2PUCA

Crystal structure of the laci family member, purr, bound to dna: minor groove binding by alpha helices
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
338
structure length
338
Chain Sequence
b'TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLEANTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*AP*CP*GP*CP*AP*AP*AP*CP*GP*TP*TP*TP*GP*CP*GP*T
publication title Crystal structure of LacI member, PurR, bound to DNA: minor groove binding by alpha helices.
pubmed rcsb
source organism Escherichia coli
molecule tags Transcription/dna
total genus 116
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 1997-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2pucA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pucA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pucA02
2GRLA 1ZZ6A 3Q7TA 2HQBA 4RZSA 2NZUG 5B3JC 1DRKA 4RDCA 1PHRA 3IP9A 4Z58A 1ZZ9A 2WJAA 4UHKA 4G0QA 3LFPA 2B5AA 2JB9A 3H1FA 3BREA 2W42A 3HUTA 4JP1A 1ZH4A 1LMB3 1LJLA 1PEAA 3ILYA 3T6KA 1NERA 1QMPA 3H5IA 2PUGA 3Q7SA 4OATA 3W9SA 3IPAA 3RVLA 1YS7A 2AXZA 3ROFA 2CROA 1QO0A 3CFYA 4MQFB 4PU7A 2PL9A 4JAVC 2JVLA 3F7NA 2J48A 3KCNA 1E6MA 2LP4Y 3QEKA 4GNRA 4GPAA 2IVGA 4IF4A 4KVFA 3CG4A 5IC5A 4S04A 2M1ZA 5TQ0B 1XHEA 1BAPA 1E6LA 3T95A 3RZZA 2PUDA 1P2FA 2MYPA 3QX9A 2PUBA 4RKRA 1SRRA 4XFKA 1CEYA 1E3OC 5T7BA 2MSKA 4Z4GA 3KYIB 3CTPA 5EWLB 4MR8A 2F8TA 5DCLA 4LE2A 3GV0A 1YSEA 4MGEA 5IULC 2FEKA 2LIVA 1IIBA 4QYMA 3H75A 4PU8A 4N03A 2EF8A 1ZITA 4F8DA 4F06A 1JFSA 3MF4A 4JB0A 4KQ9A 4MR7B 4YR7A 2NUBA 3RVMA 5KQGA 1YTUA 3EODA 5FWYA 1EWVA 2LYQA 1FSPA 3LKBA 4Q7EA 1Z18A 1MB0A 1E6KA 4Q6BA 2KPJA 3H5WA 3T38A 1LCDA 1U2PA 2DRIA 4G0OA 1J56A 1XHFA 5HM6A 1CYEA 2FQWA 3TD9A 3CHYA 3HXMA 4OB4A 1RNLA 3NNDA 3H6HA 3F6CA 5I4CA 4N41A 1YVUA 4I8TA 3A3KA 2IKSA 2LYLA 1M5UA 4CBVA 4LE1A 3FFTA 1SQ8A 1ZVVA 3N0XA 3QEMB 4RV5A 1JFTA 2CSFA 2IU7A 3BRSA 2E4YA 1LQCA 2L49A 4Z4HA 3VNBA 2RJNA 3KLNA 1SXGA 3EQZA 3BD1A 3NHZA 1ZGGA 3BS3A 2MSWA 3K9CA 2R48A 2GI4A 3O75A 1RZRA 3KZ3A 3EULA 3G7DA 3IP6A 1JLKA 4MQEB 1ISSA 1JYEA 3OMWA 4Z9AA 4W5RA 1Y7YA 2BNMA 3SCFA 4YV7A 4Q6WA 4YRZA 3O2QB 2PE5A 3UFDA 1QO0D 3BDNA 2CWDA 3TX6A 1BA2A 1RXEA 2OQRA 4W5NA 1E2BA 3DZDA 1L1MA 4Z4CA 2MYTA 3O9XA 5DKFA 5A7LA 2CD7A 4KZKA 1OSLA 4MYRA 4EUKA 3U3WA 4RXMA 4KREA 2JBAB 3VK0A 2WJWA 4F11A 3FMYA 2LYPA 4YARA 3CLKA 1ZESA 3LKVA 3H5VA 4L85A 2R25B 5PNTA 3KG2A 2AYXA 4PICA 3D02A 3FDFA 3M6MD 2XIUA 1YMVA 2QV0A 3I42A 4J1XA 3CROL 3VNAA 1NXTA 5HSGA 3D8UA 2IPMA 3A0RB 4YG7B 1QQAA 4YP9A 3TB6A 5BQ3A 4KPYA 4N47A 5JNWA 3QX8A 5JNUA 3FFWA 1BVHA 3QLVC 5FWXA 1EAYA 1ABFA 3RVRA 5TQ2A 4MS4A 4KMRA 4YCSA 3I5AA 5KC8A 3EAFA 3SCHA 4Z5CA 3EJWA 5HKOA 5IEJA 2FVYA 4ZYLA 5JNSA 1P6QA 3O74A 4RXUA 3LOPA 2QU7A 1A2OA 1YS6A 3FYMA 4Z0NA 2WY2D 4EVSA 3NBMA 4F3TA 1W9HA 1LCCA 4WWHA 3F6WA 3HUUA 4GHJA 2O4AA 4FE4A 4IGAA 1LBIA 2IV1A 4YG1A 1JBEA 1Z13A 2L18A 3BBLA 1NXPA 1VKRA 2KEKA 2XDYA 4PE5B 1ZZCA 3ZHMA 5IX8A 1I3CA 3EGCA 1Z16A 4XAQA 4WUTA 3F51A 2HINA 2FKAA 2R47A 5BRJA 2QZJA 1ISRA 1AU7A 5K98B 3H5LA 5DGCA 4YG4A 4XASA 1URPA 5TQJA 1X57A 3R0JA 3C3WA 5TPZA 1JFVA 2XI8A 3S8QA 4Z5HA 1IC8A 2PLNA 4I6RA 4WT7A 2PKXA 5JS1A 3H1GA 3CECA 3OM1A 2A9RA 3HDGA 4FE7A 2FN9A 1ZH2A 2PUFA 3GT7A 2LBPA 4RK5A 3KKEA 3MYYA 1Z17A 3FFXA 4HYEA 1WETA 2YHBA 4Z9BA 1NXOA 3O1JC 2P9HA 1NY5A 4G0MA 4I6TA 1B00A 4KV7A 3JY6A 4MS3A 1ZAYA 2ZAYA 3G1WA 1K68A 1XWWA 3LFTA 5TPWA 2WIUB 2R63A 2D5VA 4JQDA 3ZHIA 3B2NA 3H6GA 4LE0A 1KGSA 4L4UA 2LYJA 1USGA 3HV2A 2MQKA 4MAAA 4KRFA 4F8JA 1DZ3A 4XXHA 3RH0A 2XCJA 3SAJA 2ICTA 3QWGA 1EWTA 1ABEA 2JVJA 3DGEC 3GN5A 1S8NA 2A9PA 2NT3A 4IMJB 2NT4A 1L5YA 4G97A 1DP4A 2RGYA 3CG0A 3H1EA 3RVQA 5F64A 4EY3A 3QLUA 1DCKA 2HSGA 1C4WA 1U0SY 1Z12A 3UKJA 5EWMA 4NDWA 2MSLA 4H3KB 2QW1A 2WWVD 3N53A 3B7HA 2FMHA 1DC8A 4NCBA 1GLGA 1KRXA 1DWKA 2JVIA 2L2QA 4IMIB 1DBWA 4RK6A 3T8YA 5ED4A 3GRCA 1ZN2A 3CNBA 2HPHA 3ILHA 1TMYA 4EVRA 1APBA 1LJUA 2YHAA 4XARA 3RVPA 1CJGA 1SXIA 3HZIB 5DLEA 5EWJB 1GCGA 2JK1A 1ZZBA 5T3YA 2QSJA 4E7OA 2B1JA 1ZUGA 3LMKA 4JB2A 1R8JA 4MR9B 2H8RA 5TPZD 3F52A 3IDOA 3EDCA 3OQMA 3JPWA 4FB4A 4MCTA 2AW6A 3KXAA 2MYNA 4N76A 5DTEA 3RVOA 3LUAA 4IRXA 2FQYA 3F6PA 4RK0A 2CHFA 4DQDA 4JOQA 1U2QA 1DCFA 3LUDA 3KS9A 2R4QA 3F73A 2EBYA 1AB6A 1JWLA 3DGFC 3KTOA 5CNIA 3JXDL 4ETIA 4TLMB 1JHZA 3I09A 4RY9A 3FMVA 5FBKA 1WIZA 1JDNA 2IPLA 4MQFA 4MRMB 4RY0A 3H5TA 1QP7A 3Q9SA 3LUGA 2PUCA 4EVQA 1ZPQA 1NEQA 1A04A 1DC7A 3IP5A 4O1IA 3HCWA 3O1IC 5TQ0A 1ZZ8A 1UXCA 2RJOA 3Q15C 3S99A 1JDPA 2AYZA 1POUA 2KYRA 3O2JA 4RU1A 4Z99A 4Z4FA 2XSDC 4X4IA 2QXYA 5CHYA 3OMXA 1LLIA 2PMCA 4M88A 3R1FA 4O1HA 1FQWA 2JRLA 1ZZ7A 2BNOA 2IVBA 2ID7A 3E61A 3HEBA 3N6VA 3I45A 3N0WA 4EYOA 1Z25A 3DLBA 1DJMA 2I6FA 5GOTA 2L17A 1LBHA 4MR7A 1YK0A 4NCAA 4MS1B 4WXEA 3HZHA 1KRWA 3OQOA 2H3HA 4YO7A 1DRJA 1CQTA 3SCGA 1JYFA 2TMYA 3LTEA 1PERL 3OO0A 2LUOA 3GBVA 1Y9QA 3N8IA 3OLXA 3MMNA 5CNJA 3GWGA 1O4XA 2FTKE 2JCGA 2F8SA 1EFAA 3GBPA 2BNNA 1K66A 4NQRA 1NXXA 4Z4IA 3QQ6A 4G86A 1RPEL 1DCMA 1BDJA 1YMUA 4G0PA 3RQIA 2BJCA 1GUDA 1RPJA 3QEMA 3RVKA 3A0UA 3NHMA 5BRAA 3DNVB 2IPNA 1M2EA 3ROTA 5KI6A 1H9CA 4LRQA 1ZDMA 1GCAA 2P4UA 2HQOA 4EYGA 4RWEA 1QNLA 4PYRA 2LCVA 1FFGA 2ID9A 4D6XA 4OLBA 1NXSA 1ADRA 2A9OA 3JPYA 4MQEA 4OBBA 2OFYA 1RZRD 3P9YA 3SM9A 4X4DA 2OENG 5IUJC 1R63A 3JXBC 2PUEA 4IILA 2NZVG 1PEYA 4NICA 2IUOA 2GBPA 4OLAA 2AWIA 1OXKB 2FLWA 3IVPA 3SG0A 4RXTA 2FXIA 2O20A 5KQPA 1QQBA 2FEPA 1XWRA 4NV3A 4MLCA 1D1QA 3L1PA 2N9UA 3K4HA 1OXBB 1VLZA 3ZKCA 5IEBA 4S05A 4KNYA 4O8BA 5FBHA 4ETNA 2JVKA 4W5QA 3GA5A 4MR8B 3OLYA 4X4CA 2H0AA 2A9QA 4H60A 1QPZA 4LDZA 4N0QA 3OQNA 2OR1L 5ABPA 2PAFA 2VUHB 3G85A 1HF0A 5JS2A 2E4VA 1F51E 3TRBA 3OMTA 2CHEA 4ML3A 2ZWMA 4XLTA 5FWYB 3QELA 3LUJA 3CLCA 1RXIA 1OCTC 3CS3A 3EQ2A 5C5EA 4OG2A 3LISA 4O5AA 4KK4A 5CNMA 2IVQA 4HNSA 1PNRA 1USKA 1YK1A 1PRUA 5IUKC 4IVZA 2FMFA 4RY8A 1F4VA 3D1NI 4LX8A 2L8NA 1FFSA 4I6UA 2E4UA 3KJXA 3CKMA 3GL9A 3OO1A 4ZMRA 4IA8A 1JH9A 1JX6A 4Y9TA 4G0XA 1KMIY 2RDMA 3Q41A 3M9XA 4Z4EA 3N0RA 1TLFA 1P8AA 4TLLB 1T34A 2LPMA 5KWSA 2GX6A 1UDRA 1ZHHA 2AXVA 1CHNA 4UHJA 3LUCA 4D74A 2FQXA 3LUKA 2GZUA 3BRQA 3HS3A 6ABPA 3PXPA 3JXCL 3MA0A 5IBQA 4MCXA 4HNRA 5JNVA 4PU4C 3LUHA 1NXVA 4MLDA 1EWKA 2IOYA 2X7XA 5FWXB 3DLHA 3IPCA 3TO5A 3KYJB 3QF3A 2KZ8A 3JTEA 3MQ4A 2IPAB 2LYRA 3KSMA 1BDIA 2QVGA 3QYXA 1R69A 3Q7RA 4LDAA 1DW9A 1TM2A 3HVRA 3L6UA 2FMKA 4W5TA 1RZSA 3MLFA 3OLZA 1D2AA 3IP7A 3OM0A 3LUFA 3SNKA 2Q5CA 1ZS4A 1QP0A 5B3JA 1SD5A 3C3KA 3KHTA 1L5ZA 1VPWA 2QVCA 1NTRA 4TMYA 3BILA 3CZ5A 5E3JA 1NATA 4PZ0A 4YWHA 7ABPA 1M5TA 2MYUA 3CU5A 2AUWA 4MS4B 5TQ2B 2E4ZA 3RVJA 4ETMA 2FLKA 2M98A 4RS3A 8ABPA 1DG9A 1X2LA 3DBIA 1JF8A 3C97A 4G0ZA 3E3MA 3UK0A 3NNSA 4X4EA 3FYAA 1EHCA 2O38A 1RIOA 2FW0A 1U04A 1LK0A 1HEYA 3FGZA 4KFCA 2GWRA 4H3HB 3L49A 2PPXA 4X4BA 2BGGA 3O21A 4QYWA 2WRZA 5EWLA 4P1ZA 2FJRA 5BR1A 3O1HB 1JL3A 4QPJC 2V0NA 3HDVA 3UUGA 5KQMA 1Z15A 2WB4A 1GUBA 3JS5A 1YIOA 2FN8A 3OLWA 4KK3A 1USIA 2LYKA 4JASB 2IDMA 3H5OA 2QR3A 3C6QA 5TE9A 4GQMA 5EWJA 2R1JL 1MB3A 2VYCA 3QK7A 1GT0C 3A10A 4PEVA 2O49A 2LYSA 2IYNA 4MPTA 3SQNA 4W5OA 3QLTA 1QKKA 4MR9A 4YLEA 4EGSA 4ZJPA 4P98A 1B0NA 2GRMA 4JCXA 4RK7A 5D2CA 4DN6A 6CHYA 4RKQA 2FEWB 3GYBA 3URMA 1WH8A 2PJUA 4E7PA 2XJ3A 4FBIA 1ZGZA 3CRNA 3O2SB 1MIHA 4TN5A 5JNRA 4MS3B 4WZZA 3RVSA 1PNTA 1PUXA 1MAVA 1ZY2A 4YGXB 3GBFA 2VK2A 5TPWB 3KLOA 1U8TA 4JCYA 2WUSR 1FFWA 3QELB 1Y1LA 1UTXA 4ZMSA 4Y42A 5JNTA 4JA2A 1D5WA 2PIJA 3MM4A 2PUAA 4MRMA 4RSMA 4YS6A 3GN5B 1A0OA 1D1PA 3QLUC 4OTZA 4X4GA 2A6CA 4KQCA 3OLVA 2ICPA 4Z5DA 2KEIA 1M2FA 4N0PA 1P6UA 4EYKA 2AXUA 4FN3A 3HSYA 3MIZA 3HJFA 4F12A 1Z2DA 3C3MA 4Z59A 2E4WA 4X4HA 1WH6A 3M9WA 2HQRA 2JBAA 1UXDA 5GQSA 1VRVA 4YBAA 5EWMB 1QP4A 1S7EA 2E4XA 2KEJA 1W25A 1TVMA 1BDHA 2HJ9A 9ABPA 2WMYA 3RVNA 4IWRA 4X4FA 1C0EA 2PL1A 3HO1A 5KQLA 2EWTA 1D4ZA 5KC9A 1TJYA 3CZCA 1SXHA 3EUSA 3G5GA 1AB5A 4MS1A 4EYQA 3HK2A 3TMYA 5IUNC 1MVOA 4B09A 3OP9A 2FSPA 4WXMA 4J1WA 1PRVA 3JVDA 1NXWA 1Z26A 3HM9A 4RK1A 2VUIB 5C5CA 1PRAA 1DBPA 2L19A 3NNNA 5HQJA 3N75A 4ZPJA 4QICA 4LZLA 3QLVA 1Z2EA 2B4AA 4PU3C 3JVIA 4RK4A 4G0YA 3SY8A 4D6YA 5CNKA 4DADA 2MEZA 1DBQA 2FMIA 2GKGA 4HNQA
chains in the Genus database with same CATH superfamily
1Q91A 4AJEA 2QV7A 2Q2QA 3D6HA 1DRKA 4RDCA 1PHRA 2ZANA 3IUEA 1VMIA 3A9YA 5LYJB 1JT9A 5J5VA 2C42A 2I2XB 2XMCA 4UM8B 3DBLB 3ZV4A 4HF7A 3WWEA 1P19A 5JYBA 3IR7A 1IBCA 3S3TA 2UU9B 2ZRGA 1NF9A 3EQ7A 3W9SA 4PANA 3IPAA 4WLFA 4XDGA 5EIAA 1QO0A 4UKDA 3KE9A 4IMRA 3CA8A 3TINA 3C43A 3NDBB 2CSXA 4AZ0B 1C81A 1PG2A 4PU0A 5CT6A 2PXCA 2BV3A 3QPDA 5BRNA 1MR3F 2W98A 2BR3A 3QFSA 5DYGA 1E6LA 5FUWA 3QX9A 3EXIA 4MMXB 2W00A 2F8TA 5EWLB 4UUAA 2GPWA 1QYWA 2VDLB 3LCMA 4TYWA 2QPOA 5BV8A 1OU0A 2WHEA 3H75A 4LXIA 2ZQYA 4DSNA 1EGVB 4MR7B 3OQJA 2CJPA 3VM6A 5K3AA 1DOAA 4MLZA 4BQRA 4BVFA 3IOEA 2V7VA 4JBGA 4Y9DA 1EWVA 3WQQA 3DDCA 2IYZA 2YL2A 1H6CA 1PL8A 2ODPA 2ZZKA 1F8GA 2AW3A 2AVNA 3UMRA 1WWKA 4KIFA 3JAWB 1QLHA 2DRIA 5GTDA 3HL4A 2H31A 1SBNE 4OB4A 4WZAA 5D87A 1UWCA 1FDTA 3LCJA 3T0FA 2CF5A 1WCV1 3CWZA 3A1NA 3DUFA 3EAQA 4ZO4A 1P1RA 3DDSA 3ZGOA 4B6PA 1MDBA 2C58A 4RGBA 2J0VA 2EKQA 1JFTA 1ULUA 4LOJA 3BRSA 4YLYA 2J5BA 2K6GA 4MPJA 3KLNA 5KYKA 1HORA 3A9UA 2FN7A 2IEAA 2PU7A 2YR0A 2GI4A 4JHLA 5JANA 1Z2CA 5LJIA 3ZEAA 2ATVA 2RARA 1JLKA 3A1CA 4XCXA 5KB3A 4DLBA 3ISVA 5A5FA 1JLRA 3S1LA 2XY4A 4MROA 4W5NA 3G8AA 3NGMA 3BEDA 1TAHA 4LZWA 3VOAA 4LN1A 4Y1FA 3RS3A 3WK9A 5EYPA 5LYYA 3R9IA 3SIXA 3TRIA 2YNMA 5JAPA 1Z6GA 2DUJA 2JNWA 4YCAA 1SVUA 3MMZA 3Q2KA 2XWSA 1S9DA 5ETJA 1CLEA 3UK1A 4AURA 2PVPA 4QOHA 3VK0A 2UZ3A 1KZGB 3YASA 2LYPA 2PR2A 2PT5A 2C2XA 2KQUA 3LKVA 5LU8A 1FFAA 2WSLA 2QSUA 1T0BA 3UT5A 3FB4A 3I42A 1F38A 1J6UA 1FTQA 4J1XA 3N9IA 2EFEB 1D0VA 1JR3A 1SK9A 4G5FA 2C5LA 4C3UA 5HSGA 4X0EA 4CEIA 3M3PA 2P9FA 3WRWA 3AEYA 1VBFA 4BQFA 5BN5A 1KK1A 4TSRA 1GPYA 4FFWA 4MB0A 1LF0A 5E9QA 5JAMA 1C7QA 1FXWA 4J29A 1EAYA 1ABFA 2VSOA 1T2EA 1YI1A 3QGMA 1ZSYA 1AU9A 4GT1A 4KPYA 4Z5CA 1Z2AA 4JVOA 1FUKA 5GZ6A 4B5LA 5H68A 5F98A 3OQHA 1Z4QA 3IDQA 2QQEA 3HCBA 3ITKA 2IDKA 4ZQHA 6ADHA 1E4OA 3DEIA 4QYSA 2MSDB 4YH1A 2OGSA 2GZHA 3EZ7A 3F8TA 4EY6A 1GCOA 2GERA 2RB5A 2VJLA 4I4TF 3DTVD 4EFMA 2X76A 2I4TA 4YI3A 1KJQA 1L1RA 4UUOA 2J59A 1KH2A 4AUNA 1DAIA 5ARBA 3KFLA 2R8EA 3GEIA 4MQLA 1SBHA 2BBTA 5DBOA 5PGMA 3OPXA 5CM2Z 4Q1AA 5KJFA 3E4DA 3C3JA 1XD8A 2LWIA 4U02A 1PT9A 4F2PA 1TTPB 2W48A 4WBSA 5FBVB 5HUQA 3ZXUB 4GPBA 3ZWWA 3VDNB 5KNCA 2J0EA 1JR2A 1U1IA 4C4YA 1YS2X 2ZOSA 3L2OB 5HF9A 1AQNA 2OWDA 2DSNA 3K6KA 4QPNA 4NEGA 1WUKS 2PMWB 1ZGAA 1MQ9A 1MC8A 1X57A 1Z37A 2HCJB 2QY9A 2GFQA 4RIEA 1TVKB 4WT7A 5TPZA 1GNPA 2PLNA 4IUBS 1UPTA 1O7JA 3HDGA 2FZ4A 1TKBA 1PGNA 2MDTA 4X00A 3R7AA 1Q0QA 3V9AA 1WZNA 1DKRA 1Z17A 2W4IA 2FY8A 4JBNA 4Z9BA 3R8XA 3RUEA 5IBCA 4RMJA 2E87A 3L06A 5J58A 2GK4A 4Q9NA 1XDGA 3M5DA 1FXSA 1E8NA 1SCKA 4QDTA 4F1KA 3DNFA 4IDEA 1NLUA 1RIFA 2KS6A 4F1WA 4PO8A 2ZTMA 4YAEA 4Z3DA 3RSFA 5JXJA 3AM1A 4XXHA 5TVKA 2Q5HA 4M86A 3VHXB 4CETA 2IH5A 1Q92A 4MK4A 1O6CA 1H2XA 4MXDA 5G0VA 1QG0A 4DLNA 2J41A 1DHTA 2H51A 4G5OA 3FTQA 1YUMA 5LDHA 4LQ4A 1JR6A 2Y1LA 3QLUA 1HLDA 3GRZA 1ZGBA 4LJ9A 4XLLA 5D3KA 5DM0A 2CXXA 5K2MA 5FA8A 4QOSA 3DM9B 5DWVA 3ZKWB 2O2SA 5KYWB 5H4HA 1RZ3A 1OH6A 3B7HA 1ZRMA 2WJ4A 1R8YA 1DC8A 4EKYA 2VF8A 5I7SA 1GCUA 4ZRDA 4BEVA 3F1KA 3E2PA 3ESDA 1FA9A 1R16A 3U40A 1HDOA 4TTJA 2PLFA 4D1YA 1ZLYA 1VPEA 3C70A 3FDZA 3O38A 4O25A 4Z0HO 5HIIA 8AT1A 2IBTA 4M83A 2HMAA 3A6EA 4YAIA 2BFOA 1J22A 2GZ2A 1VI6A 2IIBA 4EB3A 3OTHA 3KFVA 3T9BA 1WMEA 1S2NA 3A9XA 5BNWA 4IVPA 3FUWA 1P33A 2FQYA 1MO3A 1KJIA 3GBSA 4V2IA 3OECA 1FUEA 2YQZA 4G9GA 2AJBA 4QUEA 3WGGA 1DIOB 1XALA 2LIPA 3AVOA 3LUPA 4M9SA 1OE0A 2PLAA 1H42A 4ZODA 2O7VA 3X3HA 2NZYA 3GLKA 2UYQA 1LS6A 2VATA 4UD6A 5CNIA 3W2FA 5I7EA 1I13A 2J7WA 3FHOA 3K30A 4QUKA 5JO0A 4I9HA 3QFIA 1XJ0A 5KZMB 3ROMA 3L05A 4MW0A 1F2UA 1Q12A 4IV5A 5IJ0B 1KBZA 5IK2A 1XDWA 1GGVA 4EM6A 3GZ4A 4JNKA 3WSTA 2W43A 4JJEA 5U4XA 1MRSA 2YWBA 6Q21A 1DC7A 2B94A 1CETA 3HCPA 2SHKA 4M49A 1GIAA 3Q15C 4IZOA 4UPDA 5KYYB 1NUAA 3I37X 3I23A 2PU5A 2CHQA 3OMXA 1LLIA 2PIDA 2VJQA 2VTKA 3TI7A 4EF4A 5J2UF 1J0BA 3EWSA 5EJGA 5TRTA 2JRLA 1XAIA 1R3UA 2QHXA 3I45A 3PQFA 4QQNA 2HK8A 2IV2X 4W63A 4UVGA 1SVNA 5LQMA 2PNFA 2O2HA 4I9FA 4REQA 4YRBA 4V38A 4KGVA 3VPXA 3I9V6 1OXMA 3OX2A 2TMYA 3FUVA 4HH4A 9GPBA 4NU6A 4U00A 3VWSA 1LK5A 2BLNA 3QUCA 1FYWA 2HWYA 5F2EA 4F71A 4HT3B 3DE7X 5CNJA 16PKA 1O6GA 5LQNA 3GWGA 1O4XA 1P1FA 3NTXA 3CH7A 5FNVA 3CEHA 3Q88A 3WP1B 4DMHA 4X92A 5GGXA 2IU4A 2JFYA 3C8HA 3OT5A 3REQA 3U9TA 1VA5A 3HPRA 4P6VF 1YMUA 5LNK1 3W06A 3OICA 2NU7B 2IPNA 2XE6A 3QVGB 4HAXA 5IAGA 1X1AA 2ISQA 1W8DA 4JHXA 1WVGA 3UOAB 2GF0A 1C9JA 3Q10A 2LCVA 2E89A 4XH9B 2XTAA 4RTQA 4CM5A 2B8TA 4X41A 5KTRA 3Q0EA 4YAKA 1IN6A 1I3KA 4MRVA 3NANA 5KBYA 3ER8A 3M4YA 4BFSA 3NOOA 2NZVG 3U44A 4JOSA 4Q1FA 3PWSA 2UV8A 1GEEA 4AQ7A 2OILA 3L7JA 3PPVA 4WA7A 4EELA 2DPYA 2BZ0A 2O20A 4IIGA 4B2IA 1KERA 1W75A 3A1TA 4NV3A 3MAGA 2YNMD 2RK3A 4KNYA 1U4NA 2EL7A 4G4IA 1LF5A 2NYRA 3ET4A 3MBKA 4HRAA 2R1VB 2WSSA 2I9KA 3HR4A 4RDIA 2ONKA 3I6QA 5JRZA 2FWRA 4H60A 3ZDBA 3IIJA 2OR1L 1DC3A 1ZZEA 2E5WA 2QD3A 2QPAA 1N32B 4K9MA 2C7VA 3O3NB 1QTNA 3OZRA 1GAQA 4WLNA 1S89A 1XZNA 2YZ2A 4RIGA 1V5GA 3OMTA 4RV9A 2O7QA 3AJEA 2E1RA 2DVMA 1ZYUA 4M7OA 2D5CA 1KJNA 4X1YA 4A1OA 4LZAA 2P9GA 3FSRA 4NULA 5BSKA 3K1TA 4HAYA 5CA1B 2QL6A 1SUIA 2PRKA 3RC3A 4TVSA 1FQJA 1SHKA 3V4VB 4DQLA 3ZI4A 3VOTA 2RAPA 4HNGA 3K9GA 2DQZA 3AY0A 5F7ZA 2FMFA 2PUWA 3UAYA 2JCYA 2OCPA 1UP4A 2GCNA 4LX8A 4N1AA 1TIKA 1L5LA 4MV4A 5AVWA 5I7VA 1OWOA 3AVQA 2BFDA 2IYAA 3RVBA 4E88A 2YXPX 3BL6A 4LNUB 4Y9TA 5FQNA 3RTBA 3UN1A 3PC4A 3ZQ4A 3WMFA 5F73A 4J3JA 1UPBA 4MGIR 3V97A 4MUHA 1T9DA 3VSAA 2VWGA 3W5IA 3CNLA 3GUHA 4OXIA 1VCOA 5TARA 5DYIA 3GUVA 1Z4NA 3LUCA 2XOEA 1PSDA 3MJSA 3W8RA 2ZBUA 2DY1A 4CG2A 5C8YF 1AVTA 5JS8A 1E2GA 3W9BA 1E5XA 5KNCD 2P68A 2Z58A 4LTNA 2QZZA 1QRDA 3D3JA 3GZNB 4MVJA 2CLEB 4UU1A 1JAYA 4GGOA 4P58A 3CH4B 1SY7A 3ASUA 5D1HA 2H48A 1AF7A 2KZ8A 1PYOA 4LGVA 2V6IA 1WDMA 2X0IA 5F35A 3BXGA 4BDTA 3IA7A 4YDHB 4DIUA 4DM3A 8OHMA 2IQIA 1SUWA 1TM2A 4AVYA 3OWQA 4BV9A 2WI8A 4E03A 3Q8MA 1XRNA 1P1CA 1YZQA 1WV1A 1U2TA 2G1AA 4BNZA 1KI4A 4RD2A 4URVR 1P9RA 1HSOA 3I2IA 5H5JA 5A7GA 3TQIA 3UOWA 3U17A 3UT6A 4P3PA 3W6NA 1DARA 3TW8A 1O5TA 1VHJA 3E9DA 1T1IA 3A6LA 1M5RA 3AEUA 3WKCA 1YA8A 3WLEA 4BATA 2ZUTA 4AJHA 4IDFA 4FM9A 4XWKA 4JK3A 4ZOLB 4K6CA 1N36B 1DG9A 1GSIA 4IWNA 4DCNA 3ZU5A 5J2TA 1PGPA 4EW6A 4CHGA 1N75A 2YJ6A 4Z51A 4CQMA 4PZCA 5JD3A 2ABWA 3STVA 1G20B 1OOEA 4LOLA 2HCFA 1OGJA 4C3VA 2ZJFA 4KFCA 1E3WA 1TMGE 3DEHA 3PX2A 1E1DA 3F46A 2ZTHA 5LSAA 5IBPA 1E1LA 2BFCB 4LKOA 2GM4A 2IEYA 1Q15A 3P9NA 4ZT7A 3D81A 1JEEA 1MPXA 4M7WA 2J7KA 4R51A 1Z15A 5CTJA 4UPEA 3D2CA 3F90A 3WB0A 3O03A 3FLMA 2VPPA 2WYVA 4BO4A 1USIA 5C2JB 1T4MA 2A5FA 1LWOA 1QZUA 2YY5A 4CMGA 5C4IA 1A97A 3B1ZA 4MTLA 1YB1A 1TXGA 2HMUA 4G67A 1SQ5A 2QUJA 1XFAA 1X70A 3GRAA 3AXSA 1RDFA 5ED0A 1TU0A 1Z47A 5JFOA 2IYNA 1NUTA 2WAOA 1JZTA 2PKCA 4QELA 4N5DA 1ZA2A 3NEJA 3U5TA 3KJZA 3M6VA 1KFBB 2H1RA 4M9UA 2EBUA 3I5UA 5EP2A 3SJCA 3VR4A 1PDOA 1MN6A 4EA7A 1P18A 1TUGA 1JHYA 2BDTA 5JATA 3SFVA 3TCNA 4CCAA 4ZJUA 3HJAA 5A9SB 5B1EA 3SHFA 5A62A 1GRCA 5ELMA 1Z56C 4D8UA 1DLJA 3ADPA 1GL7A 1WV0A 4B3XA 3IAM6 1Y1LA 5YASA 4ZMSA 1KFEB 3FG9A 4RZUA 4YACA 2EKZA 1H85A 1UZUA 3H8SA 3UKDA 2ZULA 3BTSA 5C18A 3DNPA 5IK2D 3B1VA 1VE3A 3QLUC 1TYCA 4LBYA 4ZWNA 1CS0A 2ZBDA 1C9NA 1U3DA 1C3EA 2DHQA 3RYHA 2CYCA 1ZOLA 1RWPA 2JGDB 3WGKA 3IIIA 3EF3A 5A7HA 2G67A 3Q87B 2JBAA 5GQSA 3ULKA 1VRVA 4YBAA 2O8NA 2OR3A 1A8SA 2XUIA 3PFIA 4UAJA 4OHUA 2R7NA 3GRYA 2WMYA 3GN1A 2OYRA 4EKDA 3W5UA 3EHDA 1TEZA 1GFZA 4ADSG 1G9SA 1TA0A 4FGUA 4HQ6A 1NMXA 3B6IA 4MS1A 3H3XA 5KYNA 2QN7A 5B1HA 2WDPA 4PYJA 2J07A 4PG6A 3LLCA 1QH9A 1KZ4A 4MQ6A 2FFJA 3HZZA 1VJ5A 1ZBQA 4XX0A 2OQIA 3ZS9A 2L19A 4HUJA 4XTCS 3W2EA 2FSFA 3IO5A 3PEVA 2A57A 4B80A 4ZI7B 4TV8F 2ZKLA 2AL7A 4XRRA 5FAKA 1KYZA 1NGSA 2P3QA 5HIKA 3IR6A 2PCJA 3WKBA 4DMCA 1H23A 4NSNA 1ULBA 4ER7A 1HTWA 2XJ9A 3L40A 3QW2A 2FFHA 4HWTA 4UHKA 4WA8A 4DLKA 3PIRA 1RKBA 1IWBB 2FMXA 4MWCA 5K8VA 3HUTA 3HHEA 3E9RA 1LKZA 1LMB3 1LJLA 1CZNA 3TEJA 1MRZA 4CL3A 1R18A 5B4VA 1LLCA 4QUBA 2BGWA 3DOCA 1Q7CA 3Q7SA 4JEUA 4F96A 2HA4A 2J4DA 4NCIA 4UTPA 1CG6A 1SXJA 2VJMA 3AJ9A 1EGHA 2WC1A 2VDUE 3TNFA 3ZVMA 3ZE6A 1DEXA 1U90A 2QPLA 1A9SA 3B6MA 4IM7A 1IAQA 1QX4A 1E6MA 2PMFA 3QXJA 2D13A 1A9XB 2HHAA 3CG4A 1ZSNA 1VL2A 3Q1KA 2ZJOA 4MTCA 4NABA 2GESA 1MNAA 4PHFA 3UXMA 3T7CA 3ANNA 1CNEA 2XRZA 2B78A 2UVPB 3FPJA 2JLCA 2XLBA 4Z4GA 3OH8A 2JANA 2PS3A 2WUFA 3M1AA 1MJHA 3IOBA 4HWOA 5FUMA 3P0HA 3FGOA 1EX7A 4HLDA 1S4QA 2F43A 3PNMA 4Y2TA 3W5JA 1MOPA 2GOYA 2Z0MA 1EWQA 4JB0A 1YTUA 5HJEA 3WOVA 4J07A 1AHPA 2VKTA 2IGTA 4M22A 2LYQA 3H5RA 3JSXA 4X62B 4RQUA 2OFWA 3RHFA 3LDHA 3DBRA 4A82A 5EI5A 2AK2A 4NBLA 3GJXC 4HDMA 5EINA 1UFQA 2FQWA 3MMPA 1VG9B 2WU1A 3HY4A 2IX3A 1XOIA 3F6CA 3A6PC 3KEFA 1L4HA 4GI7A 3PWKA 1AKRA 4CBVA 1HF3A 2JIBA 1P9OA 5HP4A 2VBGA 4IGKA 1SQ8A 3W6OA 4F4HA 1HH4A 2XKBA 3ZNOA 2QJTA 4EJ2A 2PXPA 1N0HA 2XT6A 4CV2A 4ENTA 1P1IA 1PFYA 1UCFA 1Z34A 3M8KA 3NIBA 4IXDA 4MRRA 1SXGA 3D6FA 1I4OA 5B1DA 5TJ9A 3SQMA 3EPJA 2NTEA 2MSWA 4DG8A 4RVCA 2ZZNA 4V0KA 3EPRA 3HZRA 1FYDA 1EVIA 1RXSA 4Y6PA 5F51A 3RHTA 2QN1A 3LCRA 1DIAA 1HE5A 5LXTA 1FNNA 2H7VA 3BWYA 1FMFA 1QZXA 2JIRA 3U0VA 3DZDA 2ZYTX 1XE3A 3PQ3A 1WXFA 1WJGA 1B8NA 2P2NA 3K1AA 2NGRA 1RYBA 3MRSA 4MVJD 1KO7A 2JFNA 2P9EA 2MMGA 4KZKA 2X1HA 3KZCA 2GBLA 3VUEA 4AMVA 4F0JA 2EVWX 3A4NA 3BHMA 3KG2A 4U7HA 4RHXA 3SEZA 1ID8A 2OSVA 5IHXA 1MH9A 1WMDA 2VH2A 4RHCA 2IXDA 4DYVA 4MCAA 3KUXA 1J99A 2ZDGA 1YVDA 5ALLA 3SZMA 4LW8A 3TS1A 3QEOA 3AM5A 1BHSA 3FOCA 1BW9B 2KPOA 3IBTA 3ONVA 1R15A 2K87A 4KE9A 4HQKA 4MVJP 5EHGA 1HR0B 1GKYA 3DSRA 4MYSA 3SCHA 1NNEA 1IJBA 4JYBA 5AVOA 3KZXA 3R3VA 5HFJA 4F9TA 1B6TA 1FP6A 1U9JA 2B0CA 5LMCA 3KOYA 4LFCB 5HWSA 1P2UA 3IE2A 1VRCA 3LQFA 1QZZA 3H16A 5BMVF 3QBVA 4FFNA 2Q4BA 5F2KA 5A1JA 3PC8A 4I1VA 3VYSB 1GG5A 1UJ6A 3N74A 4CQMD 4FZRA 4RH0A 1G291 2JGMA 1W0KA 5JCPA 2ZWPA 4WWHA 1J97A 1KKLA 1M1ZA 4B3GA 2VDMB 1FFXA 5T67A 4HXEB 1LV7A 4O2AF 3DEZA 4YR9A 4MVCA 2IZZA 3KYCA 2UYYA 1E1KA 3MW8A 4WDRA 2AD5A 2NW6A 1EHYA 4GEKA 3EGCA 3V4SA 5IX8A 1ZOSA 1CR4A 3IQIX 4ZVVA 4WUTA 3DLCA 3THWA 5FEUA 4B0OA 1GQYA 1QRAA 2JS7A 2QM3A 5CYGA 5KNDA 1X0VA 4DQXA 3TG2A 1W8IA 4HTFA 1JRLA 3NAQA 1M2GA 2A67A 3Q4GA 4LJAA 4YRKA 1QR6A 4KQIA 3DKIA 2G0AA 2PKXA 4E94A 3JRNA 1FU7A 3U2QA 5A04A 4IJVA 3OJXA 2NVWA 2PXQA 3E5RA 3HMKA 1JR3E 5L45A 2IXAA 4XGKA 1ML4A 3VR4D 3GOQA 1XBTA 1RBMA 2Y05A 4CL8A 2CDBA 3FFXA 4HYEA 3SVZA 3LHFA 3AUJB 3I9NA 2QQ5A 3TQSA 3VC7A 2JAPA 3O1JC 4GECA 3NFRA 3DE0X 1X92A 2XW6A 2GZDA 3I3OA 5FI3A 5J2UB 4CKWB 4MV7A 1H0HA 4WCDA 3OCYA 3LP8A 4URFA 3ZHIA 3B2NA 5TQVA 4JYMA 4NCXA 3VTAA 4DV4B 4FIDA 1QZTA 4FCWA 4CMIA 5F78A 4Y6OA 3OIUA 4WNAB 4F4FA 2OT3B 5HRCA 3KUUA 5CDUA 3DG9A 3TBKA 1CVIA 3IAS6 3FCYA 1XK7A 1DC4A 5LZ2A 4URYR 1YASA 2G08A 1SKYB 3CUVA 4YAFA 5TX7A 1J0XO 2O8EA 4RBNA 1Y1QA 1XLVA 4Z2AA 1DCKA 3OPQA 4OI4A 4M8IA 2BM0A 2ZB4A 2JBHA 3H2ZA 5IVDA 3RJZA 2HL6A 3FWKA 2RGGA 4PO1A 4NCBA 2VCHA 3SQWA 1KRXA 5B7NA 1DWKA 4L4RA 1VMEA 3O82A 2EP5A 4XVUA 1U8ZA 3R41A 4Q3OA 3A1VA 2WWYA 4KNWA 4A16A 3ID6C 2ORIA 1WL8A 3NBYC 4TKUB 4DQKA 2B3DA 4IH1A 2D0PB 3BXZA 2KWIA 5EQFA 3UWMA 1KA9H 4AZWA 5CA0B 2PRYA 2PZKA 4PX2A 4B2LA 1C41A 1QVZA 2PQ2A 2WNHA 4RX1A 4S1PA 4MR9B 5EJFA 3U4HA 1HLPA 3LJKA 5B1SA 1CEXA 3OT1A 4PPGA 2HHJA 2C7OA 3F5FA 2WF7A 5A3SA 3TPFA 2I34A 4DE5A 3FOBA 4CG0A 3HXLA 3RFTA 2ZB7A 5F9HA 3GGPA 2Z56A 1Z0UA 2DAPA 2DKNA 2J45A 3DGFC 3PBKA 5I9MA 3U4MA 3C6BA 4GDFA 4LHXA 3L8ZA 4BFZA 2REBA 1TQ4A 2QTRA 1D5CA 3HKEB 1E5TA 1NUPA 4OHWA 5AM1A 1IEWA 1FUUA 2Q27A 3E82A 4FC6A 1CDZA 4O02B 4RVHA 5THXA 1RQLA 1SXJD 3ML1A 2G9NA 3E27A 3ZHXA 1ILEA 2JC3A 3H5TA 1QXSA 3EVCA 3FCXA 4P92A 4Z7QB 3Q9SA 3VSCA 2E2WA 5C35A 5C1BA 2I2FA 5DN6A 2ZETA 2QW8A 3AB7A 3HCFA 2DLNA 2GN1A 3H5AA 1R6VA 3QNUA 3WMRA 2IWHA 2WYIA 1P62B 5JNLA 4WK0B 1LDGA 5JSFA 4QKQA 1A7AA 3A1WA 1QIHA 1DT5A 2LE0A 4LPSA 1VCHA 1K3TA 1FRFS 1IULA 2ID8A 3PUJA 1RWXA 4UBLA 4II3A 3DLBA 2XXAB 4M1ZA 1EZZA 1EFPA 2VRNA 1LB1B 2XYVA 2XIQA 3B7GA 3GGDA 4NJOA 5EIHA 4DTCA 3V9PA 2CXHA 1JH8A 1MB2A 2H7XA 5CX1B 4DJTA 3PEWA 5B37A 2XWBF 4IXMA 3F7MA 1OW3B 2JLWA 1XZIA 4X60A 2VNJA 4XUDA 4L4YA 4NCKA 3CM0A 4JXJA 1KQFA 2V6BA 3SDBA 1XJQA 3RK0A 1NLYA 2WWXA 4RKYA 4DCUA 1DCMA 5F3RA 5JEEA 2B7CA 3FNGA 1RPJA 2Q7DA 4C87A 4DE8A 4A7PA 1JS1X 1ZM7A 3MJEA 3GLFA 3DO6A 2CLKB 1SXJC 2QSZA 4AKGA 3OEYA 3K5WA 2P6RA 2VYQA 2QG6A 4L8YA 2Q9UA 4NOJA 4D6XA 2Q1TA 4W5TA 1XTJA 4EMSA 3BC1A 4MUAA 3SQXA 3SR3A 3CISA 2QLBA 5LB2A 1EESA 3E7XA 1IG3A 1OROA 2O0HA 3IURA 4ZQBA 3OZTA 4C03A 2GJ9A 3CPSA 4XA8A 1UBEA 3L84A 4QBHA 3I5YA 2GZ3A 1QTRA 1CVLA 3KQVA 4DKJA 1XWRA 3GAMA 2A14A 4N40A 4JJFA 3WB1A 5IEBA 1TYEB 5GV7A 3HL0A 2FWMX 3SQOA 3UQZA 3WWPA 2ZU6A 3WWYA 4F9GA 4JJ7A 4QTYA 1ODKA 1R10A 3U39A 3KQNA 2XQKA 3DO8A 3PXCX 4TYNA 1BWQA 5G02A 2NXEA 3FNHA 4QRIA 2F4NA 4JA0A 1YBMA 1YJQA 2FEOA 3GLHA 4HVAA 4YMWA 5IJXA 5BN5B 3VX4A 2VUHB 4H1WA 4Q66C 2OV2A 1W5TA 3THYB 2XUGA 3BX1A 3R6WA 2LKDA 4EG8A 2CHEA 3KBBA 2RH4A 4FEGA 4F7DA 4DV6B 1B26A 1QVWA 2AIRA 4BMVA 1LU9A 2Q99A 1SZJG 3LBNA 5ERXA 4IRUB 5HZMA 2JIQA 1W94A 3GFQA 3O4IA 4LWZA 3S1AB 2GEDA 1ESEA 3FMOB 4TTTS 2PN1A 4H08A 1RAHA 4X95A 5JDCA 4K9OA 3D4OA 1U81A 3NIWA 3EH1A 1J7JA 1OWLA 4L51A 1KI1A 2OHHA 2OLJA 4XSHA 3BPSA 1OXUA 4XUCA 3M6FA 4UVIA 2NACA 2TYSB 3GK3A 3HZOA 4WMLA 3SGLA 1XO1A 3THXA 1RC8A 3O4FA 1XCGB 5E0KB 3H1PA 4ZCLA 1B4DA 3ZHRA 2PO7A 2II6A 3EWIA 4C9BA 2F8LA 2GX6A 2DPXA 2BEUA 2H1WA 1WXWA 2J9RA 2N1BA 4HGQA 3T9EA 2RHMA 1PG5A 1XTBA 1F8XA 5KSZA 2QNRA 2ZSBA 3BWVA 3D5EA 1ZICA 1SOWA 2WSYB 2ZI6A 2XCLA 2GBLC 4Q4JA 1NP6A 3U4GA 5KNDD 3RYFA 4H17A 1NMYA 1CIJA 2B25A 2D4AA 1B0AA 2IOYA 1IOZA 2HRCA 2J67A 3DCNA 3MRTA 3KC2A 1PX2A 3ITEA 3RC9A 3MWDB 4ALIA 5JFGA 1NV8A 1U2RA 2QVGA 2P6OA 2QX8A 1GGHA 1E9CA 1STOA 2PZBA 1F3OA 3QFHA 5DCYA 1PTKA 1DW9A 2J3LA 3GROA 4CZ2A 1IQRA 1VDZA 3DZGA 3WVNA 5HIAA 4N7MA 2EW2A 1H4TA 4R2XA 2VWHA 4WHMA 1XCJA 5JMWA 1M2OA 3ENKA 1L7RA 1YH3A 1TUBB 1F2TB 2C7GA 3W5DA 3SYMA 4FTWA 2Q6OA 3BILA 3ET5A 5FT9A 4PZ0A 3AVXA 2I65A 2ZYDA 4MMYB 1G21E 2A1UA 5AUPB 1E7MA 2B30A 3BZUA 4N5HX 3NGXA 3NBKA 3E3MA 1N0UA 1QK5A 3WJ1A 2EF1A 3CX8A 1SO8A 3D5TA 2B99A 2QJRA 4HGYA 5AKJA 3INRA 2WJ3A 4ZAZA 3KQUA 1HEYA 1BU5A 2BP7A 1BXZA 3EVBA 3MTEA 2XUHA 4ZTBA 1J8FA 3WLLA 4ZDKA 5CBPA 4NIMA 3R4VA 3VNUA 2XBLA 1CKEA 3ZVKA 2BIFA 5ALRA 1O94D 1V8FA 2XHZA 3LQYA 1NULA 5EWLA 1NYQA 2V7WA 3RODA 3B1FA 4DPMA 1KWKA 1KEKA 4H31A 2FWAA 1PQPA 4JL5A 1XKQA 2VPWA 4KNVA 4E0BA 5KSWB 1LW7A 4J76A 2YDYA 4JLKA 4MZDA 5DFAA 3KB6A 3EASA 4X3OA 2GHIA 3QOWA 5EMNA 4JVNA 4HAOA 3T1YB 1G7RA 4NMLA 5H3CA 5EIWA 5HX7A 4MQUA 5JTTA 2W7TA 3ECAA 3R5TA 4W5OA 4Q01A 5E4TA 3G5TA 1LPOA 2YOFA 4AROA 5ITVA 2ZUEA 2BEVB 1P2DA 1J09A 1J23A 2ETXA 1XZPA 2GEBA 4G4JA 4BVHA 3ZVRA 2OHJA 4B6JA 4PHCA 4TSFA 1T10A 5ECGC 1UMDB 5LQKA 3W5VA 3TVYA 5HRAA 3LK7A 4OL9A 5AD1A 1FBNA 2V7QA 4DWOA 3BHJA 2JQEA 2ZREA 3DB2A 3N7UA 2ERYA 4CHTA 3K35A 3QSGA 5FOTA 5IVHA 3KQLA 3KLOA 1GZ6A 3IS3A 3CJTA 3K9FC 1YAJA 5G1OA 3W9UA 1QHYA 2HRBA 3LQ1A 4RKFA 5EXSA 5BWLA 3QFRA 1M33A 3SYTA 3C5HA 3KCQA 3MM4A 2BFBB 2OBBA 4QUDA 3R20A 3ZWXA 1X6VA 1QHNA 1SHZA 1O94C 2V9ZA 3OLVA 3B5IA 3H11A 4B31A 3W77A 4O4LA 5DN6D 3PX3A 1NC1A 2HU7A 4CEJA 4XM2A 5G3YA 3C3MA 2C96A 3AYXB 4IIEA 2YZMA 1FOEB 4P7KA 5A05A 4AQYB 2J08A 3L9XA 3WL3A 2KEJA 3WIOA 1Y9EA 2B2XA 2SNIE 4WINA 4AT1A 3EPLA 4X4FA 2DCUA 3JQAA 4FCTA 2NSHA 4JCOA 4M8NE 1BXGB 1BJTA 3R3SA 4OFBA 5FHQA 4YJ3B 1W1IA 2YDXA 3SJAA 3WJ2A 1ZGCA 5EXPA 5FOWA 4YMLA 1NMZA 3L0DA 1MX1A 4XQEA 1I6KA 2JW5A 1JKFA 4RENA 3TMYA 2ZBGA 2FPLA 3LW8A 5TGTA 1QIEA 2FPKA 3GMSA 3HDTA 1NXWA 2I1VB 2ZYUX 3BF8A 3EFBA 4GMHA 1NRXA 4M3NA 1E3EA 2VUIB 3D4IA 1JJ7A 5K7SA 2OXCA 3NPAA 3N75A 4PR0A 4O3MA 1J9EA 1MENA 1WHSB 5DM60 3MXTA 2KX7A 2JH9A 3TRKA 4ASUA 2P4SA 1B0PA 1NQUA 3I4FA 4RL6A 4OHZA 5LVAA 4U3JB 1DBQA 3JZIA 2QJOA 3BXEA 3IEXA 3P0RA 4QBTA 4PNZA 4QFCA 2NZUG 2BMJA 3QKRB 1P77A 2F3RA 4MVYA 4FDUA 4Z3KA 4G0QA 4GX5A 1GNQA 3PJDA 3VO1A 3KQYA 1TW2A 3QENA 5F5XA 2GRUA 1NERA 1MIOA 1QMPA 4Q3NA 2H06A 5DGHA 2EX4A 1W4BA 4I55A 2W6NA 1BHO1 1R37A 4OATA 1KU0A 4G4GA 4ND6A 3OJEA 4CCYA 1ZR4A 2HFJA 3LG2A 4GO1A 1VHTA 3A7DA 5CG2A 5JZVA 2P3LA 1Q1QA 1JMYA 2C1ZA 3QEKA 2YFKA 5JJLA 4FOOA 4PIMA 1CHDA 2ZBQA 1GSAA 2X2FA 4TYMA 1TVKA 2VJOA 5K20A 5BR7A 4YCBA 3T3GA 4NH4A 1UZMA 3SFZA 3V8PA 1KFJB 2DWUA 3PHHA 4MWBA 3GFFA 1CR1A 3OF5A 2O52A 2PZFA 4A0SA 4MGEA 1VE6A 3ZNNA 1NJ2A 3FKQA 3PPIA 1VLLA 3W6UA 2R1TB 4J1TA 5CFOA 1OH8A 2GLXA 3C5VA 4I2NA 3LLUA 2XECA 6PFKA 4WVLA 4AKHA 3PD7A 1SCDA 5LMNB 2PWPA 5LKAA 2BGJA 1FP7A 3UVEA 3D64A 1G8FA 2GA9A 4OFZA 1QH8A 1E6KA 3V8NA 1SQ6A 1YBFA 3Q11A 1IOWA 4QQFA 3WFZA 3HCOA 1A9ZA 5D3MA 5HRUA 4I3FA 5AK4A 3FCAA 3SC6A 1JAIA 1U94A 2JJ1A 2X5XA 3D6TB 1JVBA 2DYKA 2HZBA 3GT3A 3QUQA 5D3ZA 3ZJ5A 3IESA 1YVUA 4R3NA 2IU0A 1YBHA 4UEJA 3OJLA 3AKDA 3INNA 3NHAA 3QG1A 4J0EA 4Z5XA 5JJIA 3JATB 4PFQA 1LLDA 2RJ3A 4OREX 5EEGA 1NRWA 5JMTA 5L53A 1V3VA 2BTEA 3IDFA 1ZUNB 2R68A 2ZK7A 5GMOA 5C4GB 5BV2P 2PS0A 5CXSA 1DXHA 2F7SA 1NJ1A 2C4MA 4F60A 4ZK6A 1KAGA 3HYCA 4KLCA 4A15A 3VPFA 2ZVJA 2OCKA 1JYEA 3PDHA 4R2JA 3W5CA 2WYHA 5GAHi 4YV7A 4E1BA 1J1ZA 2Z9BA 4HSEA 2B5OA 3MS4A 2PXDA 5BYKA 4A2WA 3VYRB 4LG1A 1U1GA 1KMMA 1DX9A 5G0WA 2G1PA 5IFLA 1ZD2P 1RACA 1E4YA 1I9GA 3IVGA 3QA9A 1AZLA 3OFSA 5EERA 3CF4G 4KLNA 4TTSA 4F11A 4XQ0A 1W88B 2PIAA 3EZ2A 5LZ4A 1L7BA 1KZ1A 5PNTA 3D8RA 1JAZA 1JI3A 1D3AA 1IHYA 2C00A 2GD1O 3KT6A 4RORA 2Q7OE 4DCJA 3FHLA 1LEHA 4D9CA 4DDKA 1I7QB 4AF7A 1IHPA 4BC0A 5FUYA 3DDWA 3DP7A 1RPTA 4F04A 5JV5A 3KXLA 4BU1A 2GBCA 4WLEA 3KTAB 1G64A 4HDAA 5JDCC 1QHEA 2EV9A 3I5AA 3EAFA 1GTSA 2NQTA 3R7LA 1QHIA 4WIAA 4WN9A 2OGUA 3ACBA 3P45A 3WV4A 5ER9A 3JXEA 4LJ7A 4DGQA 1P6QA 2FUG6 2QTZA 4UFNA 3AYZB 4HDNA 4TMFA 1I1NA 4R8SA 1H93A 4RTKA 1VI5A 2IYLD 4OFWA 1W9HA 2X5KO 4Q47A 3UPDA 1U7XA 2H7CA 1NVMB 1JLLB 2PJZA 4I1RA 3PYLA 1C80A 4YG1A 1KY3A 4FQ7A 1EM6A 3DP9A 3LVBA 4HDSA 5KQRA 1UIMA 2J4FA 3HBJA 3V8VA 3FJ1A 2P0YA 4K03A 4L9RA 3NOQA 4OO3A 1TCAA 3FYTA 4CKCA 4EG0A 3D0QA 4RJ2A 4XYLA 2BI4A 4EA6A 3E6AA 1NRIA 1NW5A 4WK4B 4E46A 2OG1A 3BK2A 5EJ2A 1FS5A 1R0WA 4B5KA 2HQSA 1QS0A 4OL0A 4R84A 4H4CA 5KOIA 2FFBA 1TTQB 1J49A 3C14C 5GP1A 1IC8A 5CFZA 1CQIB 1P39A 4EPRA 5JHHB 4BO9A 2Q21A 4HB4A 3O83A 4IIHA 3T3EA 1NE2A 3WBFA 4ABTA 3EGVA 4KAAA 3JW8A 3UGQA 4DA6A 4UUBA 3E7WA 3MYYA 3ROGA 1Q11A 1NT4A 4NNOA 1XEXB 4TSFD 2WZDA 2FP3A 3L5OA 2AFIE 1CJVC 1YZNA 1GAJA 4WADA 1RKXA 5SZHB 2V7QD 1ZKMA 2H07A 4EB0A 5FLYA 2W6IA 3DAFA 3DKRA 2CY0A 4ER3A 5JI2E 5C1DA 3A2MA 3EISA 3IEKA 1GARA 3EIXA 3G5UA 4GGMX 4BWFB 3MPOA 1FJGB 4Z8YA 1AZWA 3KV1A 2F1JA 1ULTA 3KOWA 2IYTA 3RH0A 3NM5A 3MEJA 4JR2A 2D1QA 1OWPA 4K1XA 5IDQA 1S2OA 1I6MA 4F7WA 2NT3A 2XXBA 1QH1A 3U3DA 4O0MA 2I87A 2WIJA 4FEYA 1F60A 4N65A 2RGUA 4DEXA 3LQXA 4NL4H 2CDRA 5UKDA 3IBGA 1H9AA 2PEZA 5A2GA 1GSOA 3R75A 3RKUA 4D9MA 5KYTA 1L4YA 1SKQA 1DO8A 4EI8A 3QPBA 1EP1B 1EQ2A 3OZUA 3T41A 2V6GA 3TCKA 4A0FA 5JQWA 5KJ1A 3FPFA 3IOYA 3ZCUA 1ODJA 2HR1A 4IMIB 3DDZX 3JQAD 2ZE8A 2BMEA 3H2IA 1T43A 3CNBA 3DF9A 4CM4A 1EBBA 1TIBA 3CT4A 3U60B 1XIVA 4QVKA 4J7XA 4WERA 1CJGA 2ZP1A 1WG8A 1SB8A 2O2JA 4MVJI 4G9EA 1LFAA 1FBTA 3BB4A 2WWWA 3GIWA 3BWXA 2IWRA 5EHQA 5E4YA 3EIQA 4FMCB 1I2BA 3EDCA 3MJCA 1DAEA 2GRAA 3KXAA 1FDWA 1NOJA 3GVXA 3LBFA 3H86A 2BGMA 4LV5B 2VHYA 5DXFA 2O2GA 4ASUD 4JMLA 2ZB2A 1DJLA 1V1RA 1MHTA 4J6EA 2QRQA 4YCJA 1EK0A 5FKJA 1L5KA 1W4RA 5AKLA 5FO1A 3D3NA 2JIOA 3BXPA 5EUBA 3AP2A 3C1UA 4BLPA 4HFJA 1KAHA 5HS6A 3P27A 4YN3A 3EA4A 1U5CA 2ZJ8A 5IG2A 4M60A 4WCFB 3V3TA 4MDFA 1JQLB 3FZEA 2EBHX 4D92A 1AOXA 2C95A 2JHGA 1WIZA 1F8FA 1KZHA 1QP7A 1C7JA 4AMZA 1II8A 1RD4A 3GMTA 4WX2B 2PUCA 3KEOA 1RQGA 1G0OA 1M7GA 2QTNA 2W6MA 3G1TA 4N9QA 1YCDA 3OQVA 2XUJA 1YR6A 4LXUA 4PAMA 4AECA 5EJ4A 3HCCA 2ZPUA 1R64A 1Y3CE 2C9DA 3AJDA 3GRPA 3NV9A 4OGGA 2Y0BA 5DNDA 2JI4A 4YRFA 4E6EA 1AGNA 1EFKA 3REOA 4BNUA 4D5GA 1B14A 3LHIA 2BKXA 2VQFB 4S1OA 1D2GA 4K87A 3UAOA 2NU6A 4UQOA 2IP4A 2C2WA 4PNHA 3K6SB 3FYDA 3I53A 2XA9A 1BQ4A 2ZI7A 4W8GA 1JILA 2NUAA 1GV1A 1ELOA 2W70A 4ND8B 4JH0A 3FVQA 4X8MA 1IK6A 2OG2A 2VOEA 1I3NA 4CL2A 5IRCD 1H2BA 1ZW6A 4ZVNA 3CRZA 2JCGA 2ECOA 4NQRA 1T3LA 2JJ1D 4DV0B 1Y4DE 3E7DA 1T3GA 4MIYA 3UAWA 1G20A 5CGQB 1GL3A 3RQIA 2DETA 1KARA 5JAQA 4J9UE 4L28A 4HEHA 3TFWA 3KAJA 3NC4A 2BFCA 4YO8A 1KIMA 2VQSA 3C6KA 5BR4A 1H9CA 1GQFA 4R2IA 3CVVA 1YL7A 5DLQC 2ZSIA 4MW6A 4ZZ1A 2QR2A 4I6EA 3IJ5A 3I1IA 3UMMA 4KWTA 5JU6A 4TUYB 4OBBA 2VF2A 3R76A 1Y7PA 1NM5A 3TZ6A 5BSWA 2W2QA 1NVBA 4IH9A 5FIUA 2QAGA 3UKOA 3L1JA 1V3QE 1U7DA 2HT6A 4A26A 1GP2A 2FXIA 4GICA 1KTVA 1SUAA 5JHGB 1QGED 1LS1A 1ZHOA 1CF2O 2WMNB 3BWMA 1LLUA 5A6SA 5M7EA 4S05A 1IJFA 3VOBA 1ZOPA 4JSYA 1W73A 2H54A 1K75A 2RBGA 3BMOB 2A9QA 3DTYA 3VSDA 1XA3A 5J4VA 3WL7A 4MYTA 3M6AA 4EITA 3R6TA 1N9GA 1KQOA 1DBSA 1KOJA 2VCEA 1DE0A 3EFHA 3ZH2A 3VU1A 1V0JA 3TRBA 2CBGA 4XLTA 2H17A 1RKVA 2SECE 3NETA 4GLFA 1F20A 1E5LA 3CLCA 1I6LA 1IJKA 3DXXA 3PNPA 3C1AA 1OTYA 5E4FA 3OEHA 2HJVA 2VTVA 3TUJC 1U8EA 1GUYA 2IEIA 4XWAA 5ER6A 1XRJA 4MJ7A 3GLFE 5E9WA 1Z0JA 2E85A 8ADHA 2GPYA 1BCRA 1WMAA 4DNOA 3GQVA 3HGTA 1V3UA 5DTIA 1CT9A 2BFNA 3PJRA 4TLLB 3V7WA 2FETA 5HZHA 4JT8A 4IKOA 3X1KA 3AZQA 3RRMA 3WADA 3ETJA 4IWYA 3ZCXA 4D74A 4CLRB 2BFAA 2GZUA 3LUKA 4LYYA 1H2WA 3MA0A 4CM9A 2DF8A 3DYBA 1P7ZA 5JECA 1KZ9A 1XRRA 3LUHA 5TNXA 4H2DA 4DL9A 3KYJB 1XU9A 1R66A 4XLZA 3D59A 3P9RA 1MJ5A 3CLHA 1KH3A 1L4LA 4FW8A 2VDRB 4GI1A 2GCEA 4FGWA 2D06A 1KO1A 2VP4A 2Z08A 3I58A 3MT9A 4HBZA 5KVAA 1GNLA 3L8DA 3OHSX 5JAHA 3GG2A 3GUZA 1E0JA 2CXUA 5CT9A 4B45A 3C3PA 4UEOA 2GAIA 2WWIA 2ZW9A 4ONEA 2Q3DA 5FI5A 2VF7A 4IIBA 5KINB 1MXHA 1WULS 1SHJA 1T1GA 4LC0A 4YWHA 1OI7A 3JD4A 1MX9A 4MS4B 2E4ZA 4HXGA 2C84A 4Q9IA 1QRTA 3JQGB 4BRWA 4KQMA 4BFXA 3FYAA 3ZQUA 3Q98A 1NFQA 3V55A 2JCBA 3CVOA 1FUYB 1T5TA 2X9QA 1N2EA 3QXGA 4W7SA 1YJBA 1N8TA 1PVDA 3AWDA 3BMQB 4LZOA 1DU4A 3DDHA 2SKEA 3W04A 4BNDB 1VXRA 4BPBA 1X7HA 4J0IA 4G5QA 1YR9A 1U2DA 2XXJA 5DX8A 4U1RA 3OI7A 1Y9JA 3UMVA 1LK7A 5DHFA 4I4TA 2ADFA 3SZLA 2OOSA 2EIXA 3BA6A 2JJYA 3FCSB 5ELLA 1MVNA 1Z82A 4BXOB 1NWCA 4IX1A 1U8YA 3LK6A 1DX6A 1VJTA 4QRDA 4PHGA 5TE9A 4C30A 1RVDA 1C1HA 2C94A 2DQSA 2P3OA 4OXYA 4X1OA 5EMMA 4C4ZA 5JCZA 1TF2A 1KDTA 2Q8QA 1BRTA 2D2EA 1HE1C 2JFHA 5DLDA 1IPFA 1X1CA 2C1XA 4G2NA 2QUZA 3Q7IA 4KVGA 4J0QA 4BFYA 4US1R 4OGWA 3KDSE 2E5LB 5FNZA 3GJ8A 2ZB3A 3KJFA 3EXHB 2PJUA 4QOFA 1XMSA 4KN5A 2X4GA 4FBIA 5E2IA 5AXDA 1L4BA 1YCGA 1I80A 5JSZB 4OKNA 5FYDA 4H0FA 1KJYA 3LRTA 1E1RA 1K97A 1WDTA 4R83A 4GMXA 4O08A 4L7VA 2C5EA 4DVJA 4ZOCA 4EO9A 4CEHA 3AHGA 3SOZA 2GB4A 3EBLA 2PUVA 4JA2A 5CH3A 1K27A 1NX9A 3WWZA 2ZG6A 4KDFA 3ZY5A 4JLJA 1Y34E 1TJ3A 1P7WA 4FX5A 3GN5B 1FP4B 1L6IA 2B9EA 5KWIA 2A6CA 4V0RA 5HVNA 3IDSA 3B12A 2KEIA 3JALB 4NU8X 4R7GA 3VTKA 2NMVA 1WPGA 4MUEA 4UATA 1XSEA 4Y2GA 3UBTA 2ZIZA 4K5QA 3ND5A 1WH6A 2WPDA 5EWMB 1C8KA 1OGIA 1SZDA 1R4NA 1ONSA 2VNSA 3AEKB 3FWHA 4IIDA 3MRVA 4KR0A 1PNQA 3BJRA 4LQCA 4O8CA 1BE6A 3NBQA 1X7ZB 1KYWA 3HBLA 4PYNA 1GO2A 3CZCA 3GDGA 5CVJA 3T54A 3I2GA 5A71A 3UZUA 4V0LA 3IV9A 4B8YA 3CKKA 2Q3LA 2BISA 1N7HA 1MTOA 4FKZA 4YRQA 1Z26A 4G36A 1D2EA 3AU9A 3SXUB 5C5CA 1MX5A 4NS4A 3AUUA 3NNNA 5HQJA 4BP8A 1JKMA 4L02A 4CDMA 4QWMA 1JJFA 5SICE 3HQ4O 2RBEA 3DFZA 2GILA 3PHGA 4JD5A 1D1TA 4P0TA 5CNKA 2XTJA 2VIIA 3UMSA 1ZONA 3VI3B 4C7OA 4J2HA 4IZ6A 2WHPA 4EBFA 5JZOA 4XB6B 2H5LA 3WTCA 3NC1C 3U7GA 1VMKA 1UANA 4ZCQA 3N2ZB 2GR9A 3ZGVA 4RFVA 4S35A 2VJBA 4Q3KA 1ENZA 1L5MA 1F0KA 3E18A 2G5PA 2ZYVX 4GAEA 2IPOA 4HZGA 1UBTS 3PTLA 3O73A 1BKDR 5EVJA 4B0PA 1JJIA 2A1TS 1T5SA 1YRWA 1VL5A 3TEPA 1GRRA 1C2TA 4KGXA 1NW8A 4M0EA 3NDIA 1WXDA 3GEPA 3W7AA 2G1KA 3WHPA 1NW3A 1H3FA 1PJTA 2YYSA 2ZEJA 3DLAA 3JR3A 3K9BA 4IICA 5BUSA 1PCXA 3ZWQA 2R66A 4MW5A 4CCWA 4QZVA 1C9YA 4A27A 1PD1A 2NIPA 4JJ4A 4GXQA 2PUDA 4YP1A 3CZRA 2AJLI 1NRJB 4QBFA 1TU3A 4KR9A 4DRXA 4QG3A 4NZNA 3UJ8A 2O07A 3FSGD 3WSWA 3HWRA 2Q1XA 2FRDA 1Y1PA 1EVQA 3D0RA 2JF0A 3MPUA 4RD6A 4UHEA 1MTZA 2JRCA 5J2UA 4K8RB 5FPTA 3KU1A 4MB6A 3AX6A 3L8EA 3IHLA 5EXDA 4BMNA 1QG4A 1FSPA 3CIFA 2HK7A 2BEKA 1YNSA 3AHFA 3CKLA 3FMGA 4DJAA 1I36A 1QPGA 2Y8EA 2IYQA 1LCDA 2XDQB 4IO1A 3T06B 4X64B 4BFLA 5HM6A 1L7PA 1V16A 4OHOA 2O19A 3K5HA 5HZKA 4N41A 1RNLA 3OEHD 4BCBA 3C1OA 1J2UA 2Q50A 1NNI1 3JASB 3N28A 5IDVA 5T3UA 3ZQKA 4CFYA 2OXEA 4DA7A 3U7HB 1L8LA 2W4QA 3CR7A 4PNEA 4EHBA 3CQ9A 3A1SA 1Y3AA 4K9LA 4KWCA 1YKGA 2RJNA 3QW4B 1NM5C 2OHIA 3L7BA 5JADA 2PA3A 3NUZA 4XCQA 2B1GA 1G41A 3K96A 1DB3A 5H1YA 2R48A 4JUBA 4YRCA 5AIBA 1D8TA 2AOUA 2PGAA 2QAGC 4Y67A 1O5IA 2BMDA 1AKVA 3RUHA 3VDXA 4G5GA 1EGQA 4E09A 1WQ1R 4O6VA 1NJGA 1O97D 4P35A 3UFDA 2Y0EA 4NZ9A 4D80A 5ECDA 4HLUA 2YWHA 1RXEA 2ZTUA 2NNLD 4OHFA 2CGEA 3RSQA 1E2BA 3TQRA 4CM9D 2HY7A 4CKWA 1DBIA 2VRWA 1Z68A 3Q5EA 2B2NA 2WT9A 3CT6A 2YYAA 2WEKA 4C78A 3I2YX 5BV0A 1ODCA 2X2EA 4DUGD 3BIJA 3PL5A 1A98A 5MGBA 3D31A 2UYGA 2GN9A 3PUYA 2HRDA 2G28A 1COWD 2CBXA 2PFKA 2RAVA 2V96A 1TM1E 4ZI5A 1GPKA 2AXQA 3M6MD 4YFVA 3PRYA 1YR8A 4D43A 4ZCIA 1NXTA 4ZRMA 1EKXA 2HPZA 1C1YA 4F6RB 5C81A 2P0AA 4G5HA 4A6PA 4N47A 1U98A 2HTEA 3OPYA 5JNWA 3VJRA 3FFWA 3GHHA 2QRHA 1SQSA 5FWXA 1UOPA 3LUBA 4DA4A 1BVHA 2CVOA 2G9ZA 2IJGX 5KC8A 3MD0A 3JQ7A 2OBNA 4OIFA 4XUGB 1L5FA 2LTAA 5IEJA 3GUCA 1JP7A 3L0IB 4L5CA 1N1GA 4R3WA 4JOBA 4G1EB 1G4AE 4Q4AB 5DO9A 2ZRFA 4LOIA 4PGMA 4EAQA 1B6SA 1PG0A 2ZIWB 1U7UA 4F3TA 2QN8A 1ZD9A 4R01A 4YJ2B 1PZEA 2FFAA 2G82A 5H59A 4NQZA 1JBEA 1FX1A 2OBMA 1O97C 1VSQA 3T35A 4DLTA 3B7WA 3NKLA 5E95A 3HDYA 2UXDB 4PG8A 5L95A 1CUVA 5CJ2A 2XXAA 5CGZA 3KT8A 2CMFA 2O2ZA 3PVCA 1JA1A 1OWNA 3RC7A 1KZ6A 3UJBA 4WXPA 4DNFA 2CCJA 2YN0A 3MWJA 2VSYA 3PGVA 4I5FA 4ZCSA 2Q3FA 5LWQA 3A31A 1HNZB 4M0MA 2AJDA 4FR2A 1DWPA 4CDGA 1Z4LA 3AR8A 1L8AA 2JDIA 1JIQA 5JAZA 3FWNA 3GGOA 5C8YA 4OHYA 3H3JA 3HYSA 3C6YA 3OZIA 1O9GA 2FJ0A 2VYFA 2VAWA 3I2JA 1JKJB 2A0UA 2H29A 3L0CA 3MFQA 3WRYA 4Y2SA 3AL0C 3CRVA 3TPZA 2YHBA 3B5JA 1YACA 1UBJS 1TM7E 1NY5A 1ZMOA 2P9HA 1GZ4A 5AW9A 2R8XA 4CE6A 4EGJA 5FP0A 2PXKA 3VHQA 3RSHA 5K0LA 2WIUB 2R63A 2REQA 1KZ7B 1E1RD 5E9JA 3QOXA 3DEKA 4C7KA 2YHIA 2MQKA 1KYXA 2FB9A 2PSHA 2QG4A 4Q21A 2XVXA 4AZ3B 1FB5A 5JSZA 2Z5GA 4IMJB 2A88A 2J9ZB 4DBLE 1UAYA 3GOHA 2VZ9A 1VKOA 4ZEXA 1MQSA 3ZK7A 3L02A 5HE8A 5CB4A 1T1EA 4ER0A 1NI3A 1SWWA 2AKYA 4H0NA 4EY3A 3VI4B 4GXRA 3L0OA 3QVWA 3R5FA 3U80A 4B6RA 2J6IA 4CM8B 4UFPA 4XWOA 3ADDA 3T7EA 1NIPA 2WPDD 3F4KA 2WWVD 4BE4A 3IAXA 2NPIA 3AERB 3AIMA 2PZJA 2QU8A 3NXSA 4IG9A 3VPGA 4KPEC 5BSHA 4OQFA 3PENA 1ZN2A 4KSCA 3RJ5A 4ZGBA 1WXIA 2O8CA 1WIWA 1YFJA 2YHAA 3MZ0A 3RVPA 3VPBA 5KYVA 3HZIB 5T64A 1JEOA 4LXTA 1C4KA 1P4GA 4XWYA 1NF3A 4JI4B 5E7JA 4HWSA 2FMTA 2E6UX 2ATEA 1F2DA 3B3FA 3RBVA 3MOSA 2DP4E 4GYWA 5KWEA 5FRDA 5H0IA 3RJ9A 1VP9A 3L18A 3L6CA 4O4HB 3G0OA 4IFIA 5IPFA 1XTZA 5JSHA 2G80A 1X80A 5LP6F 1ZCAA 1N2OA 2UYOA 5EKTA 2ODBA 3LO8A 1GQ2A 3TJMA 1KMHA 4MW2A 3HVUA 3BGVA 1KMQA 1JZQA 4PRLA 4BNYA 2CVZA 2EBYA 3AY3A 1YOVA 2V0CA 2NO7A 3NHRA 4BO6A 4DZZA 2O2CA 4JYZA 4WJZA 1E69A 3GCDA 3ABOB 3BRCA 3KB1A 1N33B 3N59A 5SYNA 3L6EA 1LSSA 2AXEA 3GZDA 1KEVA 3M5WA 3RSGA 3SR0A 2FOLA 4TN1A 1X74A 1I7NA 1UUFA 4MV9A 5E6RB 3EOBI 3HP1A 3WRXA 4RJTA 5CFNA 3RC8A 4XB1A 4P7FA 3V3KA 1Q21A 5ERGB 1NEQA 3IP5A 4O4JF 1USWA 4OQZA 3A6ZA 3TNJA 3RKSA 1KOFA 2X8JB 3T7JA 3BXOA 3GARA 3M2TA 4FMBB 2ZJ3A 3GPCA 3MWDA 1E92A 4D7AA 4DR4B 2AN1A 1Z6PA 2XADA 2XNSA 3X1DA 4QBKA 2PYDA 3VPHA 3JWPA 1XZDA 1DGQA 1USUA 3ETNA 3IT3A 3HCRA 2HCSA 2GFIA 4FFMA 4BP3A 4ZZ0A 3BSFA 3FF4A 4LC1A 1E79A 5EKDA 2VP3A 3SBDA 3GT0A 4ER5A 1TUBA 1F2TA 2D74A 2NZXA 1L5SA 1YR2A 1DRJA 2V9PA 3DV0B 3HZHA 4YO7A 4D4JA 3B9QA 5JBIA 1WOYA 1IXKA 4XTRA 4CGZA 1VJGA 3TAUA 3AI3A 4COOA 1ZD3A 3RFXA 1S3FA 3C7KA 3L1IA 1B8OA 1W5EA 3FPGA 2BGKA 4LISA 4UARA 4I8DA 4C4XA 1MCZA 3SS8A 4XVCA 4G0WA 3IMFA 5ALWA 4Z4IA 4R1MA 1PWEA 3OWHA 5TIIA 4G0PA 4XIJA 5J4HA 4LGCA 4H7FA 2Q62A 3NHMA 5CDFA 5DM70 4TV8A 3O8DA 3VFDA 5D00A 1E98A 5ALMA 3RLFA 1J90A 4H27A 3LVRE 4P3YA 3DPUA 2XF2A 4RLHA 4X7MA 2FZCA 3BCHA 3HR8A 4LY3A 4B6GA 5LQRA 3PLAE 2PKQP 2Y1WA 4NJEB 1NXSA 3T7DA 4F97A 5IJ9B 4G1FA 1OXVA 1K88A 3JXBC 1V8PA 2BSXA 5DISB 1S3SA 4F3YA 1AS0A 1I4TD 1SURA 1UZAA 4KX3A 1QJCA 4UJ5A 3A70A 4D81A 2WJ6A 1W9MA 1Y9AA 3IVPA 1A71A 1DJQA 1T2AA 2Y0DA 3KDPA 1BX0A 1QQBA 1ND6A 1QVVA 3QXCA 4J7UA 5E1MA 2VHJA 5T6MA 3RF7A 1BVYF 3W34A 4MLCA 4EX6A 1DX4A 1MEJA 2N9UA 1ZEJA 1VLZA 4HMOA 5DTRA 2CLIB 4LYJA 2FRDC 1JE0A 4HJXA 2RHJA 4QODA 1A8QA 5DF1A 2JVKA 5IKXA 1RRGA 3MBIA 1MAUA 2PGNA 3OC6A 2RG7A 3B8HA 4BN5A 3ZDQA 5CLHA 2PQ6A 1NI4B 5CAEA 3IOMA 3E1GA 5ISMA 2NVUA 1IN8A 3GGGA 3W4JA 1K7FB 1F51E 5ALJA 3S81A 2A86A 4ZYVA 4M89A 4PW0A 3FJYA 1XF1A 1YCFA 2EX0A 4BYMA 4HR7A 1HDEA 5HEKA 3AB8A 1ODIA 1Z22A 1U65A 1RZUA 4JYCA 2IVQA 4MLPA 3GR6A 1G20E 2FWIA 2QXTA 4TXHA 5DN9A 2EKLA 3IQEA 3SJZA 2ZAIA 3LDUA 3LC1O 4R8LA 4RM3A 4BQEA 4H15A 3FNIA 2PJDA 2WT4A 4UE2A 4Y3UA 5DNYB 4X6XA 4G23A 4BN4A 4C4SA 4YT8A 2HIHA 2ZGVA 3ITNA 3ZX4A 2RGCA 3ICQB 1A5AB 1C1XA 4REOA 4IEIA 3VZDA 1LDNA 3GLIB 1NF2A 2C29D 3DPSA 3I1YA 2WHYA 4DCSA 2LNDA 3PNOA 2P1ZA 2FRVA 1H1LB 1KBOA 3KL4A 1GHTA 2X0NA 1W2WB 5I9LA 4DB2A 1I2CA 4MZXA 3H4VA 3L77A 1TVCA 2ODWA 3G8CA 4M38A 5CB0A 1XXHA 1JU3A 4CWAA 4ZREA 4Y6SA 1XNRB 2IZ5A 3IALA 1NMEA 3ABSB 4CLDA 2FV8A 3E35A 3PNVA 3WFJA 1U0JA 1DV2A 2JDID 4JX9A 3MJFA 5KQSA 3MJTA 1RYDA 5ITZA 1Y8AA 1J25A 3B3QA 4FFOA 4J1SA 4BFVA 7REQA 1E60A 3AESA 4DSTA 1NBHA 2PDAA 2ZJYA 1CJBA 2CJWB 3MLFA 2WP0A 2YJ3A 2IOQA 4JLSA 4GYJA 3IE0A 2VHEA 1VTKA 3TOSA 3ZXIA 4Z54A 3EE6A 4UW9A 3TZCA 4EZIA 1L5WA 1XDDA 2HSZA 1IBRA 1QGUB 1LH0A 3KUDA 1M5TA 1MV5A 4JVLA 2AUWA 1NQTA 2Z5VA 1O96A 4GXTA 3NC0C 8ABPA 3DBIA 1X2LA 4KBYA 4QNRA 1PJ4A 2D0OB 3I83A 4WAUA 3PDIB 2LV8A 2VK1A 1PK7A 3DXZA 3QJ5A 2ZUDA 1EDZA 4J1QA 5EP3A 4UBMA 5BMVA 5HUHA 5A3QA 5FBQB 4EYSA 1QMGA 1UDCA 1O95C 4IHAA 3RAFC 4M0FA 5A4MS 3O3CA 2WYUA 2WRZA 3GU3A 2D2IA 4HDKA 2I4LA 4LTDA 3KEGA 5ALSA 5TMDA 3UUGA 3AUXA 3VBEA 4RTPA 1YR3A 1CB0A 4WEOA 2C4NA 2BFFB 1G8YA 2R44A 2Q8NA 1E9EA 2XYGA 2Q6TA 2CVHA 2QYSA 3ICWA 4PX3A 2IHVA 4ZGGA 4O2AA 3B1XA 1A7JA 1YGYA 4DXHA 2A5DA 4PQYA 4I1OA 1WB5A 1TW3A 4FYXA 2A84A 1U9YA 2Q2WA 5BVGA 3F5MA 5EWJA 1LPPA 2Q6VA 3HI6A 3NKFA 1WPRA 1JG4A 4CUZA 3GG9A 3KQKA 2A3NA 1FW8A 3WRYC 2OBXA 3SQNA 3MERA 4TWAA 3W6PA 5EZQA 2R00A 5BNZA 4O33A 3PFNA 4CM1A 4QASA 5LUBA 2AHRA 2OTCA 3PQDA 3ZCQA 4DN6A 4D9IA 2I4RA 3UJAA 1RPAA 3DE4X 3TIIA 3RBXA 2UUBB 1UBKS 3K0FB 1DELA 3QWHA 2BRUC 4MPPA 4D0GA 2XJ3A 2CV1A 3O2SB 1E4EB 1Z6AA 3EIWA 3OE1A 4YJGB 3A3NA 4IZHA 4LJKA 5L3QA 1CPYA 2X3UA 4TWZA 4LGMA 3TZKA 1SHTX 3R24A 4YRGA 1HFKA 2EFCB 4BY9E 4IIJB 3TSOA 3F6BX 4X1KB 5T5QA 4EPXA 3IP8A 2VSQA 1IOVA 1SUCA 4UNQA 4KQHA 1GN8A 4B34A 3UW3A 4E5PA 1A0OA 1D1PA 1I6WA 1PSWA 4B8WA 1G9TA 3VSEA 1WUTA 4AK9A 3G5AA 3ECSA 4OPMA 4PQRA 3ZVLA 3IE1A 2QUIA 4FN3A 1CUWA 1DUIA 2M2IA 3FZQA 1IZ8A 1UPUA 3KQSA 4B84A 4AX4A 3CXRA 4F12A 3NZLA 2WAMA 3A4TA 2MCFA 2V45A 1OFHA 5KX5B 2BOVA 2E4XA 1S7EA 1DDGA 1EINA 3AI7A 4Z7NB 1KC3A 3TZHA 4YA6A 4L0CA 2P9CA 4BCDA 1N7GA 2WF8A 3SU8A 4DLSA 1XDZA 1D4ZA 1QDEA 2ZYRA 4C06A 4C6TB 3OZEA 5IKEA 1BD3A 1MABA 1TO6A 4P7BA 5CP8A 2QRVB 1E79D 4CLOA 1YB5A 4CKBA 2IQ5A 1D6MA 2FSPA 4J1WA 2BM8A 2LD4A 1A72A 3PJEA 4GYKA 1HE3A 1QHGA 3KTAA 4R1NA 4CGYA 4WLVA 5SYAA 4C7XA 2Q3JA 3COJA 4OYHA 1OY1A 4D9JA 4BE7B 4DR5B 3DZFA 4Q39A 3EZ9A 3IFSA 4MIOA 3ZI0A 4H77A 2BEWB 1MXFA 1DTSA 2I4NA 3K73O 3AH8A 1KKMA 2HQBA 3Q7TA 5B3JC 1AO0A 4D26A 1RAGA 3HCEA 3IP9A 121PA 4FHZA 5AW6A 1CX9B 3S7TA 3DE6X 1JLLA 4U5QA 5DNEA 1BH6A 3WZ2A 1FXUA 1GXSB 4KUEA 5JMOA 3LY5A 3U3OA 3GZDC 3DMGA 3EEYA 3HNOA 3ILYA 1R5JA 4B6QA 1KNQA 4EB6A 1RPZA 3A9SA 5LBUA 1GZ7A 4JKIA 3WRXC 1Y1TA 2ZJBA 1J0DA 3EUFA 1DBVO 3JAKB 3L7MA 4W9NA 3EIEA 5I6DA 3CFYA 4PLVA 3G2KA 3CWQA 1G3UA 1SVWA 3FYCA 1C3OB 2VDQB 2VNAA 4BX3A 4FHDA 2LP4Y 1A50B 3G9TA 4YJFB 3R40A 5DULA 4ZMBA 1OR8A 2ZI9A 4HRYA 4RIHA 5DDIP 4EUHA 5TQ0B 3ND6A 1U5AA 1CQIA 1ZH0A 5LDGA 4BLTA 3K4PA 4MUGA 2D1RA 5CB8A 4YRLA 5KNCH 3FVVA 1I5RA 1CEYA 4F1JA 3KYIB 4MR8A 5DCLA 3NVKI 3PVZA 3PFGA 3RW9A 1SQGA 2Z1DA 4MJLA 3IAFA 2X5JO 4BB6A 2L69A 3WK5A 2NQ2C 1Z4KA 3PUWA 2Z09A 4N03A 2EF8A 1A5SB 4F8DA 1U0HC 2Z9CA 3KSUA 4TT3A 4Q9HA 3KVRA 4NU5A 3F7OA 3PSHA 1SFRA 3RYCB 5K3CA 1DSSG 5KWSA 4P4SA 4B2PA 2OZPA 1JI0A 8MHTA 6REQB 1RAEA 3DB1A 3RIMA 4BV8A 3HB0A 1FTSA 2GJSA 2OM6A 5IN5A 3TXXA 4YALA 1S2GA 1KYYA 5IJZA 3TN7A 1GPBA 5GY7A 3H6HA 3ZZNA 3LOUA 1MJGA 1AJEA 2AB0A 2LYLA 3CRQA 4DWVA 3BCUA 3JYHA 2X6TA 3FFTA 3L8HA 3M89A 2V4ZA 2V6JA 1IMJA 5HK8A 2ALJA 1DINA 1JIXA 2IU6A 2VAVA 4J0GA 2X4IA 3EQZA 3CF4A 4W1RA 3OOHA 3FAZA 3ONEA 1O5OA 5G41A 2C7PA 5TEWA 4Q4CA 3W5HA 3MWEB 1T2UA 4ZT2A 2JFGA 2Q4EA 4GVLA 1HM5A 5JPIA 1P5ZB 4UXJA 3RFCA 4EYEA 4CFSA 4YRZA 1Q20A 2H4JA 4CT0A 1EUDA 4OJQA 2RKBA 2OQRA 4QU8A 5DMXA 3FY4A 4UAGA 1M76A 3AV0B 2O1WA 3T7SA 1MG5A 4ZVLA 3U3WA 2POQX 4J2OA 5MN5A 3AZOA 1N3BA 4LOAA 1OBCA 1KYQA 1M6EX 4P5EA 3QLJA 4L85A 3PXGA 4QO7A 2F90A 2FUG1 2I1LA 3NAGA 4URWR 5JS7A 3HJUA 4BV3A 1Y8CA 5BT9A 1B76A 4FZ3A 3UC5A 5KVCA 4OQ4A 5D3QA 3B2QA 4YG7B 3RARA 3HM2A 5A4KA 3DPIA 1MHPA 4MKZA 5BQPA 4C88A 1G8GA 5EL0A 3L07A 1NZFA 4E33A 2BSQA 4N48A 4M46A 1X42A 4YCSA 1DQPA 1S01A 1EUCA 3TW4A 1PJ3A 1I7LA 1SKYE 2XIJA 5LCXA 4M9RA 4GMGA 4BO7A 1P17A 3N2EA 2QLMA 3NMUF 4B4WA 3HUEA 4RXUA 1VLMA 1V39A 4BWYA 4IDOA 3KZNA 3FYMA 2I03A 2UDPA 1FMTA 2LRHA 1LZKA 3I39X 4BVJA 1QTIA 4WFQA 2DWQA 5I51A 1ATIA 1FYEA 2PZGA 3ORFA 2OXIA 4BEWA 1FF9A