3C45A 4QFCA 4WLEA 3F46A 3UJ9A 1VCOA 2PWZA 3MQ4A 5DLYA 1QDUA 2EJBA 3HI4A 4TPKA 1DAMA 2PSSA 3DFUA 1YDGA 1UXCA 1RC1A 4TXHA 2YJNA 4U3JB 3RIGA 3NTOA 2J0VA 3ET5A 2XD9A 2ZRPA 3Q3VA 5JYCA 4JU8A 5FPKA 2H4ZA 3WMRA 3F9RA 1V4BA 1AOXA 1QG4A 2C4MA 4D82A 4ZIRA 3W78A 1G8GA 3OZDA 4C88A 4TTJA 4BV2A 5ALLA 1VLVA 4PX9A 3L93A 5CNJA 1WR8A 2I3GA 3H9QA 5BW6B 4IJQA 3ULKA 1W4LA 4MIKA 2NYRA 4YWHA 3ZBQA 3FCOA 3COSA 5LR6A 3MB5A 3OURA 5LMUB 5ITSA 2UUCB 3FOEC 2IHUA 3OUUA 4L5JA 5F73A 3H1FA 1CNEA 1TYBE 1FUEA 3NM5A 3H0KA 2VBFA 3SIWA 4I9HA 1KIAA 1P77A 5AVWA 5EXDA 1V4VA 3DFMA 2ZJ5A 2YWCA 2ZJ4A 1THTA 2IK8A 3A6FA 3BK7A 3TZCA 5BVGA 1X9HA 1EQAA 3RQIA 3THWB 1JZQA 1N6RA 3L01A 1STOA 5L3SB 1GL6A 2NV0A 1L7RA 3FSRA 4IHKA 5DI9A 1IN5A 3BFKA 2PGOA 1R64A 5A04A 1E94E 1EK6A 2W0SA 2ZYWX 1W5AA 2AHRA 1DBPA 1E6LA 2V03A 2ZDQA 4FFBA 5IJ9A 4XYGA 1L4MA 4DRXA 5EZYA 2DQZA 1KO8A 5F7ZA 4AJ9A 1TDJA 5IULC 3KQWA 1XXLA 3OJFA 3H6KA 1BTOA 3BMQA 1ZD9A 5JJCA 4H17A 4D57A 2FLVA 2JJ8A 5K0NA 4MI9A 3CZPA 3E23A 4NPCA 5LQRA 2JGFA 1L5KA 3PC8C 4KO1S 1DAIA 3HV0A 5G1NA 5F9FA 3ESXA 5E7QA 3AJ9A 4Q48A 1KJNA 2POCA 3S0JA 4S2EA 1T10A 1POXA 2JHGA 4OOEA 2PVSA 2YBEA 4IGAA 5JALA 1UJ2A 3TEFA 4XM2A 4HBZA 4DSNA 5EE3A 4IIYA 1N9GA 2R6FA 3FR8A 3HR4A 1TUBA 2QJFA 3MRTA 4QGAA 4EB6B 4QNMA 4YQEA 3DLBA 3DEFA 4ZJZA 3PGLA 2RIRA 2V5VA 4UTZA 3RUHA 3U9LA 2OAGA 1J06A 3C3CA 3RTEA 5BN4B 3ITNA 2RD2A 1RAAA 4TLBA 3UQZA 1XU9A 3EMDA 3LUBA 1V2GA 4TT8A 1A9XA 5B36A 4HFNA 4FQ7A 5DNDA 2QEQA 3ZCUA 4H1UA 2K87A 1LS1A 1U3UA 1TD9A 4KWTA 4Y9SA 1FRVA 3T1VA 4NFYA 2X9VA 3WFZA 1MABA 3UJ8A 3ZUPA 2ONCA 5IXSA 3WGQA 3QJ5A 5TIIA 2QL5A 1P3DA 1U4NA 2B94A 4DC9A 3UFBA 3LXXA 4EJFA 4YRBA 2HA4A 4TROA 1DCTA 1F0YA 1XYYA 1GU0A 1G16A 4AX8A 1BMDA 3HZOA 5JUWA 5C34B 1OAAA 3DYIA 3G9TA 4UMFA 4YB8A 3KSDO 4G2TA 3QSGA 3A1NA 1P7PA 1Z74A 4IUDS 1MORA 4K88A 3OFNA 5KQGA 4FFLA 4FW9A 4PS0A 1J1IA 3B2EA 3OPYA 2PMDA 4L22A 3IP5A 2W58A 1PKXA 4Z0TA 3KZ3A 2W4IA 3LLCA 1SZCA 1P3JA 2PD6A 4MVWA 4RVHA 3ZJUA 4HYYA 4YAGA 4LMPA 3KR1A 4R0VA 4I8XA 4X7RA 3OKAA 1NGSA 4QUGA 1N34B 3EDRA 3CLHA 1U7ZA 13PKA 2V6MA 2OT3B 3IV6A 4ARUA 3HFSA 1JR3D 3SCFA 3PHGA 4I1UA 1AA9A 5H3CA 2WFMA 3PQ2A 1GPDG 3LY7A 1UJCA 3OM1A 3VR1A 1IJFA 2ZIXB 1DEAA 4NOJA 5FUBA 1R0WA 1QHSA 3PCRB 1MC8A 1JDNA 4LF6B 3UXEA 2OCBA 4QAJA 2JFNA 4XVHA 4I2NA 2OL4A 4H15A 4BRZA 4DRYA 2AZXA 4DADA 2DQKA 3VAZA 3IPRA 4WV3A 1ZUNA 1M1UA 2RHRA 4MRSA 4EVQA 4FCVA 5EKDA 3V42A 5I4CA 3AGQA 1RAIA 1EGQA 2BTEA 4BQOA 4MLCA 5LZ4A 4HB4A 2E4YA 4TRMA 4ZZ3A 4BZZA 1JI3A 1CR0A 1YNSA 2JGIA 4YMTA 2ZB7A 4PO9A 1FVXA 5KQPA 4XDHA 4X20A 2GFIA 4OL0A 3SCGA 3B6MA 3UT5B 3UF0A 5M2QA 3KWJA 4MR8A 4RCZA 3FIUA 1PQUA 3NORA 1NNLA 1NW3A 3W06A 4IDOA 4JLUA 3AW9A 3KJQA 1ADJA 1NN0A 1ZZBA 2AA3A 1C7QA 2P1ZA 3WX0A 5JEDA 1X7ZA 4MMZB 1F2TA 1JKIA 3OZGA 4CL3A 2RK4A 5BT9A 3V6LA 3DLHA 4FUTA 4M1WA 3HCBA 4WX2B 3O4GA 3PNSA 1E9RA 1I01A 1U28A 4BFZA 4G3XA 4R8RA 4U7WA 2NU9A 3V1UA 4IWNA 1MJFA 2W6ID 3MFQA 4GLLA 4L8LA 4ZHSA 2IH2A 3BPSA 1P2GA 3PQFA 3BQMB 3D0OA 4DLTA 5F2KA 2QW8A 1HFWA 2EF1A 1LKZA 4UOZA 5TE9A 3UMVA 2E87A 4S1WA 3MMSA 4J7AA 4YAFA 1EXWA 1DINA 3ETJA 4GKAA 3M3PA 4MMYB 4KSBA 1M6HA 1J6UA 4RSRA 3U39A 1NZFA 1EFHA 1NMQA 1QYCA 4BX0A 1H4QA 5AI5A 2VF7A 5AXDA 1TQ8A 1FBNA 3J7TA 2D5BA 2GKGA 5JW6A 1WE2A 5U9CA 1VHQA 2I3DA 1FL9A 3C0KA 3QLUC 5FIUA 3LUKA 1N0WA 1SCJA 1Z7BA 4UHBA 2IWRA 2ONJA 2HSJA 2YFQA 4EVIA 4YAKA 3AV3A 4FSDA 1Y6ZA 3R8XA 1UAAA 1T5DX 2H4WA 1ZVVA 3GARA 3MGBA 3TL3A 2XQJA 1WDTA 3DHVA 1D7AA 1VA4A 4HCJA 1KARA 3JVIA 4B6RA 4MNTA 2VJBA 5B3LA 3DQZA 1KEZA 1CZOA 1YT5A 4MUJA 4GF5A 4NG4A 4WBSA 3RJTA 1GA6A 3N7TA 4LMAA 3RVPA 3GN5A 2LPMA 3DDSA 5KX5B 4MUFA 4YQFA 4B3BA 1L9KA 4B34A 2HQRA 3IBYA 1O6FA 2GK3A 5CH8A 2O2EA 1QCYA 3I6ZA 3NDRA 1DEXA 2C9ZA 3OC0A 1U04A 4YMGA 1BHQ1 1VP9A 2HCRA 3RTGA 3PL5A 2GEBA 4TMTA 4DE9A 1BIFA 5CEEA 3KSUA 2I7VA 2VWGA 1C3XA 4CKCB 3D3EA 2OD2A 1SXPA 4GYYA 3E35A 5BRAA 3LQYA 4JP3A 5EKXA 1YBVA 3WTCA 1YAHA 3AF6A 1T3ZA 1IPFA 1ODFA 2FCRA 1N8NA 2FW7A 2QT9A 3GG9A 4M55A 5CX1B 3OMXA 1N6OA 1ZVJA 4O2BA 4KR7A 4PRZA 4DZRA 4NBNA 2EZ9A 3AUXA 1DAGA 3TDKA 2PFKA 3FD8A 4JLKA 4LQ4A 3EXG1 4EG6A 3K94A 2Q29A 2RMKA 3TLGA 1PR9A 2NV6A 3GPDG 5ALZA 5C8VA 4JK3A 3OZEA 3HBFA 4BFSA 2PV0A 4F4HA 2ACKA 1V3UA 4K9PA 4LHVA 2EYQA 2NAPA 1RYYA 3TTTA 3NBAA 1FS4A 5E7IA 2O52A 5AW1A 1FMCA 2H5IA 2IYFA 4JJEA 1N6NA 1R6BX 1WPRA 3KB1A 1FB5A 1TF2A 1A7KA 4HSGA 2PNJA 3UAYA 1NQ5A 1DQRA 1FCJA 1X0VA 3UGQA 3CW2A 4D81A 1C1XB 2JJYA 3PNYA 4RTSA 1JJVA 2VP6A 1NUQA 4DIBA 4UQLA 1U9IC 3C8MA 1P9OA 3HKEB 1XLWA 3PQEA 2J0UA 1ACJA 1W7AA 3BSFA 3OPQA 4G8DA 3ZI4A 3NYQA 2IODA 5LMZA 3NROA 4PQFA 4DNXA 2XKBA 1X86B 1Y82A 4CDMA 4M9SA 2RJ3A 2PDAA 4CNBA 1KK1A 4RIEA 2O1WA 1UBKS 2ISSD 2MYNA 5HOEA 1WBDA 3NP9A 2C84A 3PNLA 4JN6B 4ZDJA 1N25A 5E95A 4CMIA 3OE4A 1TQDA 3SS8A 2BFBB 3EZYA 1GTMA 1M1NB 2QRVB 4GSLA 1T4CB 2HQBA 3C7TA 1XQ9A 2BI8A 3PXBA 4IF4A 4J2TA 3ZE9A 4DMGA 4F2GA 4HI0E 1CF9A 1E2HA 1QC5A 4ADSG 2Q5LA 1RLOA 5IM4A 3TJMA 4TQ9A 1NX6A 1NF9A 4Z4EA 5HRCA 1K89A 1CPYA 2ECKA 2Y9PB 3DE1X 5KTSA 3ORFA 3ISVA 3VZRA 2ZXUA 2WSBA 2QZJA 1PJSA 1ZSYA 3VJMA 4J9VA 3P7MA 2PPXA 2ZWAA 3H9UA 4X9XA 3P9QA 3RTBA 2R2GA 4G5OA 3JQ9A 1Z7YA 1KI3A 2WB4A 4KHPB 1WZUA 1U90A 1V8ZA 2J5XA 2P2NA 1TXGA 4P3PA 4EFKA 1NYLA 3WHLA 5B2FA 2HRQA 2WTEA 2AFIE 1DKNA 4IJVA 1EUDA 2MSEB 1G291 2OCYC 3QV2A 1K8RA 4FDUA