2PUCA

Crystal structure of the laci family member, purr, bound to dna: minor groove binding by alpha helices
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
338
structure length
338
Chain Sequence
TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLEANTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of LacI member, PurR, bound to DNA: minor groove binding by alpha helices.
pubmed rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*AP*CP*GP*CP*AP*AP*AP*CP*GP*TP*TP*TP*GP*CP*GP*T
total genus 116
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 1997-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2pucA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pucA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pucA02
2PUCA 5IC5A 3EGCA 4YV7A 1TJYA 3H1GA 3HCWA 1Z2EA 1K68A 1E6LA 2E4WA 4J1XA 3C97A 4EUKA 5ABPA 2L19A 4W5OA 3BRQA 3DLHA 2PUFA 1DWKA 4HNRA 2BNNA 2AXZA 4Z59A 1D1QA 3HV2A 4MR8B 3RVNA 1DCMA 4EYGA 5BRAA 5FWYA 5JNVA 3IP6A 4P1ZA 2WY2D 3I5AA 2MYNA 1ZZ9A 2GX6A 3KYIB 4ETNA 2FLWA 2QU7A 2WJAA 4ZPJA 5KI6A 3EUSA 1JDPA 3R1FA 2KZ8A 3GT7A 1ISSA 1EWVA 4OLAA 1Z18A 2PUEA 1DC7A 1KRXA 2EBYA 2BJCA 2IPAB 4MR7A 2H3HA 1LBIA 5DKFA 3O1IC 2JVIA 4RK7A 8ABPA 2R63A 1R8JA 1GUBA 3H5VA 4LX8A 2IVBA 4NV3A 5DLEA 2HPHA 2VUIB 3D02A 4G0QA 1JYEA 1UXDA 3G1WA 3I42A 3E3MA 2FJRA 1HF0A 4KFCA 4RK4A 4DQDA 4OBBA 4MS1B 4RXUA 1O4XA 4XFKA 1YK1A 1NXXA 3H1FA 4KV7A 3HM9A 1JFSA 3D1NI 1F51E 2WRZA 3CG0A 1TMYA 4H3HB 3QF3A 5EWJA 4EYQA 3L1PA 3U3WA 2FQXA 5TQ0A 3OLXA 3KYJB 5BQ3A 2R25B 1BDJA 1DCKA 3FDFA 3F52A 4D74A 3RVPA 2QZJA 4JCYA 1F4VA 3TRBA 1DJMA 3SNKA 4KQ9A 2EF8A 1VPWA 5JNWA 4E7PA 1QNLA 1WIZA 3CZ5A 6CHYA 4W5RA 1ZGZA 4PE5B 4RY9A 3QELA 1LMB3 3F6PA 2GZUA 4KK4A 5FWXA 4EYOA 2FMIA 5DCLA 3HS3A 4Z58A 2GRLA 1U04A 4MR9A 4KRFA 1WH6A 5DGCA 4X4HA 3HZIB 2VYCA 1Z15A 2FKAA 2HJ9A 4KZKA 1H9CA 1NXTA 5KC8A 2L2QA 3LUKA 4G0XA 1ZHHA 1YS6A 3N0RA 2PKXA 1UTXA 4N03A 3UKJA 1PRAA 1T34A 2MYUA 3LUAA 3VK0A 3DBIA 5BRJA 3CS3A 4JAVC 1ZZ6A 3QK7A 3QQ6A 3OP9A 2MQKA 4MLCA 1DC8A 2AWIA 3LUCA 1IC8A 2KPJA 2FQWA 5KQPA 2MYTA 3KCNA 5FBKA 3H5TA 1Z17A 1KMIY 2OENG 3SY8A 4FN3A 3MA0A 3EAFA 4Z5HA 1X2LA 1ZAYA 1RZRD 2FXIA 4LDAA 2GRMA 5CNMA 4KREA 5TPWB 3VNAA 4EVSA 4F8DA 4OB4A 1OCTC 5EWLB 3HXMA 3DGFC 3S99A 4YRZA 2WB4A 1ADRA 1YMUA 1U2QA 3N0XA 4D6YA 4JQDA 1S7EA 3NNDA 1RNLA 1LCCA 2W42A 3OQMA 4YG1A 2PLNA 4PEVA 4PU7A 4W5QA 5KWSA 1AU7A 1S8NA 3B2NA 3N53A 4NQRA 2IDMA 5IX8A 1M5UA 2KEIA 4F06A 1Z25A 3QX9A 4Z4CA 3LFPA 2P4UA 4ETIA 3SCFA 4EVRA 2WUSR 1ZESA 4NCAA 3RZZA 2MYPA 1A2OA 5CHYA 2AYZA 1R63A 3G5GA 3HSYA 4JCXA 3FYMA 2PJUA 2VUHB 1SXIA 2BNMA 3KXAA 2GWRA 2WMYA 4QPJC 1U2PA 2OQRA 3RVJA 5KQLA 3FMYA 4G0MA 3A10A 2AYXA 4LE1A 4RZSA 5KQGA 1ZITA 3DNVB 4YGXB 2PUBA 2NUBA 4G97A 5GQSA 4S05A 4I6RA 1PEAA 2I6FA 4I8TA 3RVOA 5TPWA 4Z4GA 3HDVA 1ZH4A 5HKOA 5IUJC 3F51A 5IULC 1BA2A 2LCVA 1E3OC 2PUGA 4YLEA 3GBVA 4XLTA 2FLKA 4UHJA 1MIHA 4GNRA 3F73A 1DW9A 3O2QB 4YARA 4WT7A 3TO5A 1DZ3A 3UK0A 1SXGA 1B00A 1ZH2A 1EWTA 3OMWA 2NT3A 1DRJA 3C3WA 1BDHA 1MVOA 3OM1A 3Q7SA 4MR9B 3URMA 3MM4A 1L1MA 1ABEA 3CU5A 3QLVC 4X4CA 1B0NA 2RGYA 1L5ZA 2CHFA 4IVZA 3ILYA 3LFTA 1QKKA 4QYWA 4WZZA 4B09A 1P8AA 1TLFA 2O20A 5DTEA 5I4CA 3ZKCA 4EVQA 2CSFA 4X4FA 4RU1A 3G7DA 2J48A 3BRSA 1M2FA 1Z26A 3LISA 3NNSA 3O1HB 5FBHA 3JY6A 5TQ2B 4G86A 5TPZA 2E4ZA 1P6QA 4JA2A 3CKMA 1DBPA 3Q7RA 2E4UA 4MQEA 3QWGA 3EODA 2QW1A 5B3JA 5EWMA 5KC9A 2FN9A 3OLVA 1RIOA 3O75A 3LOPA 3BREA 4IILA 5ED4A 4W5NA 4N47A 2LUOA 3O2JA 3KLNA 3LTEA 1JWLA 1I3CA 4M88A 1UXCA 3H6GA 4YP9A 3DLBA 3MQ4A 1BDIA 2FQYA 3QX8A 4Z0NA 2FEKA 2AXVA 2RJOA 1URPA 2QVCA 2O4AA 3SCGA 2CROA 4YG4A 3Q7TA 4Z4IA 1XHFA 2JBAA 2CWDA 2JVKA 5JNTA 1FSPA 2L8NA 2IYNA 3CHYA 1QQBA 1SRRA 1JBEA 2YHAA 4PICA 4RS3A 3H6HA 4F8JA 1GCGA 4IA8A 3GL9A 5CNKA 4W5TA 1D2AA 3M9WA 3QEMA 1ZS4A 4F12A 3JXBC 1PRVA 3CZCA 2NZUG 5GOTA 3SM9A 3B7HA 4EGSA 4Z4EA 2A9QA 1AB5A 2LYLA 1FFSA 4IWRA 3O9XA 3JPYA 4FE4A 3SG0A 3LUDA 1ZVVA 4ZYLA 3HJFA 1C4WA 1GT0C 3MIZA 3UUGA 3N75A 2KYRA 5JS1A 3EQ2A 3K4HA 4IMIB 1JH9A 2QVGA 3I09A 3A3KA 1LJUA 3MLFA 1OXKB 3OLWA 2JB9A 1CHNA 3H5IA 4KMRA 4DN6A 4XAQA 3BDNA 3CRNA 3A0RB 3M6MD 2QSJA 3BD1A 3JXDL 4HYEA 3PXPA 2LYRA 2RDMA 2PUDA 2IVQA 1IIBA 5E3JA 2PIJA 2PAFA 4YG7B 1USKA 3GN5B 4TMYA 1NXPA 1APBA 2VK2A 3BS3A 1QP4A 2AUWA 4RKRA 5HQJA 2GBPA 2XJ3A 3BBLA 4FBIA 2FSPA 3CNBA 5JS2A 2F8SA 1RZSA 3JVIA 5HM6A 1A0OA 1BVHA 3LUGA 3QEKA 4N41A 4EY3A 3NHZA 1PHRA 4UHKA 3FMVA 4Z5CA 1POUA 2B5AA 2IOYA 3N6VA 1PNRA 4L4UA 1XWWA 3A0UA 4MS3A 1L5YA 2WWVD 3QYXA 2O49A 1UDRA 2XIUA 4MQEB 4YR7A 4ZMRA 4TLMB 3LUHA 2XSDC 1USGA 2GKGA 2ZWMA 4OATA 1ZPQA 3FFTA 2NT4A 2MEZA 2A6CA 2IU7A 3GYBA 2ICPA 1YVUA 4RY0A 3HZHA 2FEPA 2PE5A 1VLZA 1NEQA 3GBFA 4XASA 2FMKA 4O1HA 3BILA 4Q7EA 4PU4C 4MQFB 4Z99A 3TB6A 1Y7YA 1QQAA 1PRUA 5A7LA 1ZGGA 1R69A 2IV1A 3OMXA 1ZDMA 3OO0A 4F11A 4KPYA 3EQZA 3QLUA 1PERL 2KEJA 1M2EA 4Q6WA 3MYYA 1GCAA 3L49A 2LYKA 4YO7A 2L49A 5EWJB 3TMYA 2GI4A 4LE2A 5IEBA 1MB3A 3UFDA 4MR7B 4H3KB 3QEMB 4WUTA 1JHZA 3H75A 5TQ0B 4RXTA 3TX6A 2MSWA 1WETA 2DRIA 4MRMB 4ETMA 1EWKA 2LP4Y 4XARA 3LKVA 5C5CA 4GPAA 1VRVA 3KHTA 3KS9A 2HQRA 4QICA 4OLBA 3RVMA 2NZVG 1NY5A 3C6QA 1VKRA 4QYMA 4RV5A 3IP7A 3L6UA 3KKEA 2MSKA 3FFXA 5IEJA 1P6UA 4G0OA 2X7XA 3QELB 3QLTA 4YBAA 4NCBA 4FE7A 4MAAA 2JVLA 1W25A 1LLIA 2FMHA 4RK5A 4MCTA 3EDCA 4O8BA 4PU8A 1RPEL 2BNOA 2JK1A 3GV0A 3MMNA 3OLZA 4MR8A 4Y42A 5TPZD 3T8YA 4ZJPA 3GN5A 4YS6A 3TD9A 3SQNA 3ZHMA 4MLDA 1YIOA 3GA5A 3H5LA 4JASB 4XXHA 1KRWA 1AB6A 1FFWA 3OM0A 4IF4A 4L85A 4Z9AA 3S8QA 1HEYA 1PEYA 1E2BA 1ZY2A 1NTRA 1LK0A 2CD7A 3OQNA 1JF8A 1NXVA 2B4AA 3FGZA 1QPZA 4X4GA 2PMCA 1CEYA 2LPMA 4F3TA 3Q15C 2PPXA 1GLGA 2RJNA 4RK0A 3H5WA 1DCFA 1NERA 2FN8A 2H0AA 3F6CA 4MYRA 2B1JA 1NXWA 3NHMA 3EULA 3LKBA 3CG4A 1ZZBA 2HQOA 3HDGA 3IDOA 3IPAA 1Z2DA 4Z4FA 2QR3A 1USIA 1XWRA 1X57A 5IBQA 3CFYA 2O38A 2E4XA 3G85A 1FQWA 3VNBA 4MS1A 1K66A 3D8UA 4HNQA 3LMKA 2OFYA 1D1PA 1ZN2A 4YWHA 3RVRA 3QLVA 1LCDA 3I45A 4X4DA 1DG9A 2H8RA 2A9PA 1ZZ7A 1DRKA 2QV0A 3O74A 4CBVA 1CYEA 3GWGA 3HVRA 1QP0A 4LDZA 3QLUC 3W9SA 2E4YA 4PYRA 1SD5A 4RSMA 3IPCA 4GHJA 4RXMA 3T6KA 2ID9A 3O1JC 1QO0A 3O21A 1KGSA 4KK3A 2IPNA 3JTEA 3OLYA 2LYJA 3SCHA 2FEWB 2R47A 3EJWA 3Q41A 1SQ8A 5EWLA 2R1JL 3C3MA 4MGEA 4MRMA 3E61A 3RVQA 4KVFA 3CROL 3OO1A 5CNJA 3M9XA 5T7BA 5JNUA 3KZ3A 1D4ZA 1GUDA 1RPJA 1Z16A 3CECA 1ISRA 4G0PA 5PNTA 4KNYA 1DBWA 1JX6A 3NNNA 1E6KA 4Q6BA 1PUXA 3OMTA 3IP9A 2PL9A 4I6UA 4PZ0A 4X4EA 1YSEA 4JP1A 4NICA 3ROFA 1LBHA 2HINA 2OR1L 4LZLA 3LUFA 3RVKA 1OXBB 1QP7A 2XCJA 3CLKA 3OQOA 3JVDA 2QXYA 5D2CA 1Z12A 3IP5A 3CLCA 4FB4A 5TQJA 2IKSA 1TM2A 1RXIA 3KG2A 4ML3A 5T3YA 1J56A 1U8TA 3HO1A 5K98B 2FMFA 1DP4A 2WJWA 4IMJB 4MCXA 5B3JC 7ABPA 2PUAA 2MSLA 3HUUA 4Z5DA 4LE0A 1YS7A 3RH0A 3DGEC 4Z9BA 2FVYA 4P98A 9ABPA 2L17A 5TE9A 2N9UA 3R0JA 5JNSA 4X4IA 1C0EA 3H5OA 1NATA 3KJXA 1M5TA 1YMVA 3O2SB 4IGAA 4O1IA 2D5VA 4EYKA 5IUNC 4H60A 1JFTA 5EWMB 3T95A 1D5WA 2FTKE 4LRQA 3RVSA 4TN5A 1Y1LA 3T38A 1Y9QA 3NBMA 1OSLA 3JS5A 2F8TA 2L18A 4WXEA 5F64A 2JCGA 1U0SY 3C3KA 3LUJA 2CHEA 4JB0A 5KQMA 2EWTA 2FW0A 3SAJA 4OTZA 1NXSA 1JDNA 2R48A 4RKQA 2JVJA 1EHCA 1LJLA 4OG2A 4Z4HA 2WIUB 2XI8A 5C5EA 1QMPA 2M98A 3HUTA 5HSGA 4NDWA 1NXOA 1QO0D 1JYFA 3KSMA 2XDYA 2LYSA 2IUOA 1ABFA 1JL3A 4MS4A 2ZAYA 4RDCA 2A9OA 4DADA 2LYPA 1CJGA 1EFAA 2LYQA 1Z13A 2IPMA 6ABPA 3IVPA 2R4QA 2E4VA 4KQCA 4D6XA 4JOQA 1P2FA 3FYAA 3GBPA 2JRLA 4IRXA 1JLKA 5BR1A 4YCSA 4GQMA 1PNTA 4G0YA 2YHBA 4I6TA 4RK1A 3P9YA 3HEBA 2HQBA 2IVGA 1RZRA 3H1EA 3N8IA 3ROTA 1MB0A 2Q5CA 3JPWA 4HNSA 4JB2A 2LIVA 4PU3C 4N76A 3ILHA 1TVMA 2JBAB 2M1ZA 1LQCA 3MF4A 4X4BA 3F7NA 3K9CA 4MQFA 3ZHIA 2ID7A 2PL1A 1JFVA 1CQTA 3RVLA 3N0WA 1FFGA 1ZUGA 2AXUA 2A9RA 1BAPA 5CNIA 1E6MA 1EAYA 4G0ZA 4ZMSA 5FWYB 2AW6A 3DZDA 3KTOA 1A04A 4Y9TA 1YK0A 1WH8A 4RWEA 1SXHA 1W9HA 4WWHA 1YTUA 1MAVA 4MS4B 1DBQA 4N0QA 2BGGA 1ZZCA 5JNRA 1RXEA 1XHEA 4O5AA 4RY8A 2IPLA 5TQ2A 3HK2A 4TLLB 4E7OA 2P9HA 3RQIA 4N0PA 2HSGA 5FWXB 4S04A 2KEKA 3FFWA 1ZZ8A 3CTPA 2TMYA 3KLOA 2LBPA 4MPTA 2ICTA 4WXMA 4J1WA 4MS3B 2V0NA 3GRCA 4RK6A 3JXCL 5IUKC 3F6WA 3Q9SA
chains in the Genus database with same CATH superfamily
3KL2A 3LP8A 3KJHA 5LVAA 2M2IA 3EGCA 4QG7A 4X94A 4C76A 3LX5A 1UR5A 1ZIXA 1C3VA 4O4LF 1DULA 1LW7A 4DY6A 3QWAA 4QJ3A 4J90A 5C5DA 2L19A 3FPSA 3MILA 4WZAA 3ER9A 2NVUA 1L8QA 4BMVA 2BNNA 2P67A 4MR8B 4HQOA 2G0TA 2IYOA 1KO5A 1HT2E 4I99A 3WTCA 3AVVA 4B4KA 4CMAA 4Q3OA 4ZT2A 5A03A 2HTFA 2ZYUX 2XNHA 2C2ZA 4Z86A 4E5SA 1IXYA 1U7HA 1NUQA 3DZGA 3GPBA 2HADA 2J46A 5H9WA 3R0VA 3D4OA 1TU3A 2GPBA 3MJ4A 3GT7A 2FCAA 4IMPA 2AI3A 5JH7B 5EXXA 4RH3A 4QJ5A 1N5OX 4DV1B 2D13A 2XUHA 4K9QA 4OSEA 1I4TD 4HXGA 2H3HA 4Q1DA 1TM4E 2ZI5A 4XDHA 5DKFA 2WE7A 1VJTA 1YI0A 1JR3D 2ZWIA 4IY1A 1V9LA 1GQFA 3T1NA 1YT5A 3EGWA 4DA6A 2C8VA 3V4SA 3MWDA 5BSGA 1NFQA 1L1QA 4MV4A 3NRJA 3ZWQA 5E6UA 1LQTA 1WIWA 4M8KA 3JAKA 3K9WA 2DOKA 4RQUA 5IC4A 1Y1QA 2FJRA 2CZQA 2QRKA 5DF1A 5HOQA 2VLBA 5KYXB 3E22B 2RHCA 3A6FA 1LWNA 3W79A 4MYTA 2UZ4A 4R54A 3KPJA 1RXYA 2AOTB 1XPRA 2O2XA 3ESCA 4BGDA 1SZPA 1B6SA 4LJSA 2CHVA 5KTKA 1J99A 1EGQA 4TMVA 1TQDA 1ULAA 2D0OB 2BKXA 4RAOA 4UHFA 1KQOA 2YUIA 4R8SA 3KYJB 2PWBA 2FFRA 3SXUB 4FKZA 3KQPA 7ADHA 2GA8A 5B6IA 5IAKA 5GGYA 1GU0A 1IBRA 3OFNA 3BE6A 4AS2A 4KQ9A 3A37A 3KYCA 4MUNA 3LY8A 2PJZA 5IC6A 1VPWA 3K0CA 5JNWA 3FMIA 2NSYA 1XX6A 3CA8A 1ZCBA 2H6EA 3QVOA 5AW3A 4KIWA 3CPEA 3WLOA 3C6BA 3LT4A 1G5PA 2XCIA 3WLJA 4BNUA 3H2YA 3M1YA 4LCEA 5DBOA 5DNAA 3BHNA 4HGOA 3FUUA 4KZKA 5COQA 1GYPA 2DBVO 4XX1A 4X64B 2XOKA 1L5HA 4DM4A 1GT6A 1WF6A 4D3FA 2ZB3A 3N8HA 4W6ZA 1FXSA 4B32A 4HN9A 4P83A 4C0SA 1T34A 4FYWA 3D31A 4JC0A 3TW4A 3PCXA 3RM3A 3AHDA 3CLHA 3GN1A 4FHFA 1T8UA 1WCIA 2CBXA 3WX0A 2V45A 4JBXA 1QYRA 5CLGA 3O03A 2ZUBA 3PP8A 3KHKA 2KPJA 1U0NA 4W1RA 4TTIA 3WIOA 2WJYA 1OPXA 4FN3A 2XDAA 1OJLA 1K5DA 2ILTA 3Q40A 2E87A 4GT1A 4GWKA 3SJBA 1QFZA 2Q0HA 1BA3A 4ZI7A 4ZQFA 3SZ3A 3HM2A 4R8LA 1WQ4A 3OIUA 3PTAA 4TKUA 4FMDB 3ULKA 4F4FA 4YUYA 5KU7A 1E99A 5JJKA 2BW0A 4S1PA 2GAIA 1BH6A 1X1QA 1YACA 2C84A 2OD7A 2FSUA 2P6MA 2HREA 2QP4A 2ZFUA 2QJRA 3DXXA 3GQBA 3N5CA 3DFFA 1OFVA 4QOSA 3BUSA 1YMUA 4JJIA 4YJFA 2WIFA 3VPSA 5ALDA 4PNHA 4BATA 4DHWA 3ZZUA 2QY9A 2XUQA 4PU7A 5AIAA 1ZCFA 3JVUA 3HJCA 3Q7IA 2IU0A 2KE5A 4XEUA 1ID8A 3RUCA 5BSFA 1RLOA 1YCDA 2PZAA 3PYLA 1QF9A 2DR2A 3CH4B 3EA0A 5ALOA 3FPHA 4ETIA 5B5SA 1WW2A 3ETNA 5IRCD 2WUSR 1HBJA 1PF7E 3DXFA 3TJRA 4Y3UA 5K8CA 1NQXA 2IEIA 3P52A 1ZIOA 4MCHA 4CMEA 3OQ6A 4CEJA 3DOEA 1SXIA 2V8OA 4AJIA 3X1ZA 2C2OA 3MN1A 3E9RA 4AZSA 2NXJA 2GJ8A 1YNSA 3O3NB 2AYXA 1M2OA 2O50A 3LQ4A 5AKIA 1JA0A 4CUKA 2NUAB 4XWKA 3PJRA 2PUBA 5GQSA 1YGYA 5AJZA 5AI4A 2MJLA 1U8YA 4NE2A 4HMPA 1H2HA 1YAJA 1OC4A 5IULC 1BA2A 4DPKA 2CVQA 2WYIA 1UQUA 1ZM9A 5B4VA 1A97A 3ICEA 3TCNA 4HGYA 2W2MA 3AM4A 3LPLA 1Y5RA 4S24A 4B8ZA 4LK3A 2AOVA 1L5NA 1MVOA 1FP2A 3BCHA 4D9GA 5IKMA 1CUSA 1YONA 4J3JA 4DILA 1CY2A 3ZNOA 4DDWA 2BJWA 2PIAA 4XDGA 4X4CA 2OCLA 2WR8A 3CLVA 1QKKA 4BLSA 4YCMA 1U3FA 2Q1TA 1CQPA 2HSJA 2OCDA 1US8A 3BAZA 1FBTA 2X4GA 2PTHA 2XUZA 1F0YA 2ZIXA 4EF4A 4ENTA 1UBFA 3E5RA 1BXRA 5AI6A 3GWZA 4M7PA 5LZ4A 2FNAA 3PK0A 1QDUA 1U2SA 1C8KA 3AY3A 3QWFA 5BQXA 5THXA 1RQ7A 2C92A 2JIZA 3MLEA 1RHKA 2WWTA 2YXPX 2XGMA 3ROMA 4OBWA 5C1DA 1JWLA 4YDSA 3ZZ1A 3BFXA 3O4RA 1VHJA 4CMHA 1KEUA 4J16A 2C5EA 4PHGA 4ZOBA 3P4YA 2NX2A 2XRMA 4J75A 3UCXA 3SCGA 2QUKA 3COZA 1L4FA 3SYTA 2GN2A 4AG6A 1G20B 3DDNA 4GM4A 2YDXA 5D8DA 5IZ4A 1PSZA 3VAYA 1J0CA 4W5JA 4W5TA 3S40A 1FMFA 1IPFA 3M9WA 4Y98A 3K5WA 4KGZA 2JKVA 3VH2A 2IYPA 2K4MA 1OROA 4PM4A 3H0KA 4JL5A 3LS2A 3T3HA 4QSHA 1IN6A 2LYLA 4A27A 1XK6A 5C8ZA 4X41A 3O83A 1JEEA 3IRUA 5HQ3A 4BQRA 1KIFA 3RYFB 2VJPA 5IDWA 4LZPA 2GCGA 1Q3TA 1U2DA 1T9GR 3BYZA 3HN6A 3I09A 3VNRA 3Q3IA 4DIOA 3WISA 4KMRA 4AMYA 4UARA 4U4AA 3R6DA 4QASA 4ZO7A 4KWTA 1T5DX 3ZG6A 1QIJA 8LDHA 4CIVA 4R05A 1TM5E 2PXXA 3PZBA 4YT2A 5GZ3A 5DWDA 2FN4A 5EJ6A 5FR2A 1PS8A 3GN5B 4R9NA 1Z4MA 1SCJA 1QP4A 2QE7D 2VK2A 4UHBA 2WVHA 1R9MA 1FMTA 1PO7A 2J5QA 2N75A 3V9PA 4BNWA 4CIWA 2Q3BA 1YB5A 4BRZA 1R9GA 2HA6A 4LRYA 4O2BB 1CRZA 3FMPB 4DLVA 4ZCRA 2PMBA 1FYVA 4D8TA 3C7TA 4RUKA 3HXTA 5EJIA 2VCEA 3QIVA 2Y1OA 1VKNA 3ZE6A 1J9GA 4X8MA 1YDFA 3LOQA 4Z3KA 1EFRD 1FFXB 4KO3S 4MS3A 4RZIA 4ARZB 4D9NA 3RYCA 4P38A 4FYYA 3TELA 1FLAA 2CNKA 2CMDA 3DWFA 4Y0NA 5EKDA 3SJCA 1BE6A 3CRZA 4CMEC 1GPH1 3QENA 4MOWA 1OUMA 3X1JA 4X7BA 2Q0SA 3TIGA 2RMKA 4UAUA 5C53B 1ONPA 2XUAA 2GA9A 3K70D 1A72A 3BTVA 4UHCA 2BUAA 1V96A 3ANSA 3EIUA 2QOEA 3SDBA 3PX2A 2RJ3A 2PFGA 4CL0A 4TL8A 4RBNA 4UTZA 1ND6A 1ZDMA 1FTYA 1LA2A 2BEWB 3MSXA 4UU1A 4ZA2A 1W5FA 1B14A 2GHIA 3L0OA 1R3DA 1X7GA 2IPXA 2OESA 1UDBA 2ON6A 1CF2O 1E2LA 2ZJ4A 2QUAA 3B9QA 1P5ZB 4LG1A 3CRMA 5EINA 2ZYTX 3DDCA 3U80A 1U2DC 4C0WA 2Z6UA 2Q9AA 4ESOA 4YDHB 1AE1A 1RM5A 2RBEA 2Y0PA 3VR6D 3H86A 1CS4C 4FVTA 4LXIA 4QHTA 2DRIA 4FDMA 4OQDA 3TUJC 3QW4B 1CZNA 4CTKA 4GL4A 4XARA 3HBMA 3NTRA 2B1IA 2FYTA 3P9XA 4LXHA 3TR6A 1L5FA 1V8FA 2HQRA 2CSXA 2G3YA 1GL7A 3KAQA 3NVAA 4B6QA 1K7FB 2XMSA 1TZMA 5CK4A 5ALRA 3LF2A 4UW9A 2TMKA 3H11A 4A8HA 3C41J 2G72A 1AHHA 1WA5A 1X8LA 5IEJA 2HQ1A 3ZC3A 3BQMB 2XB6A 4KE8A 2IV3A 4NCBA 2X8JA 1DDOA 3CLRC 2O05A 3PL1A 4HYYA 5I4KA 3IIMA 4P4NA 4UM7A 1HDYA 4BHTA 3K8YA 1NQVA 2DWUA 2P68A 3EG5A 3JQ9A 5DK6A 2HNKA 1LLDA 3HKBB 3RWOA 3D6VA 2E89A 1EVYA 4HH4A 1X87A 3ZV6A 3F6BX 1L7MA 5AKHA 1ORIA 3SQNA 3I73A 3O31A 5IPFA 3IT3A 4RGVA 4QUGA 3ICPA 4IICA 4BWYA 2VDWB 3TRJA 1AB6A 1UKEA 2CL0X 4LOLA 2HA2A 1O95D 4KFRA 2WQ6A 1N33B 4WASA 4P7FA 3SC4A 2ZZNA 2GBFA 4FYPA 3IQHX 2UZ0A 3DKVA 4DIKA 1WRBA 3IUJA 4EQ6A 1X2EA 1CEYA 3PQ6A 3M8KA 1QSGA 3TLBA 3WK7A 3WS7A 2X9GA 1DCFA 3K3PA 2H0AA 3TRFA 2UUBB 4L0QA 2J3JA 1M83A 1PSDA 1RYEA 3HU1A 5BSHA 3LKBA 5G02A 2O06A 3D5QA 5F3DA 5AWFC 4EG1A 1CZRA 1KFEB 3KC2A 3SEFA 3CB4A 1AK1A 1W30A 4G9EA 1N2ZA 5I4IA 4HAUA 4DRXB 4NXMB 3QOFA 5EQJB 3LMKA 1N2CA 3N7UA 3QVTA 4YWHA 4CQMD 3TGPA 2QGFA 4RVFA 3Q7QA 3GUUA 4XQEA 3UJNA 2J9ZB 3PQCA 3T3MB 2ZIFA 4DR1B 5IFLA 1SH7A 2I87A 1IBCA 1CYEA 1KBOA 3QF4B 3G7NA 4FFMA 2ILVA 5FD8A 1QP0A 3QLUC 2UUAB 2MDTA 3DFUA 3E9YA 2I2WA 3OJWA 1OWPA 1JIIA 4R2XA 1UXJA 1PVOA 2EF1A 5BV2P 1TPYA 2QLJA 1DKLA 2D62A 3HB1A 2W8ZA 3OT1A 2FK7A 3QYPA 5BR8B 4ZT7A 1I13A 3CLTD 3OLYA 3ICQB 4PFKA 3OCVA 1IJKA 1QVVA 3LF1A 5FBRB 4QYIA 1QMGA 4KG7A 4Q9IA 1U1IA 1E9SA 2QVZX 5E4JA 3WNCA 4BWVA 1NVMB 2WU0A 2QNIA 2DTEA 4D3ZA 2G80A 4QWWA 1Z75A 2GPYA 4H1HA 4Q6BA 1JR3A 3FTPA 3SGLA 2RGNA 4UU8A 3K35A 2QMOA 1F2TA 3SJAA 4CFYA 1D2NA 1NJFA 1TUEA 4X4EA 2DY0A 2Q7XA 9ATCA 2M6KA 3ROFA 4P4GA 4KDFA 3ZW8A 3GEMA 1AZSC 5TEWA 3HVKA 3QEBZ 3LFUA 3EA4A 2PA0A 3EISA 4NWIA 2QL5A 2NU8B 1ZMTA 9LDTA 3GOQA 1RHUA 2OV1A 3PQ8A 5L3SB 4Q4CA 1KU6A 1JVNA 2HLHA 3FWHA 4EO4A 2Q4OA 2QIPA 3O4JA 1IUPA 4U2EA 1W94A 2YMPA 5CJ2A 3W4IA 1Z82A 1NW4A 3GEGA 4RFVA 1NYLA 4BVHA 4J29A 4KYIB 2BFBB 4L8GA 4IGAA 2P5UA 4KR9A 3L6EA 3NHBA 3NWEA 4OK6A 3SPXA 3THOA 4X92A 3TEJA 3LA8A 1T5BA 2PLRA 2HIGA 4X1YB 2VC2B 3UK1A 4FFSA 2F8TA 2L18A 2W8BB 4GWGA 2EHDA 3LHKA 4NEGA 4HWTA 4Q9AA 2NU9A 5FRDA 4BGVA 1BN6A 3NEJA 4JQYA 1J1ZA 2W48A 4MVJD 4NF2A 2G1PA 4R7GA 2R6AA 2WQZA 5C1PA 3CVOA 1W93A 1YMQA 3MT9A 1PHPA 2D8AA 3PTLA 3SAJA 4UQOA 3V4PB 2FR1A 3UJDA 4Y2TA 3ZWBA 3KJFA 2YW2A 4HGQA 3W8EA 5FNVF 5KSPA 3ZTTA 4BB5A 5AKJA 1JPUA 3A2LA 3PENA 4EBFA 2ZS7A 3DTVD 3DE7X 2PMKA 3D6AA 4LMPA 5MFZA 3HCFA 1UT5A 2GAJA 3GG2A 2YNMD 2ZAYA 1DXQA 2B8JA 4FLFA 5GMOA 4X66B 3DL2A 1TD9A 5I7SA 4LHZA 2I4NA 2WP0A 3GFOA 3GMSA 3MEQA 3O4HA 4K05A 1JI3A 4O08A 4ZJZA 4BXOB 1Z7WA 4LJLA 3NKLA 1GPDG 3H9UA 1II8A 1KDOA 3A1VA 5B4UA 1Z5GA 2A7QA 2ZAMA 2B8NA 2VF8A 1KAQA 1C4KA 2ZCVA 2ZG6A 3H1EA 2BF4A 5J9FA 4AU1A 2ZJAA 3EBPA 1JFRA 5KOHB 2EW2A 1QZ3A 2CLSA 4WECA 1QYVA 1LW6E 2CNWA 3R6LA 3U4MA 3LLSA 2G7MC 2F59A 1K3UB 1XGKA 2M1ZA 3K9CA 3AVQA 4J07A 3T3EA 3VR5H 1NZDA 1GNQA 1I32A 4P35A 1UC9A 2Q99A 3OZVA 1TUBB 2VA9A 2OUIA 2CB0A 3Q6NA 4GZMA 4LXXA 4ENSA 4MKFA 5JEDA 4NMLA 2ASVA 2I1VB 3DZKA 5CXXA 1EUZA 2V7UA 1DMRA 1OF1A 2GEUA 4BLPA 3QVUA 3AIMA 3IAEA 4P86A 4X93A 2BTEA 2IWHA 5G1PA 4JXJA 4CG3A 4V24A 1EXDA 5FB3A 5HMLA 4N0PA 1JALA 2HSGA 1E7YA 1VPDA 2BH9A 2Q3FA 1HF3A 2J3KA 3HCAA 4F93B 1XRLA 4KB5A 4B6RA 1T9CA 2HO4A 3RSGA 2BM0A 4GX2A 1H4VB 1GLNA 1N7JA 2GKOA 2ZITA 3FTDA 4S1OA 4YP7A 4CI0B 1P75A 4LHWA 4RPLA 3NOOA 5FBWB 4V0SA 1SVLA 2JIBA 3L8EA 5BQPA 2IBMA 2YJNA 3CONA 2I8LA 2QQGA 2XX3A 3MSCA 4G4IA 4C5AA 1L1EA 3I6QA 5K01A 4P7KA 3HKEA 4H1TA 1N0WA 4WHMA 2XDQB 1NNEA 2I4LA 4I3HA 4WLEA 3X2EA 3E0XA 3BE5A 1XP5A 3PEUA 4HMOA 2J0UA 3RRMA 5HZGA 5JNVA 1E4VA 1E60A 1I2MA 1HMPA 4GICA 1HQ1A 1QQ5A 5EC8A 3VR4D 1WTCA 1XZPA 4I08A 3N2YA 1FYFA 3EUSA 5CFRA 5MGNA 4JX8A 4IEFB 1NJ8A 4RHFA 4CUZA 2ZQYA 1U94A 2VHWA 5A05A 1KVQA 1R5NA 4H7EA 5CIWA 1T3HA 1VECA 3CLTC 3EW7A 2Q4DA 3UJ9A 1BX0A 1QRTA 5AVKA 3JR3A 1ZUNB 4AN1A 4JELA 4N82A 4KL8S 5K3SA 2JFPA 2VLIA 1X70A 2JAOA 3JATA 4L76A 3OH8A 3DMNA 2JIZD 4HRYA 4CQLB 5DWQA 1NRXA 4QOJA 1HF0A 5LBUA 4OUDA 3NVMB 1AS2A 2Q1UA 1RYZA 2D7DA 3TLGA 3TTVA 5CLLA 4RXUA 3I1FA 2HRDA 3DDSA 3T3NA 1G3RA 5L7WA 1H94A 4MCIA 3AP1A 1ULUA 1X8KA 4TRJA 3T9BA 3NI2A 3HM9A 1XXLA 2A3NA 3L0YA 3V4FA 3GLFA 4F92B 3ZV4A 1DCTA 4I14A 4IOMA 3ZDBA 1XZGA 4FYHA 2AG8A 4LYAA 1FFEA 4EMSA 2R6R1 1YO6A 2BZSA 1K7YA 1UXIA 1YE5A 2OWDA 2Y4NA 4Q9KA 3RVPA 3T15A 3OG9A 1SWWA 5AK4A 2WJHA 3B1YA 4DNXA 4EVIA 3IT0A 4OHYA 1ENZA 3KFXA 5ES4B 4OHWA 2GO1A 1GL3A 2VJBA 2O3TA 4WKPA 4ZOAA 3RGGA 1V4VA 2WSBA 4BNXA 3EFOB 4V2IA 6CHYA 4PZDA 4EGQA 5IXYA 2NVOA 5DEIA 2GZUA 1G8YA 2GSWA 3P0FA 1UAGA 1YIDA 3LGAA 3AQ4A 4GOXA 2OCGA 5AESA 5HFAA 3CVYA 4KRFA 2EJWA 2VL7A 4BKOA 4NZ9A 4EHHA 1D03A 3BMXA 2R8YA 4A91A 4CYMA 3U3JA 1EP2B 2Z5FA 1YQUA 1W44A 4MARA 2R8ZA 2MINA 3N0RA 5B58C 1Z5UA 1W59A 2GCPA 2WTEA 3DOCA 4ID3A 1SU4A 2C59A 4FFBA 1M6VA 1A88A 1T9ZA 3DBIA 2ZIXB 4ZYVA 3KYDA 5ANRB 3OWXA 2AOXA 2WSLA 4F4UA 4Y1EA 3EGDB 2AWIA 4MJ3A 7YASA 1OB2A 3BFKA 1EVLA 4OB8A 1JEQA 3TMKA 3W5CA 2W7TA 3SX4A 3QUAA 4P58A 4E5YA 3PS9A 1IRXA 4JK3A 4Z5HA 1KZ7B 4MUIA 4KODA 1RZRD 3VJRA 1X3LA 2O5VA 4OQ4A 1RP1A 4HPWA 2AEFA 1OTXA 3BEDA 5CNMA 3VSCA 1DHTA 1WU8A 1Q19A 2QUJA 3D6JA 4RWZA 1FC0A 4ZU1X 3W2TA 4EJ2A 3UAOA 3KT8A 3HXMA 1FFYA 3U3KA 2Z43A 1DJQA 4B40A 4D6YA 2G5CA 4U7GA 2CK3A 3GQVA 3WLRA 2Y4OA 1IATA 3LPMA 2QAGC 1T2FA 3DO5A 3QFHA 1H1DA 4G6ZA 2SKCA 3WYAA 3LC0A 3UTCA 3SCFA 4EVRA 1CR1A 1WS6A 1G18A 1PFUA 3FBGA 3VGJA 3MBKA 1JHRA 2MYPA 3AR6A 3NB0A 5G1OA 1BXGB 1ST2A 1P0MA 2CVPA 3W5IA 2C2MA 3KWMA 4NJMB 3EFHA 3JSXA 4XH9B 1NWHA 1PR2A 2GWRA 4HQRA 1EVKA 3RVJA 2IODA 4NHOA 3RYFA 2C7OA 3FMYA 1PT5A 1CUJA 3MJDA 4NI5A 3I9NA 3VO2A 1SXQA 1QE0A 1HG1A 1NNLA 1VE9A 3A4LA 3DNVB 3D81A 1P0PA 1W4AA 1BVUA 3DVAB 4G1EB 4AJNA 1O0CA 1Q1BA 2YMLA 4HZIA 3W6OA 1YR7A 3OPXA 3R23A 4CN9A 3AL0C 4BFWA 5IUJC 4B7ZA 1GTZA 4JWTA 2LCVA 1E3OC 2DBYA 2IIVA 5CDFA 3RIYA 4O29A 2W2XA 1QYIA 3ENNA 2PXQA 3INYA 2WF9A 2FLKA 1MAUA 1W35A 2A2ZA 4P9NA 3QPWA 2EFYA 4RKEA 1R88A 2CN1A 2GASA 4EPVA 4MW0A 3NATA 3CWQA 2IU4A 1OT5A 2Y99A 4QQ8A 4S1VA 2E9SA 4GEGA 4N5LA 2HO5A 4CDGA 3LVQE 1G5IA 3L9WA 4YJDA 1WD7A 1G3IA 3C3AA 3ZJVA 4JQOA 4I50A 1KXZA 1KEKA 3G0IA 3MWJA 2AG5A 1I51A 1Z68A 4G86A 4LRTB 3VU0A 2X0FA 3AFMA 1DBPA 1F1JA 4OGKA 4KQ6A 5DNYB 3NXSA 5AM1A 2RGEA 2YYSA 5LNK1 5EIAA 1H0HA 2J09A 1AXGA 2N46A 4IIJA 2EZUA 1XQ9A 3LBFA 5E6RB 3TLXA 3K0FA 2GNOA 3VNQA 4D79A 3G5UA 2XCTB 3H6GA 1DL5A 3RSQA 3W4JA 4Z6KA 1KTVA 4G36A 4LCBA 3BK1A 4ND5A 2I34A 1RI4A 3MMZA 5D87A 3TBKA 4N0EA 3QVJA 5JXGA 3BB1A 2GPJA 1Y6GA 4B76A 3A9TA 4UASA 1X80B 1R0YA 3DMTC 1GTG1 3UH1A 3AEUB 1GAQA 2CXSA 1SRRA 5K20A 5EUBA 2UUCB 4EG7A 4DQ0A 3JQFC 3H3JA 3AW8A 1UBUS 1AT1A 1D2AA 2CL6X 3BPSA 1BOOA 1ZEJA 3KJQA 3L8FA 3P0JA 1VMKA 4J1SA 3VX3A 3S2EA 2A5DA 2NZUG 1C8LA 4UJ5A 1C0LA 4MYUA 2NV2B 3O9XA 3KDSE 4FE4A 2PLAA 1BE8A 2NUTA 2FG5A 1K06A 3EBLA 2J5RA 1UODA 3OWHA 4K9DA 3LP5A 3VR6A 4Q4LA 2VHQA 3KXIA 3FDJA 4B3FX 2IZ1A 2OAQ1 1F8XA 4RTJA 3KXDA 5C8XA 4H59A 3BDNA 1EVIA 1XDBA 2ZRAA 1U81A 2IDKA 4LF6B 2LYRA 2ZYAA 3WKCA 3D7KA 4XSGA 5DCWA 3AJDA 3QJYA 4WNYA 4H17A 5E3JA 4BMSA 5KJ6A 4RGYA 3UMRA 1USVA 2EJVA 1II0A 2QM7A 4HDOB 4ZODA 3M6FA 4OHMA 2H08A 2QQ0A 3LWBA 3SZOA 2IOFA 3JVIA 3LJKA 4LXQA 3UUFA 2RGRA 3M81A 4YHHB 2H92A 4MRNA 3QQ5A 3FHCB 3HVIA 4OOEA 5C4GB 3NRCA 3EXIA 4JZKA 3I01A 1PFVA 4NENB 1BH2A 3L1IA 4TLDA 2NV6A 1PNRA 4PWZA 5KQSA 3HRIA 1XDUA 1IBKB 1DFIA 1SBHA 3MCTA 4LI0A 4L8WB 4PY2A 5KDOA 1X9GA 2GKGA 1OGYA 2R4TA 2X86A 3F2IA 4Y2PA 5AXDA 4KDEA 3ZHUA 5C3MA 4KQKA 1T6ZA 1RYYA 2ICPA 3B1VA 3GYBA 4TSRA 1K8XB 2BLLA 4R81A 3MWDB 5JO0A 2J6HA 1U3GA 2GTPA 2P77A 3OLCX 4WV3A 1QLHA 2YXBA 1TQ2A 3AO0B 4ER7A 2G5PA 2QR5A 3G2IA 2VUSA 3TB6A 5JAOA 2ZVQX 4LYYA 4JR2A 1CQIA 3UK7A 2PXUA 4E03A 1B16A 1H65A 1ZP6A 1VJGA 4UM5A 1JMVA 1MR3F 1X7WA 4TTQA 3B3GA 4Q21A 2Q9CA 4Y0AA 5ECYA 5B1DA 1FXWF 3S28A 3VZDA 5AHXA 3M83A 4MLPA 4CGZA 3CCCA 3KZXA 4Y2QA 2ASEA 4MR7B 5DYIA 4MZDA 3COVA 1D8TA 4DBVO 1MEEA 2QXTA 3SXUA 1J0BA 1NVFA 4Y2YA 2FZWA 2WJ6A 4MUGA 4DSAA 3QE9Y 4BGEA 2FEXA 4O3MA 3D4LA 1ZFNA 5DSZA 3KU4A 3CCFA 5IBRA 1JQLB 2FWMX 2O2ZA 1ORVA 1HMYA 3I5UA 5FOXA 4F4JA 2QS9A 5JQWA 1U99A 3BWEA 5HKAA 2VQ6A 2AXNA 1KNXA 4QBFA 2QNBA 4WLUA 1TC1A 3AEYA 5JPIA 4OOFA 1UBEA 2KB0A 3ZHZA 1BJKA 2CXTA 3VR0A 1H93A 2Q3HA 1G8FA 4Z9XA 2DQZA 3GARA 3N39C 4JU8A 3KSZO 2R79A 1QIMA 4LQCA 1VL8A 2JHPA 3IUQA 4O5OA 1RWBA 3PWZA 3QI2A 1JXMA 1PZMA 5J2UB 4JBHA 3FR7A 1W0KD 2NYVA 1U8FO 1JHMA 2E85A 3EEYA 1HK7A 4NP6A 4Q4HA 2QP3A 1LK0A 3WQHA 4A0HA 1VM6A 5ALPA 1P44A 2B4AA 3RK0A 1E1LA 1FSFA 1VKZA 2Q28A 2R4UA 4NX2A 2VNJA 4CEHB 1O0SA 1VLHA 4JR1A 4XD2A 1EWRA 4R1NA 4YXWD 1LC3A 4NDZA 4DA0A 1GGHA 1B41A 3RUAA 4IM7A 2PXBA 3W2HA 5EHQA 3ZIAA 1YR9A 4FFVA 5DNDA 3FFAA 1JIUA 1BSVA 2TS1A 3I04A 4AS3A 5IVPA 3LOUA 3EASA 2OLEA 3U0VA 4DSOA 2KX7A 1I14A 4X6LA 4IDGA 4G24A 5ITSA 1K66A 1LRJA 5C8YB 1NLUA 1VQ1A 1YS2X 3BF7A 1D1PA 3RUDA 4B85A 2E5WA 3JW8A 3GJ4A 1F5NA 3KTAB 3ROKA 3TZQA 4C04A 2TRSB 3NGMA 2FJPA 4L2IB 2GHTA 4GEKA 1J00A 1KJIA 4WY8A 2XYGA 4UNQA 5A9TA 3RTAA 1AO0A 5DN6A 1QFXA 2HEIA 3JQGB 4YEDA 1Z28A 5GINE 1DIBA 4RSMA 5IXSA 4G1FA 2X8WA 4D8VA 4DJDC 1CIVA 5HUHA 1TQ6A 3G2KA 2CGEA 4KK3A 4PF1A 2YNMA 1UWKA 3A4YA 4CV0A 4AI6A 4HN4B 1JB1A 5DULA 3NG1A 1M2OB 2QENA 2X9VA 3CKKA 3RVQA 3AI1A 3VOTA 4EA6A 3L82B 2CMKA 2CJWA 2W2TA 4NSNA 4PG8A 1PLLA 5MFPA 2QTWB 3KSBC 1AU9A 3BXHA 4Q1AA 1ISRA 2LNMA 2IL1A 3QX7A 5IJZA 4OV6B 4AVYA 1OFTA 1E9AA 5DH9A 4M89A 3V8VA 3X43A 4BC0A 3AW9A 1EA7A 3GI1A 2PL9A 1QB8A 1UJMA 2QD3A 3NC4A 4I6UA 3PUZA 1KGDA 1XNHA 4L51A 4JFRA 2JLXA 1YSEA 4LDJA 2J5XA 1OMOA 5CCXA 2CV0A 2HINA 3E81A 4MRPA 1W0CA 2CVOA 2VIIA 3LU1A 1QP7A 1H2AS 1CUFA 3CLKA 5LXTF 3P19A 4OQLA 5P21A 1Y3BE 3AP2A 2WUVA 1XAGA 3IILA 4HV4A 3KG2A 2IEAA 1ENOA 1XTKA 1ZPDA 2FPSA 2DAPA 3HCOA 3ZE1B 3UBTA 2IY7A 1TZ2A 1X9IA 2PUAA 2IE8A 2VPPA 3LUPA 4KR0A 3HFJA 2HA4A 3BBPA 4II7A 4PFSA 2R60A 4UTXA 5J2TB 4Z9BA 2VP4A 1KZGB 4BZXA 1WXHA 2WDPA 3R0JA 4GXTA 1PX0A 4JEHA 4D0LB 1NATA 4B84A 1BJTA 2PY6A 1NUPA 2I4IA 2A1TS 4C7MA 2HYIC 1HQYE 2XAUA 1X1AA 4ZVVA 3ORYA 4E2WA 4N5DA 4MVJM 3TDKA 3OX3A 2YWXA 5CVEA 5CXQA 1TEZA 3VZQA 1BFDA 2CNBA 4EENA 1WDTA 3U7RA 3IJ5A 4WFJA 1SHJA 3X44A 3U19A 3C8DA 2XOKD 2JVJA 2WJGA 4TYYA 3DP9A 5ALWA 1E9VA 3ZV3A 2Q49A 1JT2A 1LB1B 2M98A 4ND3A 4UCFA 2DFKB 1TTHA 2C1XA 2O23A 2Q6VA 5HIJA 1SY7A 1ZONA 3DC7A 3S0JA 4JROA 2JLVA 1MTZA 2NACA 3T7EA 6ABPA 2AF4C 4PO8A 1ORDA 3PFIA 4IFEA 4MMYB 3GBPA 2B4YA 3PG5A 3Q3EA 2NUAA 5ECGC 4EGAA 3A6GA 1GPBA 3QNMA 5KQLA 2HK7A 3P9YA 5CT9A 1EFKA 1L5SA 3EPRA 2Y76A 4E6PA 1DQPA 1OHHA 3E6AA 3FH0A 3QKWA 5TDHA 4PU3C 4I9GA 2J31A 3HYLA 4QWMA 1UKCA 2DEUA 1FSGA 5T3UA 3E1KA 1BHSA 1L4GA 4FE3A 4OYRA 1CF4A 1R0SA 3UN1A 1A7KA 1O8BA 1O97D 1T29A 4NJEB 4AYWA 2C20A 3W5VA 2C2KA 1KAHA 1A1VA 2EW8A 4Y2RA 5KREA 4IOLA 1E6MA 4NK5A 4JWKA 4BVFA 1I2CA 4RYLA 5T8KA 3ZBUA 4C29A 4Z8XA 1E1MA 1JR3E 4NCHA 1US8B 1BEUB 1E20A 1YDHA 1L4MA 3PUYA 2BBTA 2N47A 1G8JA 3OEWA 5TT0A 4JQCA 1TK2A 1DAPA 1X13A 1CS0A 4BLVA 2P90A 1D6NA 3FNFA 4YHBA 4XI9A 5LWHA 2GZRA 4UATA 4MV0A 1W2GA 2PYDA 4C22A 3H4TA 1G60A 1D4OA 1ZYUA 2BGNA 4UDXX 1AGRA 3K9FC 2PD4A 5ALHA 1RJGA 2DKNA 1J8YF 2BFCB 2R6JA 2WE8A 2FPGB 2ZBQA 3FR8A 3MT7A 5CEEA 2Z6VA 3DB2A 5H59A 4AT1A 2XYVA 1V45E 1IHXA 1Q1GA 4NJOA 1ZK2A 4Q9LA 2IYYA 3EF0A 4FYJA 5F9MA 2FZGA 3RVNA 4EYGA 5CDUA 1HFWA 1K5GA 3FRJA 4OA8A 1LPNA 5GJBA 3JD4A 3WFIA 4CMGA 1WTAA 4ETNA 4O2BF 5IVHA 4KE9A 2GH1A 4B3SB 2LVBA 3NR2A 4A1FA 5LQRA 1B93A 1NW3A 1XZJA 2NYUA 2GNPA 2G8LA 2IV7A 2FN7A 2PNFA 4N3CA 4BE9A 5A9RA 4YI3A 2EBYA 3ZXYA 1FTQA 4JFAA 2W6NA 5D7BA 4YRPA 2B8EA 2IK8A 3KNZA 1GU1A 4HLUA 4JSTA 1IMJA 5SYMA 3TCKA 3ZKAA 2R63A 4PZPA 4LMAA 1P73A 1ML4A 5K4AA 4XTCS 5K3DA 4NV3A 4P36A 1TIBA 3ND8A 4JOSA 5CRIA 5DMXA 1J2EA 1RJDA 1ILEA 4W8GA 1UXDA 2D1YA 5DEOA 3E7WA 1OFUA 2WF8A 1PZHA 3BSYA 4CKCB 4EATA 4KSBA 1A8IA 1IZYA 2CNNA 1T2AA 4QYTA 2I7VA 5EHIA 5KTSA 2G70A 3IAS6 4RA9A 1PR5A 1TMYA 4H3HB 3UG7A 3LA6A 3QKIA 5EWJA 4C3OB 3L1PA 3MTAA 2IY9A 2X0RA 4G1MB 4A0FA 3Q3HA 1M1ZA 2P7HA 5T4EA 1XA0A 3N86A 1A95A 1E2BA 3SFZA 2FY8A 3A4TA 4BO2A 3EWSA 2H2WA 2BKEA 2C42A 2WG1A 4P7BA 4EKGA 1QPBA 2IF2A 3BGDA 1GL9B 2F1KA 4LZJA 4GC5A 4MI9A 4WMLA 2DB3A 2PZMA 4X7MA 1IG0A 1NQWA 4KK4A 3O92A 4JLVA 4ZDIA 4M1KA 1U04A 4NMXB 5T6BA 1WH6A 3DMFA 3SEZA 1YFJA 4QOHA 4BU0A 5EE1A 4G1BA 2FSHA 4ER0A 1UJ5A 4YUAA 2YYZA 1F3OA 1P3Y1 3LPAA 4IYJA 3TIVA 1XLTA 4EFLA 4QU5A 4US2R 2CUNA 4IHJF 4QOIA 4L7QA 5LPNA 4HVAA 3UPUA 1SHTX 1YS6A 1SOVA 1B15A 3IULA 2WJVA 5DYWA 2A5YB 1V5IA 2BEWA 2ZI9A 4H7FA 5C81A 1I4LD 3EFEA 4MUHA 2WBLC 3JQBC 1E92A 1UMBA 4CQJA 3GD7A 3K1JA 1CEXA 1CJBA 4GZ5A 4RULA 2A0WA 2V6MA 1J70A 4PZYA 1QE3A 2I8AA 3UHAA 1A9TA 1N5IA 1UOPA 1Z6TA 4ESVA 3HO6A 3ZE8A 4XFDA 1J21A 3R8CA 1ZAYA 2A5JA 2FF5A 4KGVA 4PXSA 2AQIA 5IYZA 1EFCA 1EFRA 5F23A 4HLUC 1GPKA 3F1LA 1S2NA 4C4OA 4DJ5X 4DF3A 3H11B 1Z33A 2Y0BA 1ADRA 2AFHB 2WUEA 3DH0A 1IVNA 1FCJA 4JQDA 1PGOA 4R69A 1RNLA 1LCCA 4BV2A 1AC5A 1KZYC 1N8KA 1QIIA 2PSEA 4G3XA 1KZ1A 2JGLA 2I5PO 4LWQA 4P33A 3B2NA 3HY6A 2IA5A 4RSGA 3L7CA 4A2QA 5KTNA 1F12A 4CU5A 4R6WA 4KMOA 1Z4PX 1O97C 5EJEA 3BULA 4WCFB 2H7XA 3MB8A 4M8LA 1P17A 3QKSA 1P7CA 1Z0AA 3NONA 2IHZA 1ZESA 2J4CA 3D0QA 1KIAA 3QU2A 4Q39A 5IS2A 1RWPA 2Z4SA 4G63A 1QQTA 3HSYA 1WHSB 4JCXA 1JR4A 4V0LA 4XCQA 2NU8A 1MN6A 1O4VA 5J2UF 1JSZA 3EXG2 3MB5A 3NP7A 1YU6A 1V5GA 2OQRA 5GJVC 1M74A 3NBKA 4ZC8A 4HHEA 3T1VA 3TOCA 1K08A 1VE5A 2XB9A 1T2CA 1HYEA 3H4VA 2FWPA 4OYYA 2WM3A 3ZGVA 4BPRA 1P1HA 1I7NA 1PEAA 3A9RA 3VX4A 3PDWA 4GGMX 2YWGA 2E0IA 3NAQA 1J2UA 2H59A 3AG5A 3R3ZA 4GMFA 3AEXA 4J6EA 3UGKA 3VSEA 4IJQA 1M67A 3D3EA 3FPKA 3LY5A 4YUZA 2VYNA 2W6JA 4QBHA 5M2QA 4Z53A 1Z35A 4H7HA 5JJCA 1HETA 2GJAA 2SKDA 4ND1A 2NO4A 2PMFA 3FHLA 4CCWA 3RYHB 3URMA 5A4DA 5LIPA 4C4ZA 1U9IC 3KZ1E 4GS5A 3SYNA 3WIUA 3LWZA 3QLVC 3IDZA 1WB6A 1Q7EA 4W1SA 3ZUGA 1G9SA 3L8GA 4D6PA 2JL1A 5H7XA 4ARVA 1WWKA 1OA0A 2G1AA 4Q9DA 1EQ2A 3ND9A 1ZOLA 4JEUA 3H7IA 4YQEA 3U49A 4JJ7A 5KNDA 1M2FA 2FHSA 2ZJ5A 2I80A 5FWAA 1C1DB 1XOIA 4GD3Q 3C7CB 3OA2A 4CLOB 2QMYA 5CX4A 1NYRA 4B0OA 3CEJA 4ND8B 3OT1B 3OLVA 4PG6A 3F90A 4PGAA 2G9ZA 5B3LA 5BYBA 1JJFA 3U44A 4CMKA 1DOAA 1BS1A 2LUOA 3CLSD 2DLCX 1E61A 2XUKA 1I3CA 3E03A 2GBLC 3FCAA 3N05A 3RAFC 2RBGA 4HEJA 4RV9A 5DX1A 4AP9A 5C9ZA 4DR7B 4K6KA 1QWOA 3K2QA 4UEQA 2JFHA 2QTGA 3R4VA 1Z0UA 1RR6A 4TTAA 2ENUA 2R751 1SJ9A 4PG7A 3UT0A 3MOSA 1EX9A 2I1WA 4YO8A 3R8FA 5A6VA 5LKAA 3IV9A 4F9TA 4EMBA 1EUQA 4UOZA 4IA8A 1KAGA 1SZDA 2Y93A 1X94A 4LNAA 3PUVA 5D3KA 3RC1A 4XWGA 3SBOA 4R5MA 4CQMA 2A4KA 4EB8A 3B8EA 1ZM2A 2QN2A 2GZSA 1WY7A 1ADFA 2P2DA 1DDIA 4QOFA 1GTSA 3IUNA 3FROA 4KIFA 4I55F 2BHTA 3ABQB 3ZXXA 5LQAA 2GFIA 5I6DA 3UHJA 4UFNA 1RD4A 3LGXA 3RVBA 4ZRDA 1UJ2A 2EXXA 3GMTA 5I9BA 3VU3A 1WBJB 1PU2A 4GH5A 3B1XA 1VLQA 5LP6F 1E3MA 1M8FA 4OKSA 3UW3A 4RKWA 3O7WA 4K2AA 4DG5A 1YHYA 3ZLJA 2ZSUA 4DV2B 4X1YA 1LDMA 1MCZA 3EUWA 3EWAA 4LPKA 3KU1A 3VRHA 5BW6B 2FQQA 3M6VA 1O7JA 2WWRA 4DC1A 2KLHA 1USKA 1Y1TA 3B3JA 2X8AA 3LBNA 4N7MA 5F77A 4K8RB 2ZSJA 2X42A 4GHWA 8MHTA 3L02A 1DSSG 3AGPA 3OJOA 2XJ3A 2CVZA 4FBIA 3HKEB 3ITNA 4M7RA 5KNCD 4LHYA 2F8SA 3DV0B 2C77A 3GAAA 4AW9A 5HM6A 4FHCA 3WYNA 3QEKA 5CB8A 5JY6A 1GFSA 1PUJA 1VG0B 3GLHB 4C2AA 1UK9A 221PA 3ICVA 3CNEA 1QH8A 4ENPA 3FSJX 5K6AC 5TGTA 5BP7A 2ARKA 2B4QA 3I72A 2WJPA 3QA3E 2O49A 1DIAA 2QQEA 4BN4A 4IG4A 5CR9A 2K7ZA 3LE8A 2HU2A 5IVKA 2VQDA 5BSEA 5LSAA 1YVUA 5LNK6 5TX7A 1O89A 3A1WA 3MAJA 1Z0ZA 1JJ7A 2C1EA 2ZYIA 4LNHA 1GTRA 4ROSA 2NU7A 1PV4A 4CWAA 3BILA 1EIWA 4CQLA 1WDMA 5KKNB 2YHIA 1F6WA 4LV6A 2A30A 2FUG6 4RIEA 1WCXA 3SSMA 4L16A 1TADA 5JS8A 1N92A 1VHWA 1J5PA 1Y0BA 1NA5A 2HPVA 1E63A 4FKMA 5DYTA 4B3CA 1YRBA 4WFIA 4IDHA 4A36A 5TF4A 1VP3A 1YBFA 2XGJA 4F84A 3TQTA 3WGQA 2QM0A 1B0UA 3UFDA 1NIPA 1G63A 3FUTA 3GLVA 4HUQA 2AUNA 4MK4A 1A4XA 2JIOA 3LRXA 4JLDA 4BV3A 1WETA 1U4NA 2R65A 4PRZA 3W8FA 2CT8A 2OM2A 4MWSA 2ORVA 2CF6A 3EHDA 5FI5A 4CTNA 2ZB7A 5AKLA 5HJEA 4DTIA 4WOCA 1PG0A 1AIPA 3ST7A 1VKRA 1ACJA 1CR0A 2PEYA 1S0UA 2B83A 1NI4A 1E6EA 1P61B 1UINA 3EFOA 4TSFA 4XB2A 3T4XA 1L8OA 4BKMA 4JLOA 1IWOA 3QV2A 2ZUTA 3WYGA 3Q72A 1BROA 2CXQA 5HUQA 1OW3B 2FMHA 2FR0A 3Q4GA 3U39A 3ZHOA 1UCFA 2PCJA 2VVTA 2X5NA 4FXOA 4OD0A 3T3OA 2O8BB 1Y7TA 4JSYA 3Q9NA 1C81A 3VYVA 2V7BA 2WIGA 3G7UA 4JY7A 4DNPA 2FSIA 5IASA 1ODSA 1Y5IA 3O3OB 5EESA 1GNRA 1IHUA 4YMSA 4DAEA 2E6UX 1UBGA 3HBLA 1QUEA 5LOVB 1IYZA 1M6VB 3IOMA 4NH0A 3B6IA 2P62A 3CRVA 4NCKA 5K8LA 3MAGA 2CD7A 1TE2A 4ZXPA 3EC1A 3WSTA 1OI7A 1E4EA 2RGGA 4NBUA 5IM4F 4F3TA 2FU5C 4A23A 2OO3A 1XE3A 3NOXA 3RROA 1JFFB 3UV7A 4K9OA 4RD1A 4CU2A 3WGHA 3DCYA 4X1OA 3KZKA 1SKMA 1KFCB 4AKHA 3OX1A 2H5JA 2PRIA 2X19A 3HDGA 3UMCA 3QE4A 1EP1B 4Y9RA 3OPYA 4NYMQ 3D7MA 4OQEA 3I3SR 4LJ6A 2B4TO 5C1OA 1PVVA 1DAMA 2E18A 3AKEA 1O5OA 3HYRA 4MWZA 4TLAA 1Z6ZA 2BFMA 3L6OO 5F7OA 2BVNA 1PAUA 2HA7A 3I6MA 3JALB 1VJ5A 4J0CA 4LFBB 3I45A 3GAMA 2QV0A 4KWHA 1SXJB 1E5VA 3UYLA 2B1RA 2Z4TA 4XFJA 3AKDA 4KO2S 4JC5A 4OL0A 4KRYA 2HCJB 4W4TA 5TGDA 2APJA 3QHQA 1KI6B 3A2MA 4I4NA 1BEZA 4YJGA 2QTLA 4NV1A 1QB2A 3T6KA 2OG2A 4GECA 5AJYA 3W6UA 1PFQA 1T1EA 4ILKA 2VPIA 4IDQA 5DBGA 2GFQA 1GUYA 2H5LA 2JAXA 3C5WP 5ITZB 3V46A 2ES4A 2VJQA 1RYMA 3ZWPA 1KI9A 5G1NA 1OLXA 3UYKA 1TT7A 4LECA 1DBWA 4TRMA 1GFWA 3W05A 2XECA 4IV0A 3MLAA 2YV5A 4OBEA 4KXLA 5ALZA 2FSVA 3IKLA 5KDLA 1E1QA 3SR4A 2QL7A 5CX1A 3EZXA 4RTLA 1RFGE 4NICA 4X95A 5KSOA 1JEYA 3RVKA 1U3TA 3JQAD 4Q47A 4R1OA 1YQEA 3PVCA 3OQOA 3JVDA 5CTAA 3GLIE 1E9EA 4RSRA 1QHYA 2OKGA 2F3PA 5AVJA 1Z5OA 1S8OA 3IAXA 4JI1B 1UFRA 2YXLA 5T3YA 1RC0A 4LTNA 3VKWA 2ZB8A 1UOOA 3ZHCA 2UVQA 2ZU0C 1E3IA 2WDZA 4YPFA 2WA2A 4MGZR 2H17A 5H82A 3WWDA 5DM60 5B3JC 1OE0A 1NBAA 3KR2A 2ZKLA 3ACCA 4LE0A 4QFDA 2ZUFA 2P3SA 1J0AA 1LSSA 1ES9A 1ORWA 3BMCB 3IMEA 4O1IA 2RC6A 1XEFA 3CNLA 4C05A 1DKMA 1NGSA 2ZRGA 4WN9B 2C0PA 5J5VA 2AC2A 5CU7A 2I2DA 1XMVA 1AKYA 1Y9EA 2D59A 4JOCA 1KNQA 3JS5A 1PN3A 3ETDA 4DCPA 2ZBRA 5JSZB 2QXUA 1TJPB 1MFZA 4BNYA 5DK4A 4I4CA 3B6JA 2A1TR 4LXUA 4A2CA 5A0TA 1H0SA 5BPFA 1CZOA 1H1LB 1EJ6A 2NSHA 2OZVA 1PI3A 3DLPX 4HEQA 4IWXA 5G2OA 4Q5IA 5GP1A 4AG3A 1ZCAA 2BDTA 2F9FA 4DL9A 1EX6A 2R8OA 1U0OC 3ELWA 1PQUA 3L0DA 2FPIB 1QMPA 1O08A 1Y1RA 4GMKA 2G9VA 3NAGA 4Q4JA 4ISBA 3KSMA 1THGA 2UUPA 3GH3A 4R40A 1KI7A 1E7MA 1XL0A 3VPDA 5JAMA 2LYQA 2QHXA 2R4QA 4ZQGA 5K51A 1S2MA 2OPHA 3I8XA 3PGLA 4D6XA 1AQIA 1P2FA 4Z2YA 1G4AE 1N1GA 3ASYA 2QRJA 2BCEA 2DCUA 1GFIA 2GKSA 1KK0A 1QV6A 4Y7DA 1AA9A 5JYBA 4DJJA 3HEBA 3I0MA 3NT2A 1FU7A 3H2KA 1NVAA 4CKCA 3VU9A 4HNSA 4XJSA 2XT9A 2AN4A 1PQPA 1ZI9A 1P2UA 1V25A 4GU5A 4HN2A 4TQUS 1M2GA 2WT9A 4FZVA 1ZRSA 2XNCA 2HJSA 2JLCA 4UAJA 3TL3A 3AR5A 4D4MA 3AXTA 1C0KA 2OG1A 3NEPX 4H4CA 4I81A 1JU3A 1U7DA 1YCGA 3HKDA 4M9SA 4YRDA 1GYRA 3O8RA 4FJ0A 1XTRA 3ENVA 4JT8A 4I1PA 2A9RA 3G5AA 3WHIA 3SX2A 4IVRA 4W9RA 1POXA 3SSNA 1YZTA 2AW6A 4B6FA 3ML1A 4MKRA 3BFPA 1KFBB 3KVVA 4H7DA 4EYEA 1VSVA 3TIFA 3WJAA 3WNBA 2BGGA 3ASZA 3O9ZA 5E2IA 4CR6A 2HWUA 3FUWA 3AFOA 4PIVA 3K0CC 4FGKA 4PC2A 2HJWA 2M32A 3AK4A 4HDKA 4MPPA 5IT9A 2JGFA 4PGGA 4QDXA 4BFSA 2HDOA 4B2LA 3ZVMA 1ECLA 5JECA 3EZGA 3MTIA 1XZHA 4J1WA 1E3TA 1ZO8A 4U2KA 3AETA 4R2IA 2PUCA 2OORA 1XLVA 3GFRA 3MHPA 4DUGA 4BFCA 5EIEA 5EP3A 3P9QA 3R7BA 1K68A 4EUKA 1U3CA 1R6UA 2D3TA 1BE0A 5CLQA 1ZNYA 2HHJA 4MX8A 3U4CA 3LQ1A 4Z59A 1D1QA 3BIFA 3PV0A 4KFTA 4EH1A 3TM5A 2PV7A 4U3JA 4Z5XA 3EXHC 2B37A 4XIYA 5F7JA 4OI0A 1T91A 2DFTA 4PO3X 3P2OA 4M9CA 1UMDB 4Q7QA 1WSBA 2EFHB 1T36B 5TMBA 3IJPA 1B23P 2ZJ6A 2UZ1A 2SICE 4BVGA 1U31A 3B78A 4DZRA 2QRLA 1ZN9A 5EIFA 3WIBA 4CCYA 3EZ6A 5IM4A 2IZZA 4P53A 3D8NA 5A04A 2ZANA 4MR7A 2X3YA 1M72A 1HG0A 3P2YA 4ARSA 1AQLA 2DQKA 1G1AA 5EVCA 4KQXA 5JSYA 5K5EA 2IVBA 3LP6A 1MHTA 3FYDA 1JR6A 4INPA 4UVEA 4M4SA 1J1IA 2X0JA 5CK5A 3I2YX 3QVLA 1D0IA 4H3VA 4OXXA 3H9EO 3F46A 1KAMA 1QH1A 2B4KA 3I8SA 1V8OA 1J2JA 3ITEA 1NUTA 2PR7A 1E3JA 2ZIUB 3L1JA 3N7AA 1NG9A 1E3SA 4J1NA 3KD2A 3ERCA 3WDKA 4KN5A 3ZDRA 5ERGB 2D1TA 4N9WA 3LCJA 3CT6A 2PV0A 3ZXSA 4B9AA 1LPOA 1O94C 2XRYA 1PLKA 3EVZA 2AMVA 4FYIA 4UCQA 4DMKA 1Z4LA 2IX9A 1WF3A 1PZXA 1UBLS 3GJSA 2XOXA 1ISJA 5B36A 5ILOA 2A9KA 3RLIA 3R3XA 1XF9A 3QV1A 1QYCA 2ZUSA 2ZRFA 3GIDA 1KTIA 4E15A 1NVWQ 1M34E 4Q4HB 1Q7BA 1SB9A 1Z2CA 2J7PA 1S4MA 4E5KA 4X71A 1HQCA 3ZWXA 4DXHA 4CEHA 1QRAA 2Q46A 1JEDA 2GRLA 3C8HA 3JWHA 3VH1A 4DMGA 2NQTA 4FUTA 3UGQA 3TN7A 2GXAA 2ZRBA 1V8PA 2VZ0A 2PMWB 3CUTA 5K0SA 5C51B 4TSKA 2EFJA 1MTOA 1OXSC 4I5GA 4Q1VA 5J3JA 1ZHHA 1E4YA 1VP9A 4LVNA 4AZVA 1FNMA 4DIFA 1MOSA 1VDZA 3AP3A 1T35A 2XUIA 3LUAA 1ZBQA 4M2LA 3WQSB 3IIKA 4JAVC 3T9FA 4D9KA 1JFLA 3D0RA 1N2GA 1N6RA 2I2XB 2WTBA 1Q0QA 3JD3A 3M5CA 4EARA 3AEKB 2QX6A 4PSKA 3B6MA 1IC8A 1IBSA 3CSDA 3IQWA 1SIOA 5FBKA 5HVNA 1IWBB 4MV8A 1VL1A 1CWUA 3EXG1 2B25A 3V8EA 2CNWD 1WUTA 1C9YA 1RTTA 2WJJA 3LXRA 5DW3A 4EI8A 1Y1SA 1OHHD 1OI2A 2OV4A 1EH5A 3BSSA 4JT2A 1OCTC 1CUZA 5EGSA 1RE1A 4WH0A 1NUUA 1NMZA 4EFNA 4TWIA 3DC2A 2Y68A 2WB4A 4J7AA 4E4YA 4FCWA 4WXRA 2YRXA 2C00A 1K6EA 3CZRA 4TROA 4J3NA 1NVUQ 3DZHA 4JNCA 3TQRA 2BGRA 3WB9A 2G6BA 3KOUA 4K6HA 1QG6A 5IJWA 4HQLA 2KEIA 4HWKA 5KMGB 1UEIA 2WJ4A 2D2FA 3UJCA 4ZK6A 4Z4CA 3WLTA 1DJNA 1UC4B 1ADJA 1UBMS 3B60A 4QNNA 1CJVC 3EN0A 4M87A 3L4EA 4RETA 5DM4A 5DYNA 3RUPA 3ZVLA 3HXKA 2ONCA 5EAIA 1NR5A 1DC3A 4X63A 2KPOA 4DCJA 5CCEA 4QDZA 1KBQA 4TLEA 1YB2A 3TOVA 3B1ZA 4E1AA 5AM3A 5HDBB 3CEAA 1MX3A 2WAOA 1B6TA 1H2RS 2QRMA 1PCXA 3A10A 3REGA 3TQCA 2OO5A 3PRYA 4CM6A 2WIAA 3RSSA 4AX4A 4XRRA 1D1TA 3H04A 4WLOA 4UCWA 4XVUA 3SJUA 3HDVA 3A3OA 5DXAA 4Z4GA 1G5RA 5K3CA 4YMLA 2I7CA 3F51A 1F9EA 2C04A 2C0CA 4XA8A 1N5MA 3LCCA 3G59A 4LOAA 2UVPA 1H9BA 2JHAA 4FX5A 4DV0B 2NVWA 1XEWX 3W2EA 1B00A 2NT3A 4C7OB 2WF6A 1PDVA 2YZGA 1OBVA 4K86A 5FOQA 5JISA 3TEFA 1TKBA 1ABEA 3UMFA 2WICA 3RWMB 4WZ6A 1SVUA 2OHJA 3H5AA 1YQTA 4G5FA 4B09A 2HCTA 2Q9UA 5HM8A 1E1CB 3EIWA 2O20A 1QQ7A 4QTYA 2ZWVA 5DTEA 5I4CA 5KNCH 5I9MA 3VDMA 1JBKA 2ZJYA 4TZTA 3DOUA 1I4EB 1EXNA 4RGBA 2IHNA 4D9FA 3HNOA 3KQTA 4U7HA 5DX8A 5A3QA 3TB4A 1T8YA 4YCAA 3EEOA 1FDWA 2WKRA 2B34A 2X6RA 1EFVB 2FLVA 3LOPA 3PDIA 5HWSA 2VTBA 3N0VA 3O2JA 3PPIA 4Z3DA 1ADYA 4P22A 1OILA 3ORSA 1QB7A 3INNA 2WIKA 2QX7A 3HRKA 3VNSA 3MQ4A 2IVFA 3U5ZB 1UH5A 2D7CA 4P6VF 2IEDA 5F2KA 5A4AA 2ODEA 1URPA 4G65A 2JIPA 4RLHA 1MC8A 3EUEA 3OZUA 3IO5A 4MKHA 4G5OA 2O8CB 5J5AA 1R7RA 3L7LA 2I67A 1E58A 3R9IA 4IXWA 3CPSA 2JJ1D 1RXVA 4JBLA 5BWCA 3WK6A 1U6JA 4PAQA 4HUQB 5HYVA 4O25A 1O9GA 3L9XA 2O0JA 2D2VA 3AR9A 5E7IA 4URYR 4KACA 4LJ4A 4R2MA 1Z7YA 4KXMA 4YP0A 4Z4EA 1V2GA 5ISMA 2A9FA 3N2GA 2G06A 5F1PA 5GAHi 4FDTA 1JU9A 1R10A 2H54A 2OO5C 1W2WB 3KR9A 2QLMA 3T0GA 2BMAA 2CJXA 3F1KA 1VZ2A 5EYPA 2MTBA 3H5IA 4JLJA 1C8VB 2GNAA 2BE9A 3A0RB 1G5TA 1IOWA 1I5OA 1E2NA 1WXGA 2VA8A 2V7VA 2W37A 5AI8A 4HNGA 2O3RA 3PXCX 1YVPA 2R1VB 3RC8A 1ZQ9A 3MWEB 4YG7B 2VSFA 3G2NA 4YP6A 3H84A 5IJAA 4RACA 2DPMA 1GZ7A 3OU7A 4I4IA 1K1EA 1SXJD 1O9BA 2HXGA 1ZSYA 6GPBA 1DT5A 3MELA 2O8VA 2W2LD 3NHZA 1BS2A 4C5BA 4BFZA 2EHJA 1Y8QB 4LOIA 4QUAA 5J4VA 3FMVA 4Q4AA 2RAVA 1RS0A 2P11A 5BORA 2EGUA 1R0XA 4A6XA 4CTOA 4DR5B 1P9NA 1PR3A 2XTMA 3SLRA 5FPYA 1D04A 3QFSA 1INLA 1X86B 3IQIX 3ZHYA 1ONBA 4MVXA 1EVQA 2YCLA 2RGXA 2MEZA 1U5CA 4MICA 4S1TA 3F5SA 1BCRB 1YS4A 2ZUEA 2PZKA 4JODA 1RYNA 3GCGA 3D6HA 3AKYA 4OFBA 3GDOA 3RWBA 4ALIA 3RSOA 1ULSA 4EAAA 4JJEA 3D2CA 3MPUA 3AH8A 1PS9A 1RHRA 1R69A 2IV1A 2PX5A 3VVMA 5K09A 4NTZA 2CXOA 1HDXA 1WHTA 1JLHA 4FFPA 2YIMA 4RMGA 3QVWA 1T0UA 2V4ZA 2JH9A 5EWJB 3TMYA 4ZEXA 1TMOA 4WD3A 5DBIA 4AIIA 1IUKA 1JHZA 4G89A 5FFMA 4IHAA 5DJ5A 2Y77A 3VKHA 1DBVO 1Q74A 5ITZA 1NBME 4XIGS 1ECBA 2HEGA 3CMCO 4AAYA 1VBKA 2KI5A 2W2QA 4ERNA 4OREX 4M49A 2VTDA 1SOMA 4BY9E 1ATZA 3AUUA 5G0SA 1F4LA 1OU0A 3SU8A 5IJ9B 4P34A 3PA6A 3ESBA 2SECE 4CNQA 2TYSB 3ZOKA 4U1RA 4ZOLA 1G5FA 3E2MA 3OY7A 2CDCA 2XE8A 4UU0A 2DUWA 3OOHA 4K6MA 3GFBA 4LKRA 1ONSA 2H07A 4EG0A 2FI1A 4WKOA 4P3OA 2AJ8A 4O2AA 2YV2A 3UIEA 3VSAA 5ADHA 5IP5A 4GKVA 4WBNB 4GSLA 2ZE6A 3SVLA 2WA1A 2J87A 4DA7A 3RJ5A 1OASA 3KHSA 1JAZA 5J5CA 4F9FA 1KRWA 1PK7A 1G9XA 1BZYA 2OPBA 3OURA 1R8SA 3QUSA 4RV4A 1P1FA 4Z9AA 3TK1A 3UMSA 3U3DA 5GONF 3ABSB 1RM0A 2JFOA 4MWBA 3PQEA 4XOIA 4C43A 3H5RA 3R7FA 4CT4B 1MX1A 4BNNA 4DCVA 1EAMA 2J7UA 1J2TA 3DO8A 5FQOA 2D1FA 2P9CA 2WWWA 3LQFA 5B3KA 4DLYA 2L82A 4NAVA 2CFSA 3EQ7A 1DRUA 4A6DA 5IFKA 1QUFA 2W2OA 3MWFA 1YQWA 3L4BA 2QU8A 4DEVA 4AY4A 3G85A 1PRYA 2E4XA 4WUVA 4GR5A 3UB2A 4A2WA 1CJMA 2V6GA 1T9GS 2QL9A 3CWZA 4HH0A 2FPIA 1ZIPA 3JAWB 1AQJA 1B74A 1IY0A 2A84A 2HBRA 1E8MA 4N65A 4XM0A 1SD2A 5KVCA 1EE9A 4MIOA 3FKQA 2HCNA 1LCDA 2ZSEA 2JLBA 4RA9B 5LBIA 2B2XA 2XB4A 1ZZ7A 3GZNB 2NUPB 2IXBA 3WMGA 4LDZA 5FV7A 1CTQA 2D1SA 3Q98A 2GEBA 1PV1A 4OXRA 3DUFA 1X39A 2VO1A 2XLBA 4NABA 3O1JC 1D7AA 1NULA 4MV5A 1QC5B 4AQDA 3MMXA 1RQGA 1XF1A 2BR5A 2X4LA 1RVDA 3DS8A 3HB5X 3MJSA 1CB0A 2HM7A 4B2PA 2O3SA 4MRMA 5EJ8A 4KVFA 4YRRA 7MHTA 4HLNA 2JHFA 3QQPA 4RPGA 3KZ3A 1QDLB 1GRQA 3U1BA 1PWXA 1GYQA 3GNTA 1SVSA 3H0EA 1GOTA 3EMKA 3HY3A 4M0DA 4ZVMA 1PYGA 2EGGA 3QUCA 3GZCA 3K0BA 4WPGA 3I6ZA 4C1BA 1Z4OA 1ZSVA 2HY7A 3UXHA 5LP1A 2G0NA 1QX4A 1MBZA 3KQQA 4OLHA 1SZCA 2WF5A 3AFIA 3U9SA 1PWEA 1SQFA 1IHDA 2H1HA 2P3OA 3KIPA 3ZXIA 1SFRA 4MSUA 4LBVA 3JU3A 2RI1A 1ZJZA 2WTAA 1HLGA 1ODJA 2IIBA 3MMSA 3EXFB 3KL4A 1IXZA 1Y9JA 3JQQA 5DGXA 5AW1A 4CLRB 2IXEA 4IMJB 2D06A 3PUWA 3GGDA 4O8CA 4R31A 5LD2B 1RDFA 3A70A 4OLFA 1NVDA 2Z5GA 3TKAA 1RLMA 3GJYA 4A8PA 5I7WA 1IEWA 2J3EA 3U1TA 4JI5B 5JNSA 3QW2A 2OOKA 2II6A 5EIHA 3BN3A 5JALA 1I3LA 1QOPB 5KAPA 3T0IA 3C3DA 3ZWCA 2UYCA 2OGSA 2Z83A 3U44B 1LEHA 2IW1A 3RU9A 1FMLA 4FI3F 2VP3A 3LUJA 3BZWA 2CHEA 1IBMB 1QCDA 4JB0A 4U3JB 4MQBA 1BTOA 3DLAA 1WXXA 3ZDCA 1FVHA 1NXSA 1SIBE 4MPRA 4Z0PA 2R48A 3GNQA 3NHAA 3OHMA 3UCEA 3SC3A 4WCFA 3GIWA 1ORRA 3GFQA 1R00A 2QD2A 1AM4D 4Z4HA 3JYPA 1C7JA 4QBKA 3FCSB 3QA9A 4LPSA 3D7RA 3O4IA 4QNRA 3PFCA 3QPBA 3K70B 4B4WA 2IUOA 3LHIA 4XGKA 2QTTA 4D9HA 2O3QA 5KVAA 5L45A 4YMTA 2LYPA 1JZSA 5F33A 3U61B 4KQCA 4GP7A 1SBTA 3ACBA 1STOA 2P7IA 4OHZA 4GSYA 4L0CA 1FPMA 2JEOA 1E1NA 2YIDA 1UZMA 3CF4A 4G4SP 4GPEA 4WN3A 5AKKA 3TM4A 3W9YA 5BR1A 1JIJA 3PBKA 4TT8A 1ABBA 4OJTA 2HQBA 1MU0A 1NBMD 3DE1X 4LSZA 1E5XA 3JPWA 4HBGA 1M2NA 1HO3A 3W1EA 5H3CA 3GT4A 2HH9A 3NHKA 4XX0A 5B53A 1QK4A 1W2HA 2PT9A 2B69A 2ZTMA 2OSVA 3N07A 2HZ7A 1FYXA 3NFYA 3ZHIA 2ID7A 2PUHA 5DHRA 1R6VA 5DPMA 5F1OA 5SZKB 3T9CA 4UVDA 1HTTA 3EZNA 2Z5LA 3D43A 3AVTA 3PUHA 4NFYA 3GAFA 1NJGA 3F2VA 4MGKR 2P9BA 3PEYA 4F6RA 2GHRA 1OX4A 3B82A 2IW3A 3R5SA 2DFLA 5I3CA 1OBFO 1Z34A 3OIYA 4R1QA 2JD0A 3H4MA 4I1YA 3WY9A 1BVYF 5JDCA 5AI0A 3VUEA 1B0AA 4I55B 5JH7A 3V55A 1CK4A 3A7DA 3E23A 3OCZA 1C1DA 4A8JC 2Y1LA 3MT8A 5HIKA 5EY5B 1QG4A 2YWDA 4FINA 1QH8B 1RXWA 2GXUA 1YRWA 1J9EA 2ZTSA 1X77A 3AUYA 2I55A 2QN1A 3DFIA 3K1AB 3X1XA 1FMJA 2NADA 4FQ7A 2XQIA 4IP0A 1YE8A 1B2LA 4MB2A 3F6WA 1ULTA 5ETJA 1GDHA 3KQSA 2YZ2A 4U63A 4AM8A 1G9TA 3IIEA 4UAGA 3HCWA 4I4TF 4J0DA 4Y1RB 1ZMRA 5ECDA 4OHBA 3SQXA 4EG6A 2VNHA 1Y4ZA 2ZDQA 1HT3A 3CRW1 4RL6A 5H83A 3EEBA 3NDIA 2EKQA 1FRQA 1Y9ZA 2DTDA 4W8OA 4GP9A 5AKZA 3ZV7A 3Q0EA 4L57A 3QEJA 3OKZA 1QM5A 3PB3A 4N6OA 4TUYB 4X1KB 5ERXA 5FWYA 2PH3A 4OHUA 1OWLA 4RF3A 4TV9A 2GX6A 4BX2A 2YHIB 2FLWA 3OAAA 4J16C 4LWZA 2GPNA 4HFRA 5D85A 3S2YA 3SOPA 4L5CA 3D0KA 5DTQA 3GJQA 3NKFA 3RANA 5CLJA 5HR5A 4C3ZA 3GP5A 2XUPA 3AVPA 2AHOA 1YHNA 1ZVJA 2BSAA 1Z18A 2PXCA 3JWEA 1DC7A 1YUMA 2XJ9A 4PTLA 2PQ2A 2ZUVA 4S3MA 4ZDWA 3T3IA 1DX4A 3OX4A 4CXMA 2QPTA 3KYCB 4PSAA 5LXTA 4WBXC 1P62B 4MUFA 5BSVA 3C4VA 3KT0A 3FPFA 1H69A 4QREA 4KITB 3C7KA 2XCOA 5H5JA 1RHQA 4DSNA 3NHJA 3B2EA 1I4WA 2HA5A 3DDOA 1MKYA 4G0QA 3UVEA 5HGXA 3RASA 1C50A 4B3XA 2JDID 1WXQA 4TPKA 4Z54A 4FDAA 1QTRA 1QTQA 3ILSA 1A2QA 1TGYA 3OCCA 4EM6A 5H02A 2IZ0A 5EA2A 2X6QA 3R6WA 1L5HB 4XFKA 2JGIA 3K30A 1YK1A 4MEBA 5GV8A 3TTWA 4N5NA 2G5GX 3BWYA 1J33A 2XGOA 3WWYA 4DM3A 4Q1EA 1NVXQ 2H5EA 1XXHB 2Q3LA 3V80A 3BD8A 3NUZA 5DW0A 5KJ1A 1JN0A 3FETA 1Z0FA 4AG5A 4DV5B 3FDFA 4J0QA 4MW9A 2DT5A 3FFBA 4YMWA 4OHXA 5AFSA 2WVJA 4P3NA 3UT6A 2R2GA 2UVDA 4XYMA 4BE7B 3ZJTA 2QRZA 3SNKA 1NVTA 1T4DA 3EEFA 2GUWA 1AY0A 1RI1A 1WIZA 4KSCA 5J4KA 4EABA 4LY9A 1RC8A 3KB1A 3OQIA 1ZGCA 1EK6A 1LMB3 2JAQA 3QELA 3PGMA 4EA8A 1KDPA 4L72A 1SBNE 3HS3A 2CEKA 3C5HA 4UBLA 3UENA 3THSA 1ZUIA 2NP6A 1Y7HA 4MWDA 1VCNA 3AR4A 4YR7A 3E8XA 5TMPA 4ZJUA 4LF8B 1N7HA 3I39X 2OWEA 1H9CA 5F5NA 4IOJA 1COWA 5JVDF 2A9VA 1E2JA 1PWHA 3E9CA 1G38A 3FSEA 4ODIA 4MQ6A 2PX3A 2B5WA 2Q5IA 2B6HA 2F67A 4US1R 5IAOA 2ZB4A 1XWFA 4IDPA 2XXAA 5LA6F 1SNYA 3QUQA 4GNKA 5TEVA 1S2LA 1IQUA 1DC8A 5BWOA 3G5LA 1RZVA 3C45A 1RAHA 1SXJA 2JI8A 2FQWA 5CDYA 1B1AA 4JVLA