2PUCA

Crystal structure of the laci family member, purr, bound to dna: minor groove binding by alpha helices
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
338
structure length
338
Chain Sequence
TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLEANTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*AP*CP*GP*CP*AP*AP*AP*CP*GP*TP*TP*TP*GP*CP*GP*T
publication title Crystal structure of LacI member, PurR, bound to DNA: minor groove binding by alpha helices.
pubmed rcsb
source organism Escherichia coli
molecule tags Transcription/dna
total genus 116
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 1997-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2pucA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pucA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pucA02
3F6WA 3LOPA 3OO1A 4LX8A 4RK5A 3BRSA 3NNDA 4ZMRA 2XI8A 3KSMA 3LKVA 3DLHA 1RZSA 4MYRA 4WWHA 3HUTA 3C3KA 5KWSA 3EODA 4O8BA 4MQFB 2AW6A 1YS6A 4CBVA 4EVQA 1DCFA 4QYMA 5IUJC 3N8IA 1DRKA 2ZWMA 2MQKA 2IV1A 2XIUA 4N47A 1LCCA 3TX6A 3FFWA 1LBHA 3GN5A 4Z9AA 2LYKA 5TQ2A 2NZUG 3LUJA 2RGYA 1LQCA 1WH6A 4KVFA 2VUHB 1ABFA 4ETMA 3IP6A 1ZZ6A 2LYRA 1M2FA 1ZY2A 2QVCA 3GBPA 3H5VA 1GT0C 1VRVA 1GCGA 2IYNA 3IPCA 3DGFC 1ZUGA 6ABPA 4EUKA 4EVRA 4MS1B 5FWXB 1DBQA 1BDIA 5JNWA 2BJCA 1F51E 1LK0A 2IU7A 2IVQA 4X4BA 2R48A 3HM9A 1XWWA 1JL3A 1ISRA 5KQGA 3ZHIA 1JFTA 1AU7A 1GCAA 1ZGGA 2L18A 4OLAA 1KGSA 2MYPA 1Z15A 1PNTA 3CNBA 3I42A 4I6TA 2RJNA 3S8QA 8ABPA 5E3JA 4N41A 1EWKA 4Z4HA 3LISA 4FE7A 2FMFA 1E6KA 3C3MA 4YLEA 2L2QA 1CHNA 2A6CA 4YV7A 4B09A 3OO0A 1QPZA 1YVUA 4MQFA 3EDCA 3GL9A 3EQZA 1L5ZA 3IP9A 2IPMA 3EUSA 2MSLA 4MCXA 2QZJA 3N75A 4KNYA 5DKFA 1UTXA 1ZH4A 1NXWA 5IX8A 2BNOA 4Y42A 1YTUA 1NXPA 4KV7A 4MAAA 1DCKA 3GBFA 3MYYA 3B7HA 1Z18A 3KCNA 3KLOA 4RKRA 2P4UA 3FMYA 2CSFA 2E4YA 2FEPA 2PAFA 3E61A 3JXDL 2E4VA 2IDMA 1A0OA 3OP9A 1ZS4A 2JVLA 3Q7RA 5FWYA 1K68A 1M2EA 5I4CA 4JP1A 3A3KA 2IKSA 3FFXA 3KXAA 3OQMA 1NXVA 4YO7A 5FWXA 3ZHMA 2FTKE 2LBPA 3NBMA 4PEVA 4RWEA 5FBKA 1VLZA 3A0RB 2R63A 7ABPA 5JNVA 4F8JA 4YRZA 1QP7A 2QVGA 4YBAA 4MCTA 1DC7A 4F3TA 2AXUA 1MB0A 1E2BA 1KRXA 2XCJA 2FXIA 2H0AA 3CTPA 2NUBA 4DADA 3CROL 4G0QA 3B2NA 3NHZA 3EGCA 3RVSA 1W25A 2AUWA 3HUUA 3O74A 3SQNA 3ROTA 1Z2DA 2B5AA 2FLKA 3GT7A 1LJLA 2IOYA 3KG2A 3F51A 3Q7SA 3HJFA 4Z4IA 1B0NA 1JF8A 4IWRA 2N9UA 1H9CA 4P1ZA 4X4IA 2BNMA 4WXEA 2R25B 3L49A 3MF4A 3MIZA 5DLEA 4I6RA 4MLDA 4WXMA 4RXMA 4I6UA 3RVOA 4Z5DA 3GN5B 1O4XA 5TQ2B 1PEAA 2FEWB 3M9XA 1X2LA 3QF3A 1JWLA 2CROA 2JVKA 1USKA 2PKXA 5EWJB 1LJUA 4KFCA 1SXGA 3OM0A 4Y9TA 3F73A 1URPA 2TMYA 3CECA 4YS6A 4O5AA 5ED4A 1ZH2A 4NCAA 2GX6A 3HXMA 1T34A 3K4HA 2OENG 1SXIA 4GNRA 3URMA 4Q7EA 3VNAA 3CFYA 4G0OA 2FJRA 3GA5A 3IPAA 4H3HB 4F12A 3U3WA 3RVMA 2FLWA 4IF4A 4GQMA 2LUOA 4EVSA 4F11A 1ZZ7A 3JTEA 1DP4A 4H60A 4YWHA 3GV0A 1QNLA 3OLYA 1NXSA 1ZHHA 5TPZA 1NXXA 1U04A 2IVBA 1PERL 4JCYA 5TQJA 3O1IC 1YK1A 3CS3A 1TM2A 3BS3A 4NQRA 1JX6A 2O20A 3RH0A 5FBHA 4RK1A 3QEMB 3GYBA 2HINA 1QO0A 1MAVA 4N0QA 3F6PA 5JS1A 2NT3A 2QR3A 4PU7A 3TO5A 2WWVD 1DBWA 1X57A 2ICPA 1AB6A 3EULA 3L6UA 3RVRA 4YG1A 3SCHA 4PE5B 2WY2D 2LYQA 1QQBA 3T38A 2LP4Y 1U8TA 2AWIA 1ZZ8A 2H3HA 4JB0A 5CNKA 4EYQA 2GRMA 4EYGA 2FW0A 2RDMA 2KEJA 2KZ8A 1NTRA 2L17A 2YHBA 2FN8A 3OLVA 4KQ9A 3SCFA 4NICA 4RSMA 1UXCA 4RK0A 3ILYA 1SXHA 3QK7A 1NXOA 1S8NA 5EWJA 4ZJPA 3QYXA 4PZ0A 1RZRA 4ZMSA 1TVMA 2E4WA 1ISSA 1RXIA 5HM6A 1OXBB 2GWRA 1TJYA 1JLKA 4XLTA 4D6XA 4UHJA 2FMIA 1A2OA 2FQWA 2PMCA 1Y1LA 3LUHA 5FWYB 4OATA 1LCDA 1MIHA 4E7PA 2LYSA 1CQTA 3EQ2A 3JY6A 2JK1A 4PICA 5TE9A 2OQRA 3MLFA 4LDAA 4OG2A 3IVPA 2PL9A 2A9OA 2H8RA 4DQDA 2CD7A 2LYJA 2CHFA 1K66A 1AB5A 1OXKB 3TMYA 3HVRA 1P8AA 4RS3A 1D2AA 1Z17A 2E4ZA 2PUCA 2KEKA 2M1ZA 5IUNC 2FMHA 3C6QA 1TLFA 3QEMA 2R1JL 1KRWA 1LMB3 1DRJA 3MQ4A 4JCXA 1ADRA 1RNLA 1W9HA 2VYCA 1UDRA 1WIZA 3RVLA 4KZKA 4Z9BA 3RVQA 1BAPA 4OLBA 1Z13A 3HO1A 3JVIA 4LDZA 3FFTA 4RV5A 5JNRA 3LKBA 1U0SY 1DW9A 3L1PA 4RK6A 5BRJA 1EHCA 4UHKA 2KPJA 3UK0A 4KQCA 1QKKA 2PL1A 4HNQA 4Z99A 3IDOA 3LTEA 4OBBA 4X4HA 1BDJA 1NXTA 3OMWA 2A9RA 2ID7A 2PUEA 4PYRA 2PUAA 4ZPJA 3TB6A 3H1FA 4EYKA 4HYEA 4Z4EA 4LRQA 4RXUA 1C4WA 3IP5A 4JOQA 2P9HA 4PU4C 1GUBA 4G0XA 4IMJB 1CEYA 1MVOA 4WZZA 1MB3A 2MEZA 3H5IA 1EWVA 2NT4A 1PUXA 3H5WA 4H3KB 2WJAA 3O1JC 3RZZA 4WT7A 1NERA 4YGXB 4YR7A 4W5QA 2KYRA 1WH8A 3G1WA 4XAQA 4X4DA 2WMYA 4YP9A 2B1JA 4KMRA 4KREA 4E7OA 3S99A 3HV2A 4S04A 4G97A 1E6MA 3I5AA 1S7EA 2CHEA 4G86A 2AXVA 1YMVA 4XXHA 4G0MA 3FYAA 4I8TA 4LE0A 1DJMA 1ZZ9A 2QXYA 3HDGA 5ABPA 5GOTA 3P9YA 4O1HA 3NNSA 1ZAYA 4GPAA 1IC8A 4J1WA 3F6CA 4S05A 1XHFA 2GBPA 3LUKA 4W5RA 1TMYA 3SY8A 4Q6WA 1QQAA 4MR8B 4W5NA 3C97A 3CRNA 4MLCA 3JPWA 4WUTA 2W42A 1ABEA 5CNJA 4YG7B 2XJ3A 2PJUA 4MQEA 4XASA 2LCVA 1J56A 4LE2A 4W5OA 4TN5A 4Z0NA 1Z25A 1FFSA 3O75A 3CLKA 4RY8A 1L1MA 3QELA 1JH9A 2AYXA 2AXZA 1JHZA 3QLUC 4IGAA 2E4XA 4RY9A 5PNTA 5BQ3A 3GBVA 5D2CA 1POUA 3QX9A 1ZPQA 2FKAA 3OLZA 3SCGA 2WIUB 2OR1L 1P6QA 1Z26A 3BILA 1APBA 2MYUA 1WETA 3O2SB 4N76A 4IVZA 2MYNA 2WB4A 1JFVA 3LUCA 3RVKA 1JYFA 2HQOA 2F8SA 3SM9A 4OTZA 2FSPA 2FVYA 9ABPA 3KYJB 3G5GA 1ZGZA 5JNTA 1JBEA 3F7NA 4JA2A 4YARA 5TPZD 4PU3C 2WJWA 2VUIB 3LUFA 2O4AA 5DGCA 1A04A 2M98A 2X7XA 3ROFA 3RVPA 3RQIA 3LUAA 2JVJA 3H5LA 2PUBA 4MS3A 4P98A 4RXTA 3LUDA 5TPWA 4EY3A 1QO0D 3D02A 1ZN2A 2PIJA 3MMNA 3OLXA 4MS4A 1PNRA 1F4VA 3A10A 3DGEC 3QLUA 4YCSA 6CHYA 3JXBC 1RIOA 2DRIA 1Y9QA 2FQYA 1BA2A 1JDPA 3BDNA 1M5UA 5HQJA 1D5WA 1DZ3A 1GUDA 3GWGA 4MR8A 2JRLA 3PXPA 2R47A 4NDWA 1Z12A 5TQ0A 2KEIA 3N6VA 1OCTC 1XHEA 3OMTA 3KLNA 1E3OC 1USGA 4JAVC 2IUOA 2YHAA 1R8JA 4RY0A 2XSDC 1DWKA 3HCWA 3TRBA 4F8DA 1RZRD 2E4UA 4JQDA 2FQXA 3A0UA 2WRZA 1P6UA 3O2QB 4QPJC 3HS3A 3HSYA 4HNSA 3CKMA 3H6GA 4D74A 1B00A 2LYPA 4W5TA 1QMPA 3QLVC 2FEKA 4MR7A 2JBAA 4X4CA 2LIVA 3KYIB 3KKEA 2Q5CA 3ZKCA 3O9XA 3QEKA 4FN3A 1Y7YA 3UFDA 2HQRA 2I6FA 2QU7A 3H75A 4RU1A 3CU5A 3N53A 1PHRA 3JXCL 1FFGA 2NZVG 2MSKA 2EF8A 4TLMB 3DBIA 5EWLA 3H6HA 2PPXA 4N0PA 2GI4A 2EWTA 1FSPA 3BBLA 4ETIA 2A9QA 4ZYLA 3GRCA 5KC9A 4RK4A 3CLCA 2GZUA 1LBIA 1ZVVA 1IIBA 1PEYA 2QW1A 3BREA 3LMKA 1YSEA 3HZIB 3R0JA 3SAJA 1HF0A 1YMUA 1M5TA 2R4QA 2B4AA 1YS7A 4JB2A 3OMXA 1ZZCA 1GLGA 4XFKA 5IULC 5B3JC 1JYEA 3DZDA 3EJWA 3KHTA 5C5EA 4NCBA 4G0PA 1L5YA 2ID9A 3QLVA 3FGZA 1VKRA 2BGGA 3KJXA 2FN9A 2L8NA 1USIA 3OQNA 3G7DA 1I3CA 3TD9A 4G0YA 1EAYA 2MYTA 4KRFA 4MRMB 2ZAYA 3CHYA 4ETNA 5JNUA 1JFSA 4MQEB 3N0RA 4J1XA 1QP0A 2OFYA 2XDYA 2O49A 1SQ8A 3RVNA 5HKOA 4HNRA 4IA8A 4QICA 2L19A 1R69A 4EGSA 4Z4FA 2A9PA 4XARA 3QELB 1NY5A 4Z58A 2L49A 1BDHA 4IRXA 4L85A 5CNMA 1DG9A 3C3WA 5EWMA 5KI6A 3CG0A 2O38A 1RPJA 3MA0A 1QP4A 3T6KA 2LPMA 4MGEA 1PRVA 5B3JA 2PE5A 2ICTA 3UKJA 1NATA 2IVGA 2F8TA 4Z5HA 4LZLA 5KC8A 1DBPA 5BR1A 1JDNA 5JS2A 3HDVA 3N0WA 1D1PA 4O1IA 3SNKA 3CZ5A 4QYWA 3T8YA 1RPEL 3W9SA 3LFTA 2J48A 4RDCA 4NV3A 2LYLA 4L4UA 3HEBA 4RZSA 1NEQA 4M88A 4KK3A 3SG0A 1R63A 4Q6BA 3Q41A 4MS3B 2IPLA 4FE4A 3JPYA 4PU8A 4IILA 1OSLA 4RK7A 5TPWB 4Z4GA 3FMVA 4MS4B 5CNIA 4Z59A 4KK4A 4Z5CA 4TMYA 2RJOA 5IUKC 3D8UA 1YIOA 2AYZA 3M9WA 1SRRA 3O1HB 4MS1A 5BRAA 3JVDA 1YK0A 4EYOA 4FBIA 3O21A 1FQWA 1P2FA 5TQ0B 3VK0A 3H1GA 2HJ9A 5KQMA 4MRMA 4YG4A 4Z4CA 3N0XA 3QX8A 1HEYA 3JS5A 3T95A 2HQBA 3H1EA 3OLWA 3EAFA 4MR9B 2HSGA 3LUGA 3FDFA 3OQOA 4FB4A 3NHMA 1DCMA 1DC8A 3Q9SA 1BVHA 4DN6A 3H5TA 3DNVB 1D1QA 3MM4A 2QV0A 2D5VA 3G85A 1C0EA 5HSGA 1ZESA 5KQPA 4KPYA 1RXEA 2CWDA 4MR7B 2GRLA 4GHJA 2PUFA 2JBAB 3H5OA 5C5CA 3BD1A 3I45A 2IPAB 5A7LA 3OM1A 4IMIB 2HPHA 2MSWA 2JCGA 3O2JA 5KQLA 2IPNA 2JVIA 4ML3A 3DLBA 5EWLB 3IP7A 1U2QA 4OB4A 2PUDA 4X4EA 2JB9A 4MPTA 1ZITA 1CJGA 3Q15C 1D4ZA 2PUGA 2EBYA 4TLLB 2V0NA 5CHYA 3KZ3A 3I09A 1Z16A 3KTOA 2VK2A 4D6YA 1UXDA 5IEJA 2QSJA 3R1FA 5DTEA 3FYMA 5IEBA 3UUGA 3LFPA 2BNNA 2FMKA 3M6MD 5T7BA 1ZZBA 1ZDMA 2GKGA 3E3MA 1EWTA 4RKQA 1PRUA 1LLIA 1FFWA 1VPWA 1U2PA 3F52A 1CYEA 4X4FA 3BRQA 2PLNA 3KS9A 2WUSR 3CZCA 3ILHA 5GQSA 4F06A 1PRAA 5K98B 5IBQA 1Z2EA 1E6LA 3QQ6A 1SD5A 1KMIY 3NNNA 5DCLA 4X4GA 3HZHA 3VNBA 5JNSA 4MR9A 3QWGA 1EFAA 4LE1A 3CG4A 3QLTA 4JASB 3HK2A 3K9CA 5IC5A 1XWRA 5F64A 3D1NI 4G0ZA 4N03A 5EWMB 5T3YA 3Q7TA 3RVJA
chains in the Genus database with same CATH superfamily
4I5GA 3GXOA 1D07A 1YB2A 2QG4A 3U7IA 1GV1A 3HYTA 5IKPA 3U4HA 4WWHA 4QUDA 1UT5A 4OGFA 5JNTA 1XLVA 4EVQA 2PBFA 2IYQA 1E9VA 1UANA 2MQKA 1LQ2A 2O0HA 4J07A 3UJ9A 5JSKA 1NIJA 3GJ8A 4BCDA 3K53A 2ZS8A 1UC5B 3QOYA 1RYYA 2XWSA 5FTMA 3B7GA 4PZEA 4CKYA 5JECA 1V0JA 1N34B 3LQYA 2DPGA 3UOWA 2HXSA 3ZBTA 4TXJA 2X0FA 3QKSB 3KE8A 2BFPA 1KTVA 3QVJA 2P2LA 4QYXA 1CUFA 3P7MA 1B42A 5I7UA 5F9HA 2HLDD 1G21A 3CUVA 3H7AA 3PGLA 5REQA 4G5SA 4D80A 1PTJC 4WLOA 3ECSA 3RRZA 1KOGA 3R4CA 2MINA 4PF1A 4OB6A 3CGGA 3SX0A 1VLHA 4AQDA 3UUFA 3WGQA 5HWSA 2RI6A 2RCNA 3HLTA 1HF3A 1P2BA 2C58A 4Q37A 4RANA 1U7HA 1SEPA 1ZGGA 4ARCA 3NU1A 4JP5A 2Y76A 4TVOA 3UJPA 3T7IA 3TSZA 4F60A 3K73O 1G1MA 1IM8A 4G41A 3TLYA 5HRUA 3UWOA 3IKTA 1QZ3A 2A9KA 3FMFA 1UXJA 4PLCA 3TSWA 4US0R 3TFOA 1E4VA 4MUYA 1XTPA 2QUBA 4BZPA 5K51A 5EL0A 4LMAA 4CQMA 5F1YA 1XQ6A 3DW1X 2HR1A 4MGYR 2Q0QA 4OHZA 1UMDB 2X13A 4BCCA 1I2BA 2HDHA 3IP9A 5C81A 2AJDA 4UCFA 1HH4A 1I4DD 5EQFA 2PT5A 3LBNA 1KYTA 4KNYA 4JJZA 2VHCA 2PTGA 4R8RA 1RRFA 5DKFA 4QVKA 1K7XB 5B6PA 1LV8A 3CTMA 4UU0A 5C7YA 4B3JA 1J00A 1SO8A 3W04A 4ZYUA 4D9GA 2Q29A 3KLOA 1WTAA 3E3LA 3IRVA 1KI6B 4DDMA 1EKXA 1YRLA 2C4UA 3VR2A 4M3NA 3E61A 3LT5A 4M54A 1LSJA 3IR5A 1OY1A 3I2YX 2XR1A 5BV2P 3A3KA 2ANCA 3PIRA 4TZKA 4L8YA 1RR6A 3HN6A 2DM6A 1Y6JA 1M7GA 1M2WA 2VZEA 3H2SA 3PG5A 3UT5A 3SR4A 3NETA 1E3LA 2OZKA 3QENA 1C9JA 2CLOB 5C53B 2R63A 1A95A 3STUA 1A9ZA 2JIDA 1YBAA 3AYXB 1E66A 4KOAA 4DSNA 1A8HA 2ZCVA 1JIKA 5B3AA 4D79A 4B81A 1ZUIA 4BFLA 1K3UB 3II6X 3M2PA 1FU8A 4O1MA 3CROL 2G8LA 4QG3A 3FWHA 1TL7C 1FMCA 1PFYA 2BSQA 5I5GA 5FV4A 2P8SA 5KNLA 1IN7A 3T3DA 3BGVA 2A0YA 3KKZA 4X84A 5ALQA 1NG9A 2J45A 2FN7A 4LF7B 1Z0ZA 4EPVA 5JZBA 1A69A 1OILA 1KARA 4M1YA 5EZ6B 1E4OA 4IWRA 1MFZA 3CURA 1U0LA 4IIXA 3UMBA 1AXRA 1ESDA 3B6KA 4H16A 4WXEA 2WE8A 2P6MA 5C0OE 1G5HA 3WFIA 2GJAA 2FPSA 4Q9HA 1XAJA 3FDIA 3R7FA 5LP6B 1KO7A 1IY2A 1XVIA 5DLYA 1X2LA 1U7DA 1JTEA 3KTAB 3D6TB 4NZZA 5AXDA 1L5GB 1XPUA 2HCRA 1ITZA 2FCRA 1DCTA 1Y9ZA 2YQ5A 3HUEA 3AVPA 4DIDA 2W6MA 1E1NA 4Y9TA 2TMYA 1WUYA 3KEFA 3ANSA 2WTAA 4INAA 1GEEA 1JZSA 3V97A 4P4SB 5ED4A 3OU6A 1VGQA 1ORHA 3CFYA 3DR5A 3LYLA 2E55A 4PZ9A 4XIFA 4D4JA 3GA5A 4REOA 3R3XA 4H3HB 3QVXA 4UBJA 1P73A 2Q4EA 4BP8A 2G07A 3H83A 4AROA 2UYOA 4XJXA 3INTA 4MAFA 5TVKA 2IELA 4L3VA 1NVDA 4AJ4A 1TCVA 2Y3IA 3U1TA 4BO8A 1R0SA 3VBCA 3O3CA 1WCYA 4IDOA 4ENUA 1ESMA 1OWMA 3MMSA 2PLFA 2XVYA 1LVGA 2GKOA 1H2HA 1QYDA 2CMHA 5AW0A 4MHSA 2AQ8A 3VKUA 1ML3A 3KB6A 2J3MA 2IWHA 1DO0A 1DIBA 1WXWA 2I65A 2VDWA 3JQGB 1T8YA 1Y1TA 4M89A 5EJFA 1X8KA 2NT3A 3RG8A 1M6EX 3KR1A 4B3IA 3H8SA 1XJWA 2I7CA 3GEHA 1G3RA 3ENKA 1NQWA 4FGJA 4QDJA 3AR5A 3RQSA 3PNLA 2AVNA 5DYNA 1QQBA 2G28A 2LP4Y 1T9ZA 1ZLYA 3FMPB 4IJVA 1EXMA 2VSYA 1F8XA 4LVOA 4ARUA 1KAHA 1T3SA 1E4YA 2KPOA 3WBJA 2L17A 3GUCA 3VTFA 4BB6A 3WYEA 1T1RA 3H13A 4NONA 3SDZA 4C1NA 4N7BA 4ZJPA 1J8FA 1Z6TA 2BMJA 2UUCB 1FYDA 5LWQA 5B1IA 2DHQA 4PTLA 1WMAA 1HA3A 1XJ0A 4P4TA 1G63A 1H22A 1PNVA 1T9HA 4GLFA 4JROA 2Q6IA 3EXHB 3KO8A 1S9HA 3V8VA 3IUPA 3LHFA 5GTDA 3QVLA 4G1CA 4YJGA 3AEYA 2JS7A 5ALNA 1KDVA 2CHFA 2JLSA 3RLFA 3WJ7A 1PWEA 3BS4A 2TYSB 4GQIA 3GK3A 3OCZA 1NX9A 1OPRA 4BJHB 4KXUA 4QRDA 4RULA 1OIVA 1KP9A 4I1RA 1Z17A 1UFKA 2QTCA 4IH4A 1UPCA 2GBCA 3R3HA 4I0WB 4HDKB 5T5QA 4DCCA 1GO2A 1NRJB 4UPEA 2ZETA 4M99A 4EITA 3JX9A 3I6BA 4DV0B 1ZK4A 4G56A 2QDXA 4BIMA 4YRBA 2IEIA 4C05A 3TL6A 4Z9BA 3WLSA 3L6BA 3Q2KA 1KJ9A 2NZJA 3JRXA 2IP2A 3M4XA 4K28A 4OYLA 4PV7A 4B71A 1P2DA 2I34A 2UYQA 3MJEA 4XIJA 3THWA 1HFWA 1HUQA 1KAGA 4HFNA 4TWBA 4XVQA 2ZAIA 2YINC 2JJQA 4M9XA 5IJWA 1KFEB 1O0CA 4RA9A 3A4IA 1OX4A 3HNRA 5DJ5A 3G8DA 2BWJA 1EFRA 4LRQA 3D8HA 1KOFA 2NP6A 5EXPA 5L3VA 2DXIA 1CC1S 4TMXA 3DKKA 2H57A 2WP8J 4WCDA 3PE4A 721PA 2VBFA 1T26A 5AHOA 3LPAA 5IF3A 3AUAA 3K0BA 2WU8A 4UVHA 2TSYB 3DKVA 2H2DA 1OGJA 4JYBA 4FEAA 2ZR8A 4WT7A 4YGXB 1J6UA 5H1YA 5ELXA 1HNZB 3U0BA 4YXFA 1KZ6A 3QY9A 2RG7A 2I2AA 2NM0A 4P3KA 3LIPA 2O5EA 3E18A 1X7ZA 2PKCA 2RHCA 3B5EA 5HR5A 5JZ9A 3V7NA 1DJMA 3PC3A 3F74A 2F1OA 1CERA 3CEAA 3G5TA 2GUGA 1RYNA 2VTDA 1IDOA 3EK2A 3EEQA 5HKAA 2Z5VA 1WKVA 2ZS9A 5HF6A 3E3AA 4G4SP 3CGWA 1QX3A 3G9QA 4P5DA 4YA6A 1WSDA 3VZPA 3DD1A 5TVGA 3S2IA 4W5NA 2EOAA 2ZYUX 2W42A 3GDWA 1OBFO 3GDHA 2P79A 4WUTA 1RPZA 1BGXT 1UKYA 1JHVA 2IDKA 1DIOB 2Y99A 5LA6B 2JL1A 5SY4A 5EHZA 1W7AA 3LQXA 2BM8A 4DRXA 3W5UA 1E1QD 3E22A 3B5IA 1PLKA 3KKLA 3TKLA 1MO6A 4LOJA 2V0GA 4FQ8A 3L7CA 1I24A 2OILA 1V1RA 1TFUA 3M4ZA 1EJ0A 1PR0A 4I2NA 2Y1XA 1KDTA 4WZBA 3CVVA 3PFHA 4LZWA 2QT0A 5EP2A 4RD1A 1NG1A 1QIMA 3R3UA 1AS0A 1GSHA 2IGTA 2NAFA 2ZUSA 3DLPX 3L7YA 4V0ME 1HZZA 4FZRA 1PDVA 3A9WA 4I8XA 1P29A 1DEAA 1G17A 2JGLA 1TM4E 3B6IA 4JA0A 4PPNA 3TSYA 2UYGA 3AK4A 1KGDA 1Y8QA 3FPJA 4BX3A 5ICEA 3LUFA 3QFIA 1VKJA 1N4DA 1Q7EA 1R0KA 3ROPA 2WAYA 4DLVA 3GLSA 4OSPA 4D96A 1TJ5A 4EQ6A 5HKKD 4G9BA 1K6MA 4PPYA 3MB8A 5CHEA 3SYLA 8ABPA 5FO1A 3I61A 3R74A 4NJOA 4LZAA 3MINB 4M37A 5CT5A 3ZZ1A 5U4QA 1ZI9A 1ZRNA 4N3GA 1IZ7A 1T15A 1KZGB 1JEJA 1EG7A 4GE0A 5DDIP 4IWYA 2HWWA 1TKBA 4M0MA 3HZRA 3UWSA 5EMLA 3R7LA 1YQEA 4X6LA 5J5VA 4QGSA 2PXVA 3C7CB 3GUZA 3MUFA 2NU6A 2RKOA 1Y5NA 4HSGA 4FSXA 2XSDC 1WZNA 3KDSE 5FA5A 3SYTA 5ERYA 3UG7A 4BGVA 1RACA 3X1DA 4QPJC 1MJGA 4F4UA 4F71A 5A3JA 3W5BA 2B1RA 2VYVA 2KLHA 1X77A 1RQ2A 4S3MA 4D0RA 2QMEA 4N8EA 1E79D 2ZCJA 3O9XA 2CV2A 1D2GA 2OBLA 2VDVE 1FFBA 2WM8A 4B6GA 1W4AA 4E2YA 5L3SB 1Q0RA 1PHRA 4XW2A 1SURA 1ODLA 2FPGA 4WVLA 3A37A 1KJQA 2WEKA 3AMVA 1RCTE 2F62A 1NMXA 4GRIA 5LZ9A 4GM0A 3BMCB 3GRCA 4Q1FA 5F2OA 4ZVMA 2W2MA 2YASA 5K6RA 4ZODA 5I9NA 3I5XA 4GSKA 3DVQX 2CWWA 5JVDB 3ZLBA 1U1CA 2WU0A 4ZDWA 3UIEA 4LV5B 2I6QA 4JB2A 5DVZA 2V7EA 4Y0VA 2FDCA 4DR6B 4GVXA 1GLGA 3QVOA 2M32A 4QDKA 4DDUA 2II6A 1SEVA 1YA6A 4L4RA 4RLSA 5A0FA 1MC5A 5A9RA 2RHDA 3B3QA 4CUKA 4PVCA 4BQRA 5HUQA 5CB4F 8OHMA 4M9RA 2PKRA 2IUSA 4TUYA 3RSHA 1I3CA 1IQUA 1NT4A 1WCV1 2QAIA 3BZBA 2ZBVA 3R0ZA 3QGMA 4HUJA 3GVPA 4OQZA 3Q3CA 1NOIA 5SYNA 2NYAA 2QX6A 5D86A 1RBZA 1QP0A 2Y1OA 3LV8A 3QPAA 4H7DA 3I76A 5AJVB 1QFXA 2Q5JA 3R6GA 1WOMA 2HWUA 4QDXA 1GZHB 3ZZ0A 1UUFA 2L49A 4QGFA 2CEKA 2HU2A 1XU9A 2O38A 1V6CA 1Y1QA 1H8HA 1YTLA 1M1UA 2HTFA 2IYWA 3LCVB 4U7TB 3VYRB 1ONSA 4TQGA 4DRYA 5I4KA 3UKJA 2XGOA 3RC8A 4LZLA 3MLEA 3BL5A 5HGJA 1FVXA 3DEJA 4BVLA 5DYIA 4ZCTA 6YASA 3X1JA 1QWSA 2OHVA 2ENWA 3DLTA 3EDOA 3NP9A 1B1CA 3GHYA 4L4UA 4B3TB 3HEBA 4MWGA 4CJXA 2EBWA 3VI3B 2Z2XA 3V3TA 5JUWA 5TMPA 3U7GA 3L8ZA 1Y34E 3TFWA 4OQEA 3IUSA 1O03A 1CUHA 2DBVO 2GYWA 3WB1A 5KNCA 2JLAA 4KK4A 5FNVF 4JFAA 3IIMA 4M1SA 1NGSA 1F0YA 5I3ZA 1OX6A 2HMTA 1B2RA 3QVGB 4QOGA 4P7KA 3VH2A 3K8OE 4IXMA 4IS3A 4D41A 3EGDA 4OHYA 4NMMA 1RXYA 1SUBA 3IULA 4BJ6A 3MXOA 1DBSA 4YG4A 3OFVA 3WZLA 3QX8A 4FGUA 4DVJA 3ZGXA 1AKRA 1EZ1A 1KIAA 3ZIAA 3F67A 1ONNA 2P1RA 4QG7A 3JZFA 4MPJA 1ORDA 4FMDF 3TI7A 4DN6A 3H5TA 1CWUA 2C2ZA 3G1TA 3BFXA 2QV0A 3I53A 3EPHA 3K0CC 4FEYA 4DLKA 3A14A 3GFTA 1EFTA 4I46A 4N3AA 2V7BA 3FVVA 2PUFA 1L7XA 2HAEA 3MWLA 1G0OA 3L0OA 2JCBA 4LZNA 1A7KA 3V7FA 2FU5C 1MX9A 3VISA 2E4AA 1M6WA 3PE5A 1VJ1A 4YAWA 3RTDA 5BOSA 6ADHA 1W8IA 2AOWA 3G0HA 5IMSA 1W6UA 3SC2A 1EWQA 3IP3A 3RS2A 4H6WA 1ECGA 1M2KA 3SM3A 4RD3A 1OB2A 2GN6A 2ZREA 4FN4A 3Q8KA 2IE8A 4U02A 5KYXA 2YTZA 1N6OA 1XLTA 4MEAA 3EYWA 3E6AA 3R0QA 4LGMA 2G72A 4D9MA 3ZY4A 2P5UA 3DO8A 4FNAA 4EUEA 1QCCA 2VJOA 3UC5A 4MB0A 4Q3OA 5KINB 3EOBI 3VH1A 4M98A 2AX4A 3STXA 2BJHA 3TRJA 2WMOB 3F6EX 1GN8A 1TZJA 1ZJ4A 2XB9A 3G2MA 4F06A 3AEZA 1X9GA 3HB4X 4J3NA 1WSAA 1KE1A 4URWR 2JHAA 4EYSA 3AUFA 2JZOA 4UAGA 3U17A 2J9FB 2QTFA 4MQ5A 1U63A 2VPYA 1DX9A 1HSOA 5ALRA 3WKEA 3HWSA 3N6RA 1J0AA 1X39A 1C4XA 5DBGA 2ZK7A 5AQEA 2GZ2A 2VYFA 1BH6A 1PIWA 1G9TA 1ST2A 3C8HA 2DTXA 3W78A 2Q2VA 5G1PA 5DX1A 5EIFA 3QMMA 3EW9A 4QDZA 1B4DA 2LNMA 2XHZA 4KIFA 3FSGA 4GPAA 4QPZA 4RK5A 4QEZA 2JLUA 1SBZA 1AJEA 1GT91 1Y8CA 4P8RA 3C3KA 1BA3A 1Q92A 5MGNA 4B7CA 2DR3A 1WV0A 4WCFA 2AW6A 3CEPB 4DPMA 1U1FA 3PF8A 4NE9A 1ISHA 1FS6A 1S8OA 3PI7A 4LNUB 1QHSA 4YROA 4Z8YA 1WXDA 4D8TA 3WYBA 3PHJA 2LLWA 4MYDA 2WSSA 1HXHA 1XA0A 2IHUA 3DJFA 3KJEA 5CLHA 3RYIA 3SSOA 3KYCA 4HDNA 4QE3A 4M0CA 2ZR0A 5HBRA 2XUHA 1ZUGA 3GG2A 3KVRA 1UPUA 1EVJA 4JS0A 5JAQA 4EUKA 4MS1B 2XXPA 5FWNA 3U3KA 2WPNA 3OCXA 2Q6LA 4TKLA 1M8GA 3MPUA 3T9AA 3ACCA 5EZYF 5JNWA 4L8VA 4ZZ2A 4S1TA 3D8RA 5I48A 3U56A 1YOVB 4DQVA 3ER8A 4W1SA 3AY7A 1L3BA 2I6TA 1W73A 1WLSA 1FDRA 1K3TA 1NBEA 2B99A 2XY4A 2P91A 3DQQA 4R2LA 3TZQA 1NMSA 1YZVA 1Z15A 2PMDA 3S29A 3PQ2A 5A5GA 4R4JA 1H1LB 4QGHA 3PNYA 4H7KA 2RJNA 1HNXB 3ST7A 1IATA 3ETCA 5CH8A 4KOEC 4GW3A 2UKDA 2QP3A 3HB5X 3ROZA 2WJJA 3C3MA 1V26A 3G59A 2HIMA 3MELA 4PRLA 3MWEB 1I6KA 3W3AH 4AJKA 4X8OA 4ZIRB 4S24A 1CPYA 4Q3DA 2JLCA 1FX0B 3OOJA 4XTRA 3TZKA 4S35A 1PBNA 4KQFA 3TAXA 3ZD9A 3EDCA 1PVOA 5D85A 1YZ3A 4QXMA 2Q3HA 3KUKA 1EJ6A 4R8KA 1NONA 1QSGA 3VTZA 4ECAA 1X9IA 5ADWA 2X9LA 2XHEA 3LUPA 4E03A 2OXRA 4Y42A 3VR2D 1ID8A 1SHLA 1YT5A 1XRRA 1B74A 2I67A 4MINA 5SZHB 3EVBA 2HJGA 1LTQA 3ASYA 3IIIA 3NEYA 1T5HX 1X7YA 1L7AA 1E89A 3JQQA 2HV8A 4LFAB 4GLBA 5JD5A 3RYHA 4DLLA 3FFXA 4L0QA 1VIDA 2WD8A 1GR0A 1ZVKA 3GOQA 2ODRD 2RGGA 4HZUA 2SCUB 4DZRA 1CXZA 3LWZA 4GI2A 4S1OA 2XCLA 3O8QB 5GINE 5BRNA 1ORWA 2J59A 4TN1A 2BFFB 5SY9A 4YJHB 4ZOLF 5JJ5A 4YBAA 1U0BB 1CRPA 3FBWA 1EDOA 4X93A 1DBIA 1H2FA 1KRXA 2ZSDA 1SCKA 3DM5A 1UMCA 5H5JA 3KEQA 1SUIA 2R8RA 2B94A 1V37A 1KJIA 3MLAA 4Z54A 1CUCA 3NMUF 3OF5A 2GAFA 3PIDA 5CGQB 3KOOA 1EIZA 3QPWA 2MDTA 1HWYA 3ROTA 3ZDBA 3DWGA 2F43A 1HYHA 2B82A 1BRTA 2B8WA 3GEMA 1XF9A 3GJYA 3HCNA 2WG0A 3PNMA 2BZSA 1Q0ZA 4OH7A 4C0SA 5JS8A 1UAAA 3N2KA 3QKIA 1BVUA 2N9UA 3TR0A 2OM2A 1GCUA 1QV7A 3AJAA 1U8FO 4JI6B 3ITDA 3MIZA 4WUVA 1SVKA 2XA9A 2PZAA 3GLHA 4BMYA 1UWKA 1V3QE 2QMUA 1E6WA 4LISA 3VVMA 3I9OA 4NXNB 3AFHA 1U9ZA 3M9XA 3FETA 3GFFA 4WFJA 4HH4A 1M6VB 3GCWA 1JR2A 4UBKA 4X85A 3ZX4A 1G42A 5JFTA 2JFPA 4QVIA 3QWAA 4ZCSA 1FK8A 1P33A 1U5BB 4M83A 1HDEA 3E7XA 2WTNA 4R1MA 4YMSA 3H4TA 1T9CA 2PR7A 4EHKA 1R0XA 4X20A 2BR5A 3D4OA 2BP7A 2R5FA 5GONA 2EJUA 3WVNA 4CV0A 3WLRA 1MIOB 4DUGA 4YRSA 3U3WA 3OF3A 3RVMA 1YD7A 5F21A 5L45A 4IF4A 1VTKA 4A23A 3IMCA 4XB2A 4TQ9A 5FQNA 4C3VA 2VO1A 4YBRA 5C32A 5JFOA 3KAJA 2ZSKA 3G49A 4FR2A 3TD6A 5B12A 1NXXA 2V6IA 3G2QA 4R81A 3FYUA 3TIXB 3JQ9A 4LAFA 3ZLVA 4BMVA 4IZOA 1E62A 1GM5A 1FYWA 1GZ4A 2OBBA 5BN4B 4DV2B 3CC8A 4KAJA 3F6PA 1NR5A 1RAFA 3QA9A 1J8DA 3G9TA 3PDHA 5JRJA 1G1AA 2HA0A 3K6SA 1GEGA 4EZIA 3JXEA 1C9MA 4GPZA 2BZ0A 2EFHB 2C5FA 3QXJA 4YG1A 4DLUA 4JZKA 4KIUA 5ALWA 2WVAA 1T9BA 2QV7A 4JDPA 3EGWA 3NKLA 4Q9NA 2GUWA 4EA9A 1NFQA 3H2GA 2FW0A 2GD6A 3D5QA 4L07A 5C1IA 3VPXA 1T4CA 4TTAA 3ZKWB 1VSTA 3OJWA 4EKNB 3G0OA 1GFZA 2XMCA 4HAIA 1NXOA 4J6FA 1NUHA 4JD5A 5EZQA 2GTPA 3RBZA 1SQFA 2O07A 5ALGA 5CH3A 4Z49A 1C7JA 2JF0A 2QZ9A 3UJHA 1IUKA 4J1SA 4K3UA 1SVLA 1UBCA 2GM9A 3I9JA 3WJ2A 3ZXSA 4B2LA 4EPYA 4OATA 2AR9A 3FNFA 4JHXA 2B8JA 2QTMA 4KQIA 2JK1A 2XITA 2H1LA 2O3UA 4E4RA 4XRGA 3D6HA 3WGLA 1VMEA 3IVPA 2PL9A 3W6NA 5G1NA 3ZCVA 1BSVA 2WU3A 1JBKA 4QU0A 3VGPA 4Y6RA 1DAEA 1AB5A 1NBMA 3PLRA 5AI8A 4TXLA 3AEKA 1QFYA 4OK3A 3R7SA 3IDQA 5CGZA 1KK2A 1ZD2P 5HJ5A 1G9XA 4G81A 2KEKA 4CWAA 2C4WA 1AIPA 4CF6A 2GEKA 3RFUA 3WL4A 4R3WA 3IEKA 3DHEA 4GDFA 3MJRA 2VYCA 4Z9XA 3TLAA 2WKSA 1T36B 3MMPA 3H7IA 2XXBA 4TKUB 4R8VA 5FF9A 1EM8A 1EVQA 4Y30A 2DUNA 3SJZA 1D8TA 3WGHA 2GZ3A 4LYAA 3WK6A 1OD6A 3SJBA 1OZGA 1ZMOA 2XTAA 1G0NA 3M70A 1VL0A 4RK6A 4E30A 3OEHD 4KO8A 2SKDA 5BYAA 1MR3F 1V5FA 3I64A 3BH0A 4H7EA 5I9TA 3WC4A 2I03A 1DU4A 2VYND 1NBHA 2JH3A 1R6AA 5GPBA 4FFMA 1FLNA 1TQ8A 1CR0A 1N5MA 1X70A 2G25A 2XUFA 3AHGA 2ID8A 1L7QA 4IQ8A 4R41A 2Z30A 5MN4A 2GXAA 3W6UA 1RHKA 4J16C 3WIVA 2AHOA 3CUSA 4KIGA 3FRHA 2IX3A 1FDSA 3BCUA 1QVVA 1T3TA 1Y81A 1SPBS 2IF0A 2P9HA 2O1EA 2WJ4A 4AF7A 1NVMB 3REQB 4CM7A 1GQ2A 4IFBA 5AJUA 3UA3A 3DVSX 2DLCX 1MG5A 4D3ZA 1MPXA 4ALJA 5BVGA 2FX3A 4YJFA 1YHNA 3ONFA 3KLMX 2HNBA 3NANA 2WMYA 4KREA 4GPTA 1CUGA 5AKKA 4FT2A 1L9KA 1T1IA 2XA1A 2HCTA 1XZPA 2P2CA 3EASA 4MWZA 4EFNA 3M6IA 2JA2A 4NU0A 5DFAA 5EN4A 4BNYA 4Z0HO 1JR3A 4YRRA 3T5CA 1ZPDA 5A7FA 4Q9KA 1U1IA 3IBCA 3LX8A 3B82A 4MRPA 1DEHA 3F6CA 2IZ5A 1YR8A 3GGSA 4CIAA 1ADFA 4AZVA 2O1WA 4E5NA 1E2DA 2XF8A 5GWXA 5JW6A 3BCSA 4M9UA 3OA2A 1GGVA 3C97A 2C2BA 4FOLA 2XNCA 4P54A 4EJ2A 1GPWB 2GPAA 5JQGF 1A72A 1CNFA 3KWMA 5K0LA 4E94A 3MSCA 1RHQA 4MUAA 3VUEA 2XKKA 1ZMXA 4CMEC 1XEXB 3R5FA 2X5KO 3DZCA 1JI0A 2GCOA 3U0VA 5ALFA 2AYXA 1GQYA 3I0MA 3WLQA 2Z5GA 2B9EA 1Z63A 3AFOA 5HF8A 3OLZA 4HN4B 1Z26A 4R84A 1AKTA 3DOFA 1SIUA 4N76A 4IVZA 1J25A 1C3OA 2IPXA 3GJQA 4F9EA 3PDIB 5JYBA 1JEDA 2HMWA 1ZNXA 1QIFA 2OHIA 2VP6A 3IO3A 3N0TA 4JWTA 4MB6A 5DXJA 5E6RA 3RJZA 4EA6A 3QVSA 2WUWE 5C7LO 2WU1A 4NPHA 2WR8A 3PPXA 4P4UA 2VP9A 3FXAA 5FT9A 1DBVO 2EZUA 3LQ4A 1OV6A 1PG2A 2VXYA 3ROFA 3TQRA 3ENNA 5CDFA 3BC1A 1KDRA 1THTA 1V35A 2IEBA 1HI9A 4P98A 3RD5A 5JBQA 4YXWA 5JALA 5BMVA 1TA4A 1QH1A 4URVR 1UZUA 2RMKA 1SM4A 1EE2A 1ECJA 3C6XA 1LKZA 1V8ZA 4TLEA 5T41A 4UM9B 1DDOA 4DQLA 3RC7A 4AWAA 4US1R 4W7HA 4E5UA 4CVNA 1MOPA 1MPTA 2DMRA 1O3YA 1RYEA 1A97A 1GPDG 2DQKA 2OFOA 4DMLA 1AV6A 1SHUX 2Q9UA 3STVA 5F4BA 3WK7A 4YRMA 1L5QA 1USGA 1DOZA 2FSVA 1RI2A 3P27A 1R8JA 4JAVC 3KU4A 1UK8A 2CD9A 3U40A 1K3FA 5IXJA 2C94A 5E0KB 1VXRA 4HNSA 3MMXA 2RGUA 4L8FA 2PGLA 3CJRA 4RIHA 1ZO8A 3T12A 1RDFA 4IOMA 2GPBA 4S12A 1XO1A 3DOIA 3OVMA 4WERA 3MTGA 2D0IA 4EJFA 1M6HA 4RFVA 2HPAA 3ER6A 2VPPA 2PHZA 5EVCA 5CIYA 1XDGA 1SR8A 4UM9D 2XUGA 1SCAA 4DB4A 2EWTA 3M1YA 2QTAA 4KMSA 1ZVVA 4UAUA 1XZBA 3DVAB 1BEZA 1IEXA 4AX4A 1M5TA 1NP7A 3B12A 3LI2A 5WRFA 3BWCA 4B4OA 2V6BA 1H66A 2A33A 3EDYA 1ZZCA 3BQMB 3UVEA 5C5EA 2PMKA 3QJGA 1YZHA 4M9QA 4C9BA 1M33A 4MUEA 3O03A 2YXNA 3G0CA 2Z95A 2HHHB 2NMVA 3TS1A 4IHKA 3INYA 4RV9A 4BVHA 4JBYA 2O14A 3C24A 3FN4A 2CNBA 4H0CA 4V03A 1J99A 1PG5A 1W5FA 2Z5LA 3L6CA 4KJZA 1B7GO 4O2AB 4PZLA 4ZDJA 1CDEA 1H2XA 1IYZA 3QVMA 5G2OA 1PT8A 4AICA 1SQ8A 2X2EA 4DR1B 1EGQA 2N1MA 2QVZX 2A78A 1R69A 1HMYA 2D5AA 2D8AA 2ZRCA 3N8KA 5BSMA 2JLXA 3QELB 2ZPUA 2NO1A 1Z8FA 3PZRA 1LQTA 1VBNA 5KI6A 1RRPA 1XTVA 1N1GA 1YQUA 2H16A 1V96A 2W00A 3CG0A 3KSDO 3PGVA 1YZFA 1DG1G 4WBSA 1IEQA 5DYGA 4D43A 5M29A 4DBLC 4Q4DA 3QM1A 3HJGA 1GU0A 2D00A 1I2DA 2NZYA 2ZAGA 3HYSA 3VVLA 1ZMBA 2VHZA 4NESA 4N9QA 4DMHA 3L4EA 4DOMA 4MH0R 4O1IA 1U7UA 2JGMA 2XTZA 3SNKA 2V58A 4MQ6A 3MJFA 3QUTA 3TTYA 2Y1DA 7ADHA 1WZCA 2PGOA 1R63A 4Q05A 1E2FA 1DBRA 1QGUB 2GCPA 1D09A 2WTMA 3MMZA 4G37A 4YCBA 3JQ8A 4IFIA 1MHPA 1L4FA 1PP4A 1MH1A 2UVPB 1DS6A 3EA0A 2RGNC 1EB8A 3T1TA 5BN3A 4EW1A 2QQ0A 1HDXA 5IJ0B 3USCS 2CLCX 1VLMA 1UBOS 1Q22A 4N5NA 5DCWA 5T57A 1K0UA 3RASA 1ZJJA 3SVZA 3VR4H 3HI4A 2R9VA 5AVQA 5GADl 4OMUA 4LJLA 3CUTA 3IKMB 1EWRA 4KQMA 2VJPA 1BXRA 3E9YA 3KDAA 4N8SA 3LUGA 2F8MA 1MNAA 4WH0A 1QB8A 1Z4JA 5CCDA 4YAKA 1IBKB 4HDSA 4A2QA 5L3RA 2EX4A 1FFAA 4KL8S 2PR2A 4YYZA 4N0DA 2YHIA 1GZDA 1J5PA 2J09A 2RHBA 3V4PB 1YQ9A 2DUJA 2H1WA 2YJ4A 3ZVLA 1LRLA 5AM1A 3WGZA 3ERCA 4Y18A 1DUIA 1QB7A 1T3ZA 4YO8A 5EWLB 5HFJA 1DQRA 5J4HA 1T13A 2GMWA 2W7TA 1YKSA 2YQ4A 4GOKA 1ZNQO 1SAYA 4IEFB 2FFBA 2XUOA 4BO5A 4R9SA 3K6KA 4NH4A 1VL8A 3O83A 1P9OA 3PQ7A 3QU5A 1UINA 4FLFA 5B7PA 5IYZB 1BMQA 3RYCA 1HLPA 1WU7A 2Y0CA 4RKWA 2QY9A 3RCBA 3B8HA 3UUGA 5BNZA 3V9PA 3FOCA 4LRUA 5JAOA 1ICIA 3MERA 4M1MA 1VPWA 1HQKA 1Q1QA 3PSAA 1W0KD 3BQNB 3LC7O 1S4QA 3GZNB 1BXGA 4V02A 5ER9A 5J23A 4Y3UA 4AG6A 3LFUA 3ZS9A 4Z7OB 1G21B 2GAJA 4XUEA 4OGWA 3DONA 5EA2A 2PXCA 4QTTB 2ZRDA 3BBPA 3ITNA 2W22A 3UV7A 2A5JA 5LB2A 3ZBUA 4N0EA 3TL3A 1UF9A 2CK3D 4WJZA 4TS4A 2W2NA 3DF9A 4HPXB 1R88A 3HJRA 2XNJA 2YXLA 4KMMA 3HU3A 1HYEA 1IE3A 3O8CA 3LOPA 3NNDA 3UQYS 1OV4A 2NIPA 1PD1A 4P80A 3WXBA 2BF7A 4BP1A 1RT9A 4YR9A 5CB6A 3DLHA 1BTOA 2AKYA 4GKVA 3SHVA 1C7FA 2BFBA 4D4LA 5KYYB 2JI7A 3VR3A 3I1YA 3DMTA 4N47A 4YC7A 3DBRB 5KX5F 3ICWA 1XMXA 4LFBB 2O0JA 2VHQA 1N6NA 2YYSA 3P94A 1QOZA 2RGYA 4ETMA 1AC5A 3ND8A 4WW0A 4PIVA 4Z9YA 5DP2A 3WRXA 4HV4A 3L8HA 4N0QA 2QTHA 2A3RA 2B8TA 2AXEA 5CLJA 1PT6A 4A6PA 4FFVA 4HWOA 4MUBA 5KSOA 1ODCA 4JYMA 4YUAA 5IT9A 5A5FA 1NAHA 2BI7A 1BGVA 2H29A 2ZJZA 2P11A 2I1LA 1ZZEA 3VC3A 1SG6A 2HLNA 4E5YA 4B1FA 4K0RA 4LJ7A 4Y6QA 3VNQA 1JNXX 5A02A 2C61A 6NULA 5HX7A 4A0QA 2FEOA 5K6AC 1JFTA 2NW6A 4INZA 3TZHA 4B6QA 4NCKA 1VL6A 3T52A 1KGSA 1M2VA 3VC7A 3ZE0B 2O3SA 2HWXA 4O4JB 2ZQYA 3GNSA 4BVKA 5INTA 1ZNWA 1EMDA 4N41A 4H6VA 3LCRA 1YQQA 4BQEA 3LDHA 4PN3A 5T4BA 1CHNA 3ISJA 3UTDA 3GLIA 1FQJA 1AHNA 2PA0A 2TMDA 4U9IS 1YVUA 2NG1A 2FRDA 1OLUA 2B5OA 4FR5A 4C89A 3WL3A 4K03A 2MSLA 1UXGA 3VDMA 1JPVA 5ALXA 1Q0SA 3NYQA 4JLWA 4WESB 1F7VA 1Y4SA 1TCUA 4PS1A 2DPHA 4RQTA 1KDZA 3W5HA 1JT9A 3EA4A 4B76A 1MN6A 2XWJI 3FWNA 5CBPB 3KCNA 4NYJR 5KSZA 2W2PA 1JECA 1JEQA 4CQLB 2VZLA 2VVTA 5DSZA 4ZZ0A 4LKRA 1XZAA 2GAOA 4EB8A 1GPUA 2FZKA 1A76A 1ILWA 4GDMA 4CKWA 5I4CA 1M66A 3ADDA 1EXNA 1RI1A 3TNYA 2LBPA 4GF5A 5JH7F 2XH8A 3HKEA 1I7PA 2HU5A 3A4TA 4LGYA 2GBFA 3BJMA 3WLHA 4ZEWA 4ALMA 1T25A 2A14A 2XMGA 4KAXA 1ETHA 4TKVB 3U3OA 4J3JA 1J2JA 2WV7A 3K32A 4V2UA 4EW6A 1QIEA 3BOSA 2FXIA 1G5FA 2JIZA 2X3FA 1XV5A 2CXXA 3GEGA 3P2KA 4P08A 5HFAA 2W71A 3KQKA 3ZLUA 3DZFA 3NFYA 3D6VA 2AWOA 3OFNA 3PQ8A 2AR7A 4LHXA 2VDWB 2ZRKA 1T2DA 4IO0A 3AR7A 4NV1A 4ZVPA 1NHGA 1SHKA 3GPCA 3NBQA 5GOZA 4AU1A 2QDKA 4GZMA 4P1ZA 4P31A 3O9MA 4U7WA 2MHCA 3KALA 3FPAA 3L3BA 3SGLA 5KIAA 2FJUA 1DQZA 1CJCA 1Y4DE 3IT2A 1KEWA 5CB8A 2QTVB 4I6UA 3TDNA 1JJAA 2UUOA 1JIVA 1JWLA 1NI4B 2JFXA 1IWBB 1HKUA 2G5CA 4OLFA 4M8NE 3PHLA 4GYYA 4KBFA 1P62B 4EPTA 1HDGO 1URPA 3I2HA 3CECA 1Y8RA 4HEHA 1S8FA 4Z7JA 2D8MA 5AHWA 4WFKA 5CT9A 2OOKA 1ECFA 1YVDA 3WK4A 2JFWA 1ZN9A 4O25A 4WD3A 4XWWA 2LUOA 2VBCA 5HUJA 3JYQA 1SZJG 1ZOIA 2YUTA 1I32A 1DP4A 1R9NA 3O92A 4N5DA 2H5EA 1J0EA 1NXSA 5E2IA 4R1SA 4C7OB 1U1DA 2JI6A 2IVBA 3KQNA 1J7KA 3TB4A 5TQJA 1BCSB 3GMDA 3HO6A 4E1BA 1KYZA 2VTVA 1EXDA 2ORED 5CEEA 4UREA 1H9AA 3BXZA 1EEHA 1EUDA 4JLKA 3TUIC 5B1YA 2VLIA 5GAJA 4DR5B 3GPBA 3GRRA 2X1LA 4BMSA 1YIAA 3A9YA 1TDJA 2EW2A 2ZUWA 1DBWA 1MVNA 3AEQA 1FFHA 1XMVA 2VDKB 3F4LA 3I05A 4FGKA 4G01B 5FFMA 4Z1MA 3WYDA 2LE0A 1G8KA 1V43A 3ESYA 1NAIA 4HB4A 4JR0A 4ND3A 3Q8XB 4W9NA 3VR0A 3FPLA 3LVQE 1KSHA 3EOAI 4NYMR 1U8UA 2X5OA 1W85A 2OY0A 4EYQA 5JAMA 3ANTA 2RDMA 4HBZA 2W98A 5CG2A 1SOMA 3FGPA 5EEGA 3RUDA 5BURA 4RNDB 3EVDA 3HGQA 1BX0A 3P2YA 5E2BA 1O1YA 4KQWA 1PJBA 5ECDA 5HM6A 4I1PA 2XGSA 1VMIA 2EJBA 4UHJA 2FMIA 4COOA 4QWMA 1FIUA 3BE4A 1G6OA 3OFJA 1TUBB 4HRYA 4KFSA 4NBKA 4CCSA 1X0VA 4LJ8A 1XTJA 3S55A 5BP7A 3OTIA 4O6VA 2VXOA 1PL0A 4YUVA 5E3HA 3LXMA 4RELA 5IDYA 3VOTA 2RIRA 2VL7A 1W4RA 2XMZA 4IIGA 1WXFA 4EZEA 4E88A 2EIXA 3SEZA 5D7BA 1C1XB 3PUWA 4CL0A 2BPOA 2PXXA 2E4ZA 4DLWA 1Q74A 2YMQA 1RADA 2GXUA 1W1IA 3IBTA 3QEMA 2O6LA 4DCUA 1BX1A 5DM70 5BN1A 3ORSA 3ZK7A 4RJLA 2BMVA 4QTZA 1IXRC 5K45A 4ASUA 5AKHA 1J0CA 1WIZA 3ASVA 1LI5A 2PMFA 2X6RA 3P52A 3DEZA 4HEJA 2ADFA 1KU0A 4ZN6A 4IFEA 3KQMA 2OHJA 4R1LA 4X1OA 4LSMA 1ZIPA 1YRWA 3T9DA 2JASA 4PO9A 1M8JA 2F3TA 1AK2A 3NBFA 1V47A 3L1UA 1BH2A 1QP8A 1NW4A 1VIAA 3KAKA 3G6WA 3O7MA 4LGVA 4RF5A 4JB8A 3FHOA 4NBUA 4RPLA 3EGXA 1UKVY 2KPJA 2NZWA 2ZDGA 4TTPA 1XCPA 1V25A 1QKKA 2JW5A 2XT6A 5IZCC 2WZQA 1LBTA 4RAQA 2PGAA 2GKSA 4BNNA 2C7QA 3BA6A 1M8PA 3NZEA 2ID7A 1N9GA 3HP4A 4Z4EA 1UXOA 2XEDA 3FF4A 4MGHA 1KH3A 5ER6A 5FUVA 5KEIA 1ILEA 4HD8A 2GJ8A 1PSZA 4RJKA 1N6PA 1DDIA 3H8JA 3QZUA 5LBIA 4WECA 4L4YA 1SBCA 4MRVA 3T0IA 4F9FA 5AVWA 2MEZA 4HK4A 3V4LA 4P0PB 2NT4A 3H5WA 1X3LA 3C7DB 4ZQEA 1OZHA 2HF2A 2O3QA 4ITVA 5TMBA 1Y8QB 1WH8A 5ALPA 2GILA 3BZWA 2C2XA 3ZYCA 3DB1A 3PHGA 4RORA 1OW3B 3ZXIA 2YFQA 4GOND 2AXVA 3DTVD 4EQ6B 1XPRA 1DC3A 3DFIA 3FOZA 2HX1A 1PX2A 4L5YA 3LZ6A 2VDQB 5JZMA 4JEMA 2A84A 3DE1X 2VXCA 4JBHA 4S05A 4XYGA 2XYQA 2JAPA 1XHFA 1TRKA 3QE3A 4UDOA 1TMYA 2IYOA 4TMZA 3Q10A 1NBIA 4UXJA 5HEKA 5HF5A 3G9UA 3WFJA 2IE0A 5CB4A 1TLLA 1JEYA 3EQ6A 4DJTA 3KQQA 2DWQA 1WABA 1GQQA 3RKUA 4Q4HA 1X13A 2EBUA 2NU6B 2PSDA 4FUQA 4RIFA 3IVMA 3ZH9B 3SWWA 1US8A 1RJ9A 4WHMA 4X45A 4QFBA 4CMIA 2O59A 1JHZA 2F59A 1MC4A 1QGDA 1HTTA 2MJLA 2BIFA 2JJ2A 3KP1A 4RY9A 3T7TA 1IY0A 4DEYA 2PKQP 2ZYSA 2HRCA 1U0EA 2G5TA 3SCGA 2TMKA 4LFCB 4F5WA 1WETA 4CV2A 2J9XB 2PD6A 4DC1A 2E87A 1JFVA 2B2CA 1NPTO 3M3HA 4BLOA 4Q02A 4DF3A 3USZA 4E3WA 2NNWB 1V7QA 2YXDA 3AR9A 3CLUD 5MN6A 1N33B 3WR5A 1MFQC 5D6NA 3PGJA 4MB2A 4N12A 3VTKA 1L4BA 3IPYA 3LVFO 1MT0A 3L4BA 1EK6A 1RPTA 1WUHS 2QE7D 2AN1A 4MYHA 4RD4A 2C2MA 3RVPA 2HIGA 4EABA 3WL6A 4MS3A 4F84A 1NVGA 5AW3A 3EIHA 3QYFA 4EY3A 4WKPA 5D6OA 2WWGA 3SFZA 1JB1A 3V2GA 1VPVA 4YLGA 1F4VA 3A10A 4UD2A 3QLUA 4I55A 4XUGB 3TL2A 4RPGA 3ULKA 2W6JA 2ZIXA 1BA2A 3F9CA 3W5IA 3DTNA 4Q01A 4KXQA 2IHNA 4TTSA 2VDMB 5FNVA 1P7CA 3QVKA 4ZRNA 2I1VB 3PUZA 5DT9A 1SXJA 4MR8A 2ZJ8A 3SYKA 2GYVA 3TIFA 1GTSA 2QRJA 3Q1KA 3N8NA 4BNGA 4DDHA 4JLBA 3ENZA 3EFOB 3WLIA 1E8DA 1C3XA 1R64A 2VJMA 2XE8A 2GTIA 2YIVX 4IUBS 5KNDH 5KVAA 4YDHB 3SNHA 4UNPA 3HCWA 4E5PA 4MVJM 1RZRD 4Y6OA 5TJHA 4M0DA 2A94A 2WRZA 3IVCA 3MWDA 3YASA 4E1AA 3JZMA 4XEHA 1WKBA 3IEMA 2AL7A 3JV7A 3AI2A 2H1IA 1L4LA 5HW0A 3DBHA 3PTZA 2YV3A 2B4YA 5T8KC 2ZR7A 4OVKA 2HQRA 1KE2A 2G6TA 2OXFA 2PMEA 2QJWA 1R66A 2AC2A 3OSZA 4ZAFA 3E1SA 5ISMA 1PQYA 4JJ7A 3RIYA 3GH1A 3NTOA 2CXQA 4WDQA 1CJVC 3I4CA 5F98A 2QD5A 4FGLA 4IIJF 3JQCA 1HLDA 4UDNA 1TADA 1H93A 3ZY5A 3AJEA 3BHMA 4U7JA 1IVSA 3HZIB 3SAJA 1KEVA 4LDJA 4JI1B 4EMUA 2X0NA 4B4UA 3WLEA 1UDBA 2BEWB 5AIBA 1GARA 4AMYA 2O8FA 1EK2A 3L0SA 4NARA 1T1EA 3R09A 4KAAA 3U2QA 1VKRA 4ZCLA 1MX5A 3K20A 2JCXA 1U7TA 1NYLA 1B26A 1CR2A 5AK0A 2W2KB 2OK7A 3QFHA 4AJNA 4FKMA 3HXOA 2FYTA 3ANMA 1MTZA 3JVEA 4ETNA 1L5VA 1AHIA 2BSXA 2WVHA 3E82A 3HUDA 1EDDA 1YU9A 2BDTA 3FYHA 3RVNA 3VZSA 6Q21A 4MJLA 4RABA 4UCQA 4F7WA 4Z3KA 1UAYA 4CXMA 3WTCA 1TTQB 4L50A 4MQLA 4RHYA 2GFHA 2VSFA 5IP5A 2JRCA 4KFUA 3ZWMA 3SZGA 2P6PA 4D3DA 5EKUA 5EWMA 2WIGA 1OLSA 1WXGA 3BMQA 4EKEA 3T6KA 4MTCA 1A5SB 2HD4A 4JL5A 4RQBA 4KP7A 1AM4D 4B0PA 1Z2CA 3S3TA 4DLZA 3IDSA 2AK3A 3KKQA 1ORVA 3HL4A 1RJGA 5EE0A 2OXIA 3HDVA 5K2OA 4B46A 2VTBA 3CVWA 1DIHA 3KXPA 4HDMB 3Q2OA 3SC2B 3TTTA 1XFAA 4RDCA 2ANBA 1THZA 2Y9PB 2OT3B 3GLVA 3MWYW 4PXYA 2LYLA 1KKMA 1UCFA 1ZP6A 2H4JA 3D7RA 3OBBA 3LX6A 2PWZA 3M83A 3SG0A 3U7EB 4QZVA 3KT8A 5CVVA 3PVSA 2ZATA 3MTAA 5IN4A 4IILA 1IZ9A 3B85A 3NVKI 1XLUA 2FP4A 4Z59A 4EMTA 1ZX1A 3FCCA 3MCUA 5IKMA 1NW6A 2IYLD 4ZMRA 4YRDA 1NQAO 3Q3HA 2HO5A 2Q2OA 5AH0A 4CTNA 2W2TA 3H4IA 4L5BA 1YK0A 1ZL2A 2XWBF 5KU7A 2IU4A 3CNLA 3LTNC 3DEIA 3E9MA 3L1KA 3LDAA 5EIEA 5FTWA 1KZ1A 2R87A 2WWFA 4JDUA 4Q7MB 5EZYA 2RB5A 3H1EA 2ZM6B 2O2HA 1O94C 3EZXA 2PXUA 5JV5A 3NHMA 3KOYA 1CY2A 4OGLA 1ADYA 2V6JA 4MQUA 3HACA 1OLOA 1VHWA 5BW8A 1DO8A 5AI4A 3E4DA 4P32A 3G85A 5EKXA 4CM9A 4GMHA 1CDDA 3T7SA 5FR2A 4Q24A 4ID9A 5C5CA 4ZVOA 1U4OA 3UM9A 1G4HA 4G23A 1WL8A 4LZOA 2HPHA 5IF9A 1AO0A 3R76A 1N77A 2P9FA 1QVWA 1G21E 2O0LA 3UAZA 3ZQ4A 5U9CA 1D3AA 2GYUA 4UEOA 3W4JA 3CW2A 3Q15C 4O08A 5ESDA 3EPPA 4TLLB 3WKAA 1TQHA 3I09A 3PUKA 2VK2A 1OI2A 3PICA 1SVUA 3H97A 4YECA 1G55A 5GV7A 5IEBA 5IH3A 2VAWA 3LFPA 2A1TR 1CT9A 1EZZA 2OAGA 3Q4GA 4OHWA 2BE7A 1HGXA 3L06A 4RY2A 3WRVA 4G5XA 4Q1BA 5I9BA 3KYCB 1KAOA 4HDNB 1IRXA 1S2GA 2WD7B 4UTRA 1BXZA 1CF2O 4KX5A 3ZWYA 4G09A 4IXWA 3T3PB 3ZIUA 2RGEA 2OXEA 4WXYB 1LWOA 2Z58A 4OFBA 2YWBA 2J67A 2NZ2A 4I1SA 4TMKA 2JHPA 4UUNA 4A1FA 4DR2B 4J91A 4X4GA 1Z4OA 4N7MA 1KS2A 1VZ2A 4NDAA 3V1KA 3WA7A 5FJJA 2ODNA 3OLQA 1XNHA 2F48A 4YJ2F 2ECPA 4ZOLA 1J2EA 3K1AA 3QPDA 5ESRA 4TMVA 4R8SA 1C2YA 2XVAA 1OWNA 1DV1A 1Y0BA 1A82A 3MJTA 4XWYA 4G0ZA 5JJIA 4BY9E 1L9XA 3QEAZ 3I1IA 3ZQKA 3LKVA 2FJ0A 2VRCA 3NBXX 3HWRA 2WP0A 5BN5B 1OXTA 4BRSA 4YUYA 4QYIB 5I4IA 1T8WA 1XEWY 3BJIC 4HFMA 3A1SA 3RDPA 3QFFA 1DRKA 2IYSA 2XCUA 5HS6A 5GGXA 2P5SA 3ZZNA 1W48A 4B8ZA 1G7TA 2QAGA 4TTTS 4TRNA 1T5SA 2JFFA 2JGDA 2QJFA 4RDIA 1WG8A 2NZUG 1MQAA 3VHXB 1IRIA 1XCLA 5K0TA 2AMLA 3I04A 3OPMA 1T2AA 2VUHB 4KBGA 4N3NA 3SD7A 4ARVA 4D6PA 4TOIA 2GBLA 2XJ4A 2FI1A 4IHJF 2VOEA 1OC2A 1GCGA 2Z83A 3MIIA 1GZ5A 2W58A 3DCNA 3H5NA 3O3MB 1X80A 4GWGA 1QLWA 2HK9A 4TKZA 4F21A 1A9XA 1QS0B 4GBGA 4MWCA 3IAM1 3SF8B 1QQTA 1IB0A 2R1ZA 3IR7A 1NJ1A 3DXYA 4JK3A 4ARZB 1OVGA 3H9JA 3ZDYB 1O5OA 4GYKA 2L18A 3RUCA 3FPCA 4KE6A 1UEXC 1L5HA 1E4EA 4BOYA 5FL3A 3ZDXB 3I9V1 5HDQA 4IEIA 2NO6A 5A9SA 5KTSA 2WKWA 1NVBA 4YFYA 5A4IS 4PS0A 2PANA 3C3CA 3L18A 4JBXA 4YIKA 4PCLA 2WZDA 3CA8A 1KJYA 2P2SA 3D3JA 3NO4A 5CFLA 3TVYA 1SH7A 3W90A 4OI0A 3N2KB 3O8OB 1IM2A 1RE0A 2C2HA 3R4VA 5DCUA 5TMEA 3H0EA 3P0IA 1ULHA 5K0SA 4FR0A 3S5JA 3GCDA 4MAAA 2Q9BA 2EBFX 4AWBA 2IK8A 5YASA 4BO4A 3ZHCA 2AFHA 3QH4A 1S5PA 1O54A 5BUQA 5G0WA 5C52B 1XIVA 4GVLA 4BLQA 3WKCA 5EMHA 1A0OA 1TMKA 2EZ9A 3AO0B 2YWRA 3Q7RA 3GFGA 3MT7A 4HYTA 3SOZA 4JBNA 4FFPA 4PQRA 1FU4A 2CYCA 2P3SA 5ESXA 2AG6A 3OPYI 3TQQA 1KAMA 1FRVA 4EGFA 5JAIA 3FGNA 3FPSA 4JY7A 1FFDA 5M34A 4Q16A 3AF2A 4PNZA 4HRVA 3M0EA 3NHWA 3R3VA 4QODA 1IXYA 5DV9A 4A8JA 1VBMA 4ZO4A 1QFMA 1SK9A 5HZMA 5JZVA 3SSNA 3GJ7A 1OXSC 5D84A 4D8XA 1P8JA 3D0RA 3P9PA 2YV5A 2NLOA 4AUNA 1J23A 1I4WA 4V24A 3RO7A 3EVFA 2CL6X 4F6LA 2H0AA 3CTPA 4NSNA 3HP1A 5CEJA 5BV0A 3OE1A 4N18A 4N6OA 4RE5A 2I3ZA 3RVSA 4G0NA 3WGOA 1R0BA 4GLLA 3WLMA 4E2ZA 1ZWKA 1A7JA 4IY1A 4IV0A 4TWRA 1JVNA 3UXEA 4P4GA 4QM7A 3CMMA 2JGNA 4AYTA 1T4BA 3K6SB 1ADGA 4KXMA 2R00A 2DFPA 5AOAA 1ZG3A 3LGAA 1N8TA 2SKCA 2OXCA 5CPBA 1TF2A 1FMLA 4MULA 3S2GA 2GZHA 1RKVA 2Q50A 3RVOA 3T94A 3LY5A 1O4XA 4EUFA 1KTIA 2N46A 4ZCIA 3PFGA 3W4IA 2P9TA 2A4KA 2Z3VA 4TS9A 5DYYA 3IDZA 3U9SA 1U0HC 3OM0A 2HN9A 1J2RA 2DKOA 3OH8A 3VAYA 1TM1E 1EH5A 1Y3BE 2WWRA 3IVRA 1M6NA 2FW7A 1YB4A 3LC2O 1EVZA 3CV3A 1KBZA 3C3JA 4HPWA 4J43A 3X44A 4DLAA 3A3NA 4RSGA 4N48A 5DU2A 2J41A 2CNDA 2LZ0A 4CDNA 1KBQA 1KY5A 3GGGA 3PU6A 1ZZ7A 1KZHA 3SF0A 2H00A 1E64A 2XKBA 3AEKB 4QT0A 3O1IC 4IM7A 1X0XA 2I2BA 4UW9A 5FWAA 3GLGA 5K0ZA 2YZ2A 3W4KA 4HVCA 1WPQA 4RK1A 2Q4BA 2P65A 2M6LA 3E0QA 4F2GA 1HL7A 2HA2A 1AX9A 1XD9A 2EL7A 2UZ4A 4CF7A 3EPLA 4UMDA 1QM5A 4MV9A 2P3OA 3SU8A 3PWZA 2QM0A 2ZVDA 1UQTA 2OG2A 2LYQA 1VPLA 2VC2B 1NQXA 5JQGA 2QT9A 2ZYVX 4BUZA 2RE8A 1AZWA 1LGYA 1HETA 4FFOA 1M1YA 5CNKA 2JKZA 3CLVA 2ZZMA 1J06A 1X7HA 2YHBA 1I7NA 1KRHA 4FZVA 3TOXA 1MAHA 4IKOA 2PXEA 3IQHX 3MCWA 4REQB 5IKEA 2ZSJA 5EWJA 1KPHA 2YOGA 2BGUA 2PX0A 4GLJA 2IOHA 3FCEA 4KX3A 3WV4A 1VCIA 2CXPA 5HKLA 3ZK9A 4D6XA 4OBEA 1H2WA 5I7VA 1WBBA 1Y1LA 3RTBA 2ZYHA 4ALNA 3TX2A 1NVTA 2PVCA 3IXMA 4FYXA 4WFIA 1AS3A 2XECA 2HPVA 1Y1RA 3EHDA 4PICA 1KDYA 1R0LA 5LQAA 1Z5GA 2R5NA 1IXKA 2PXBA 1RWXA 1I33A 1QOPB 1JFFB 4RCYA 4UBLA 5LYJF 1ZEMA 3K09A 2CD7A 2PKEA 2FF5A 3HI6A 2W4QA 4J0EA 2ZIZA 5KNBH 2V8BA 2H92A 4X6XA 4BWVA 1R6TA 2Z4RA 3HCPA 5I01A 1D2AA 5HDBB 2G67A 4DA0A 1DEOA 2G0NA 2QL6A 4G89A 4WZBE 3UPDA 4XVUA 1AU9A 4KKXB 4LSGA 5JS7A 4J6EA 3WK5A 4M49A 3MW8A 3WGGA 1DC5A 4AMUA 2AJBA 3BMOB 3H2HA 3O3OB 4IUDS 3RVLA 3L2OB 2H2WA 1N1DA 1KHHA 2DECA 3PP8A 1Z83A 1Z39A 2PH1A 3X0DA 2EDCA 1VCNA 4X8HA 2XDQB 4OMFG 5EXTA 2LIPA 2P6OA 3A1UA 1IONA 1X3SA 2P69A 3EDQA 3PA8A 5DYWA 4S1WA 3RRMA 4E13A 2NTJA 4JU8A 5JBNA 3EGIA 4KQCA 4PZUA 3ZQJA 4H1WA 5BNFA 3L01A 3R9XA 2DHCA 1R6DA 2BHSA 1EK1A 1FJHA 2H1CA 4PYRA 3HSSA 4NCJA 4GQBA 2EEPA 3JSXA 5ILGA 5CRIA 1V9CA 4ONEA 2IUYA 3QITA 1SJ9A 4AECA 3WYFA 4BQOA 1Z88A 3IUQA 4BO0A 5C3MA 3EQ8A 1RAAA 1HDCA 4NP6A 5K8LA 3IT0A 4YR7A 1B76A 1XZLA 3NGMA 4M86A 4FFBA 5AVXA 4KE7A 3NAMA 4M9SA 2UV8A 1M7HA 1F8GA 5JDCC 4EENA 3Q3VA 5JJKA 1E6MA 2XBMA 4MUIA 2QB5A 3UO8B 5ABPA 5EMNA 1R0ZA 1NMYA 3JQRA 3IO5A 1ESCA 4O1HA 1JHYA 1M83A 3QUQA 5DXFA 3Q40A 1R4NA 3RROA 2YZNA 4FS3A 2GBPA 4R1OA 1BQ3A 2R65A 3OI7A 3OZSA 1NI5A 4RCZA 3HVHA 3KJQA 3EEIA 1DZIA 3MAJA 2AUNA 4G24A 4MLCA 4PFSA 2REXB 6REQA 5F12A 3QOWA 3NASA 2PJUA 3C8UA 1JJBA 4IJWA 5L53A 5M04A 1Y7TA 1G8AA 3OWHA 2NV0A 3ROKA 3D0KA 3O75A 2JJ1A 1BJRE 2XTMA 5DWVA 3PUYA 5J63A 4YRLA 2Q5EA 4GGPA 1A2BA 1L1MA 1X8XA 2JBHA 2PT7A 3E27A 4H35A 4JLAA 4I3GA 4XDYA 4EX6A 4KR2A 3O38A 1JA1A 2FQQA 3RI3A 4AKSA 2OR1L 1A77A 1V5IA 2D1RA 3CNOA 2RFLA 3LBIA 4JT9A 2AN3A 1MA0A 2ID4A 4YAFA 4BNDA 2MYNA 1FTWA 4ESHA 1H8EA 2QX8A 3PDCA 3V1UA 2X6QA 1GDHA 4PYJA 4KQEA 1E69A 2Y8EA 4QQRA 1OAKA 5JQWA 1ZFNA 1HOTA 3F7NA 5FRDA 3MYRA 4JP8A 3K0EA 4S1PA 2OC9A 4P3OA 3RU7A 1WO8A 5DEIA 5CLLA 5JCZA 1FXWF 2WUGA 4EHFA 2X7XA 4BNHA 2W6JD 5K2MA 2FP3A 1ZEJA 4LA4A 3RHSA 3A9VA 1QO0D 4MYCA 1ZN2A 4OSOA 4POAA 1ONPA 2WSBA 5G3YA 4RBNA 1PT5A 1WULS 2ZYAA 4BECA 5KVVA 1NJ6A 4F97A 2QMQA 4J9UE 1ZLXA 5AW1A 1D5WA 1FYVA 4YV2A 1P1CA 2G5PA 5FULA 3EAQA 3M33A 2GH1A 4G3XA 3MTIA 3RB8A 3SKYA 4E5MA 1DHTA 3FZEA 8MHTA 4B6RA 1ZA1A 5DN9A 3NYIA 3HFGA 1HFEL 4L0MA 3SS7X 3KOXA 4KQHA 4NY1A 4EK9A 1YI0A 2QPAA 3KV3O 3Q0EA 4UHEA 3UK7A 5JNVA 4Q1VA 1P6UA 2XADA 1GL7A 4HLUC 5C8ZA 3ZIDA 3HSYA 5BWMA 1AKMA 1B00A 2DQSA 2BM9A 3DQPA 1NVFA 4M0PA 1C9YA 4BN4A 4DHEA 2E18A 1X1CA 2ATVA 4EBFA 3G82C 1NC3A 2LIVA 2XZDA 5CX1B 3BDAA 3DV0A 4DVGA 2VNHA 3U1BA 2IXDA 4S1VA 1CY0A 2ZUVA 5L95A 1WQ3A 3N53A 3O8BA 4A91A 4XQ0A 5I47A 3CJQA 3C4VA 5AKZA 2GI4A 2B25A 1FMFA 1XVTA 3U3MA 1DX4A 4PG6A 2IEGA 3ER9A 4J3FA 1DXQA 3UAVA 1C8VB 1U6KA 4R9VA 4D57A 4CIBA 2B1QA 2R1VB 4D3SA 2ZRAA 5FOQA 5JVDF 4HGYA 2MCFA 1FDVA 1QGYA 4RZUA 1CF4A 1PAUA 3AZPA 3CYFA 4V0OA 2CMFA 2NYRA 3GRYA 4K6FA 2FZVA 4R1NA 5AI6A 2WYUA 2X4DA 3JQ8B 4GFDA 4Z2AA 5K8VA 3KQLA 1ECLA 1JYEA 3VC1A 3OIUA 1QFSA 2XQFA 2ID9A 2C84A 2FPPB 3DP9A 1DMRA 2AFIA 3V2IA 3QF7A 3ZHYA 5H8WA 3B2EA 4RW0A 4RZXA 1E3SA 3L7KA 4B9AA 3EIWA 2PX4A 3MCZA 3HBFA 4E1VA 2SHKA 4MWEA 2ZP1A 3AVWA 1JSXA 3NHBA 4HWRA 3TELA 3N7UA 2QR5A 1M0TA 4OBMA 1A5AB 3FI0A 3OPQA 3R3WA 1IXZA 2WSMA 3H05A 5I51A 3JW8A 2W4IA 5JWHA 4BO1A 2C4MA 4H4EA 3LHKA 5IVKA 4EGSA 1ZK2A 4Z4FA 5JYDA 3N1UA 3FJ1A 2AMFA 4DC0A 1CUEA 3BVPA 3NW9A 1B14A 4MGEA 1T3GA 4I1IA 5FBWB 3SIRA 2PQ2A 2QMYA 1XVUA 1EUZA 2QPOA 4DT1B 1QC5B 3QJYA 2F8TA 4I08A 4JQYA 4R1PA 1P91A 1Q83A 2FUKA 4UHBA 4XGIA 3DCIA 3DAOA 4B40A 4B32A 2ZUEA 2YIDA 2CL7X 3LFTA 5G53C 4FWIB 4BNMA 4RTQA 2B83A 1LLUA 1WW3A 3CLRD 1CUIA 5KX5A 4LV6A 1PV1A 4JUFA 4MPRA 4Z4GA 3MBOA 3FMVA 1WOYA 1DWOA 5T6BA 3RJ9A 3CVXA 1HOXA 1WB6A 2UZAA 6GPBA 1V4VA 3AESA 1ZOOA 1BE6A 1UWCA 2GZAA 2ZE7A 4KEAA 2ZM5A 1AKQA 2FGKA 10MHA 2CCKA 1SXQA 2QEQA 2NUPA 1BXGB 2ZTSA 4YMIA 3S2FA 1I7QB 1PX0A 1GP2A 1YUNA 4ZDKA 3SFVA 5JJBA 1JTFA 5ADUS 1P1FA 1Z0JA 1HEYA 5J40A 3H9EO 2FWNA 3OQIA 5CDGA 3E9RA 4FJ1A 3AI3A 3IBSA 1QG2A 3AQ4A 3DAYA 3F6SA 2BTQB 2OO5C 2RGCA 3ZY2A 5LN1A 4BNWA 3RTGA 3KEOA 3DNVB 2J5RA 4KN5A 5FOUA 4U7PB 3KSUA 5K3OA 3S8EA 4MUHA 1GQFA 5FLYA 1OJ7A 3GD7A 4F9GA 4JLNA 1SPXA 2HBZA 4GHJA 1W4LA 2JBAB 1INLA 2LGJA 4MR7B 3TVDA 3BD1A 3I45A 4D46A 3AIKA 4TXMA 4HGPA 2MSWA 3QMPA 5AWFC 3KZVA 2QRZA 3CKLA 4HDRB 1GYRA 4LCEA 2NADA 5BWCA 2O8CA 3BXXA 1UPFA 1YZLA 2VRWA 3PFNA 4X7RA 4JITA 4L78A 4MV4A 4YPOA 2ORVA 3BFKA 3CUEF 3I37X 1ICEA 2XBUA 3QBDA 5K4HA 1G9SA 3OJCA 4MVXA 1SG0A 2ZRFA 4L6IA 3K9GA 3V1YA 2OB1A 2X22A 3IKJA 2Q0XA 3U4IA 4YRGA 1NXQA 1II9A 4ENVA 2IA5A 5JATA 1ZUHA 2GZDA 2OGTA 4M4SA 5B1SA 3BEDA 3TLXA 5FI5A 3OPVA 1ZD9A 3VTAA 1HMPA 3NV7A 3MPOA 1K7YA 1PS9A 5G02A 3WJAA 4AAYA 1TTTA 4LYYA 1JDVA 3ADBA 1GPNA 3OBIA 5IC4A 3S1AB 1QAQA 5GQSA 1I36A 3TF5A 1IBCA 3ZHSA 1U0FA 4JMLA 5JH7A 4UNNA 2VHJA 5DF1A 4BC0A 1JAZA 2H4WA 1P45A 4NFYA 3DDOA 4CNQA 1OXUA 3FUCA 4CF3A 3A1VA 1E3WB 2O48X 3UMRA 4MV5A 4FFWA 1PUIA 2QX7A 2P4QA 3F2VA 3F7OA 3AEXA 5F64A 1DTSA 3RWMB 4H7JA 2JCYA 1O6GA 1OWPA 5E6SB 3LZDA 3NOOA 3LLSA 3N07A 5A7GA 4BNJA 5JRZA 3W3AA 2WIJA 3JQAA 1PYDA 4KQXA 4PYQA 2EWWA 2XI8A 4JN6B 4F5YA 3IJ5A 4X61A 5J4VA 3HPRA 5JDIC 4DB2A 3COSA 3ZTWA 3OESA 1QQ5A 3GFQA 3GJ0A 3N8DA 1N9KA 2IS1A 3CBGA 1JLHA 2NSJA 1CZOA 3KE9A 3GA7A 4RF4A 1DCFA 3CN9A 3VM6A 3TLCA 3P9ZA 1RJWA 1J07A 4WADA 5T67A 5J4YA 1H0KA 1LCCA 1G7RA 1I3LA 4AWXA 3FA2A 5F9FA 3ASZA 2FUNB 4INJA 3OJXA 2PMWB 2ERXA 2LYKA 2C97A 2A7QA 2QG9A 3NTVA 1CG6A 1T5BA 2D2FA 3F8SA 3OSUA 7GPBA 2WYHA 2J1LA 4DBVO 5C1BA 1DG3A 2ADMA 1RW4A 1E18A 2ENUA 2IOFA 3R6WA 1U3VA 1G3MA 2IYNA 3IPCA 3ZNOA 4BVBA 4JR2A 3NX4A 4CKWB 4E12A 2WTBA 4CUZA 4Y2UA 3DXZA 3QSGA 2J0EA 1QVRA 4KYIB 1F2VA 1H2ZA 1V16B 1WKCA 3OJ0A 4B44A 1N5JA 2NYUA 1B8NA 5K3EA 4G26A 4QELA 2CXTA 4YAGA 1NM5C 1XZMA 3ZWDA 1DRVA 1ZM2A 1TAGA 3MFQA 4GZ3A 3N3AC 1FZTA 1E59A 4RZ3A 3V1NA 221PA 2BMFA 3UB4A 4NL4H 4OLAA 1Y48E 2MYPA 3E81A 5D7NA 3DS8A 4XFDA 5EY5B 1M8KA 2VHYA 3OU2A 3PDUA 3UAWA 4BB9A 3ZN2A 1E32A 4UZFA 3O3NB 2FQ1A 3U48A 2UUPA 2C0CA 1P80A 3TJMA 3RU3A 3VPDA 3EG5A 2R68A 8GPBA 3TW8B 1RHJA 3V8BA 5AJTA 5K7SA 5D5HA 1N5LA 4OEHA 2RHWA 3F3SA 2R1TA 3EPRA 3V8RA 1QXSA 1PTJA 4HN2A 2QRQA 1N7HA 1KR2A 5KDLA 2YJ6A 3QYAA 2C3UA 3QX7A 1YTUA 3OCUA 4HQRA 3QQPA 3A6KA 3PVZA 2MMCA 5DW3A 2CZQA 4UATA 1R5BA 3VOAA 2Z9DA 5BV1A 3DZ8A 4XD7D 2O2SA 4MQMA 2I1QA 3ZU2A 1S2OA 1O6ZA 3E3OA 4HX5A 2N42A 3E84A 5JHGB 2J7PD 1NW9B 4PXSA 4KKVA 4GYJA 4RWEA 1UK6A 3ROMA 3WK9A 4TS1A 2O7SA 5IDWA 1GYQA 2NV6A 2WAMA 3KPJA 4IJUA 1VLZA 5AK3A 1U98A 3A0RB 3EWNA 3GGOA 2HO4A 4C14A 3THXA 1KP2A 3EBLA 4ZQHA 4F0JA 4YRZA 4KH0A 2AXUA 1B8OA 2IZ1A 3IP8A 3ON5A 1CQIA 4FP9A 5A4DA 2DFTA 5IAEA 1DGQA 2EU8A 3PNQA 3H18A 2GD2A 1E0SA 3LHIA 1H1DA 4OI2A 5EP3A 1L0BA 3AVOA 4F04A 4WLFA 2PFKA 4QC2A 2VT3A 4IGFA 4ZO7A 1IBLB 3TAHA 3N2GA 1XZEA 3TOCA 1Z6GA 3SDSA 1TK9A 4BP9A 5EUMA 2O5RA 4QJ3A 4TX1A 3WL8A 1SCQA 2A88A 4C4PA 4DA9A 3MF4A 2BTEA 3SZLA 3BGDA 4B5KA 1W85B 1NBME 1MJGM 1U6IA 1Y8AA 2WHPA 1YAHA 3IA7A 5FTLA 5J2TF 3SSAA 3TH5A 3NRBA 3EXG1 2H5LA 3OHMA 4RHUA 4MA0A 4TSFD 2R6HA 2XQJA 1NN5A