2PUCA

Crystal structure of the laci family member, purr, bound to dna: minor groove binding by alpha helices
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
338
structure length
338
Chain Sequence
TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLEANTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*AP*CP*GP*CP*AP*AP*AP*CP*GP*TP*TP*TP*GP*CP*GP*T
publication title Crystal structure of LacI member, PurR, bound to DNA: minor groove binding by alpha helices.
pubmed rcsb
source organism Escherichia coli
total genus 116
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 1997-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2pucA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pucA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pucA02
2CHEA 3H1EA 2XJ3A 4NDWA 4KPYA 2FEKA 3TB6A 3HVRA 1QO0D 5JNSA 2ZWMA 2QW1A 1E2BA 2MYUA 2IYNA 3JPYA 4LRQA 1DBPA 2JRLA 4RV5A 3HV2A 3QLTA 3VNBA 2HSGA 4LX8A 1NERA 3BS3A 4F8DA 1RNLA 1MIHA 1E6LA 1SXHA 4ZYLA 3QLVA 1MAVA 4EVRA 3O2QB 3QELB 1VRVA 3UK0A 5KQPA 1RIOA 1ZHHA 2LUOA 3N6VA 3IP6A 2LYRA 2HQOA 2MEZA 2FMKA 3MIZA 2BNOA 2IUOA 1C0EA 2QV0A 4JA2A 2XCJA 3LFPA 4MR7B 1PHRA 5IC5A 4LDZA 3DGFC 1P8AA 2IVQA 2LYJA 4N03A 3IP7A 3VNAA 4S04A 3IDOA 3F6PA 4RY9A 5HQJA 3HDVA 4FB4A 3H1GA 4N0QA 1JX6A 1TM2A 4NQRA 1JLKA 3CLKA 3QLUA 2PUCA 1APBA 5CNMA 5KQMA 1EWTA 2DRIA 3NBMA 1RXIA 3G7DA 2LIVA 2IU7A 4I6TA 2MQKA 4FBIA 4L4UA 3FFWA 2E4ZA 5FBHA 2KEKA 3OP9A 3MQ4A 3UUGA 1LLIA 4G0XA 5TQ2B 3D02A 3CG4A 3FYAA 4PICA 3HCWA 1L1MA 5CNKA 1BDJA 2FQYA 2OQRA 3URMA 4F11A 4RDCA 3LUGA 2RDMA 4Z4EA 4KV7A 1ABEA 1R8JA 4RXUA 3SQNA 4RKQA 1CHNA 3GBFA 1ISRA 3G1WA 1NTRA 3H5WA 1P2FA 1Y1LA 2FMFA 1YVUA 3FDFA 3ZHMA 2GKGA 3QEMB 3VK0A 1LQCA 1USGA 2JK1A 4EY3A 1Z2EA 1ABFA 2MYPA 4RK5A 4RK7A 4W5NA 2L19A 2JVLA 3S99A 5FWYA 1EAYA 5JNRA 3G85A 1D2AA 4MQEA 1JFTA 1ZESA 4H60A 1HEYA 4GPAA 1U8TA 2KYRA 5TPZD 4HYEA 5EWJB 1Y9QA 2NT3A 4YG1A 4PU7A 4WZZA 4YCSA 5JNWA 1E6MA 4YARA 4PU3C 3SCGA 4RKRA 5GQSA 4I8TA 1QP7A 3CG0A 1ZN2A 4D74A 3M9WA 4IMJB 3E61A 1WH8A 3M6MD 3KYJB 3EAFA 1D1PA 2RJOA 4IA8A 2A9PA 3MYYA 4KK3A 3QYXA 1PERL 2PUGA 5K98B 3HS3A 3LUDA 2M98A 1SXGA 3ILHA 3OLWA 5BR1A 1L5YA 3CTPA 4MS1B 3RVJA 4X4CA 3EGCA 1GUDA 4X4FA 3GN5A 1FFWA 4X4GA 2RJNA 2XDYA 3LUKA 1QKKA 2WB4A 2P4UA 4HNSA 5FWXB 4UHJA 4Y9TA 2LYPA 3K4HA 4JOQA 3HZHA 1ZH2A 3EQ2A 4D6XA 5C5CA 4NV3A 1TVMA 4KNYA 2BNNA 2R63A 2OR1L 1Z26A 3JS5A 5EWLA 5B3JA 3TX6A 1WIZA 5JS1A 4YG7B 1S7EA 3BD1A 1Z18A 3QEKA 4RZSA 1DC8A 4EYQA 1ZAYA 2FN9A 2HQRA 2ID9A 2R4QA 3R0JA 1NXTA 3GV0A 1SRRA 3LKVA 3CROL 3B2NA 5GOTA 1JHZA 4ML3A 2ICPA 3JVDA 4X4BA 4YO7A 1JH9A 2KEJA 1PRVA 2D5VA 3OQMA 3O9XA 1YK1A 3FGZA 3Q7TA 1JFSA 2MSWA 3F73A 4IRXA 1GT0C 5CHYA 1LBHA 1EHCA 1U0SY 3A10A 3O1IC 1PNRA 1RZSA 1ZVVA 3OM0A 2HJ9A 1KRWA 3BRSA 1MB3A 3HUUA 1Z2DA 1ZPQA 3LUJA 4MS3A 1I3CA 3KCNA 4LE0A 3IP5A 5F64A 3D8UA 1D4ZA 3LOPA 1UXDA 1R63A 3ZHIA 3HM9A 2F8TA 4PYRA 4F12A 5JNTA 1JDPA 2JVJA 1CEYA 5IUKC 3DLBA 1Z15A 3RVNA 2CWDA 5JNVA 3DGEC 4WXEA 1PRAA 3SAJA 9ABPA 2QVCA 1PNTA 4MR8A 5TPWA 3H1FA 4RK6A 3A0RB 3HO1A 3RVKA 1XHEA 4XLTA 2AYZA 1RPEL 2OFYA 1RZRA 2LP4Y 2AYXA 3N0XA 1Z25A 3OLZA 4WWHA 4G0ZA 1POUA 5EWMA 5FBKA 4DQDA 1BAPA 3K9CA 2HQBA 1CQTA 3IP9A 3JY6A 4XAQA 4G0PA 1USKA 4N41A 3UKJA 5DTEA 2JB9A 3KTOA 1UTXA 2WRZA 4EVQA 3DLHA 1NXOA 3F51A 2E4YA 4IVZA 2H8RA 3L6UA 4NICA 4F06A 1B00A 4G97A 3O1JC 4H3HB 2GI4A 1URPA 2E4VA 3FFTA 4MS4A 1VPWA 1DBQA 2PAFA 4ZMRA 3CU5A 4EYOA 2GWRA 3OQOA 1M2EA 1UDRA 3N8IA 4YR7A 2X7XA 3O2SB 4WXMA 4L85A 1VLZA 2KPJA 1NXPA 2PL9A 3CRNA 1R69A 4W5OA 4NCBA 2I6FA 3A3KA 3C3KA 5IBQA 4E7OA 2Q5CA 4MQFA 4RU1A 3ZKCA 4XFKA 4PE5B 1PUXA 4Q6WA 4QPJC 4TMYA 2A9OA 3LUAA 1JWLA 2L2QA 3H6HA 1JBEA 1DRJA 2R25B 5FWYB 2FJRA 2A6CA 2LYQA 4Z5CA 2PUFA 7ABPA 4W5RA 2M1ZA 5DGCA 4MGEA 3EUSA 3MA0A 4MQEB 3IVPA 1JFVA 4N76A 3TMYA 5KI6A 4KK4A 4O1IA 5D2CA 4G0OA 3GL9A 1E3OC 5PNTA 1RXEA 4Z0NA 3KYIB 2VK2A 3CLCA 1GUBA 1ZITA 1SXIA 3OLYA 1DG9A 4Z4GA 3H5LA 4EYGA 2NZVG 4Q6BA 1DCKA 3L49A 1OXBB 3QX9A 4Z99A 4Y42A 1ZZ7A 3CECA 4Z4HA 2R48A 3NHMA 4JP1A 4YV7A 5IEBA 3LISA 8ABPA 3E3MA 2OENG 2WUSR 3GN5B 1RPJA 2PKXA 1KMIY 1BDHA 4Z4FA 4NCAA 3N53A 1U2QA 2W42A 4H3KB 1H9CA 2XI8A 3LFTA 5ED4A 1FFSA 2KZ8A 1LCDA 5A7LA 3SG0A 4ZJPA 5EWLB 5BQ3A 1M2FA 1TLFA 2PUAA 2FMIA 2ID7A 3MMNA 5KC8A 1SQ8A 1ZZ6A 4Z59A 2E4UA 1U2PA 3CS3A 1USIA 4GQMA 3TD9A 2FMHA 3TRBA 3C3MA 5CNIA 4OATA 5DKFA 3T8YA 2CD7A 2AXZA 2IV1A 3EODA 3SCFA 4JB0A 5IUNC 4QYMA 2RGYA 1W25A 4X4DA 3RVLA 3KJXA 1DW9A 3A0UA 4YRZA 1M5TA 3O74A 5HM6A 4MS3B 4FN3A 4PEVA 2B4AA 2PL1A 1JDNA 4G0YA 3DBIA 1IC8A 1GCAA 4DN6A 2AUWA 1O4XA 2HINA 1M5UA 3NNNA 1LCCA 4ZMSA 4O8BA 1ZS4A 5JS2A 3GT7A 1YTUA 2CSFA 2MYNA 3Q7SA 4Z5DA 2PUBA 4J1WA 4IILA 4KVFA 2JVKA 4HNQA 1WH6A 3HDGA 3N0WA 1XWRA 1P6QA 3H5OA 4FE4A 3LUFA 1W9HA 4MR8B 5TPWB 5TQ0B 2PUEA 2FQXA 4RXTA 3Q9SA 3QF3A 1K68A 4WUTA 2V0NA 5KWSA 4MPTA 3UFDA 2LBPA 5EWMB 4XARA 3I09A 4YG4A 2O20A 4XASA 3H6GA 3O75A 1QNLA 3KHTA 1QQAA 4Q7EA 3JXBC 2FQWA 4RS3A 4Z4CA 2FTKE 2WIUB 1QO0A 3CHYA 3BRQA 2PIJA 1KGSA 3OO1A 2QZJA 3HSYA 3OMXA 2FLKA 1YIOA 1DCFA 4IWRA 2QVGA 3LUHA 4OBBA 3N0RA 3H75A 1Z13A 5BRJA 5JNUA 4WT7A 3C3WA 4MS4B 2QSJA 3LTEA 2WMYA 3CNBA 3JVIA 2WJAA 3I42A 3GWGA 3Q7RA 2FXIA 1ZZ9A 1EFAA 1K66A 2E4XA 2IDMA 2WJWA 3N75A 1F51E 1NXSA 3CZCA 2F8SA 3F6WA 3G5GA 1BA2A 2IPAB 1ZY2A 3HUTA 2GRLA 4KRFA 4YWHA 4TLMB 2PMCA 5EWJA 4MQFB 3I45A 3RVMA 4RSMA 1PEAA 1QP4A 1YMUA 2O49A 2IKSA 3F6CA 4YGXB 4LDAA 3RVQA 2NUBA 3SNKA 5HSGA 4S05A 5IX8A 1TMYA 4J1XA 2KEIA 2FKAA 2MSLA 2PE5A 4O1HA 4RK0A 1X57A 2AXVA 4UHKA 3GYBA 1GCGA 2FW0A 4B09A 4KREA 2QU7A 1QPZA 2FEPA 4ETIA 1NEQA 6ABPA 1Y7YA 2B5AA 1MB0A 3SCHA 2FEWB 4MS1A 1LJUA 2CHFA 1FSPA 2ICTA 1S8NA 3JXCL 1XHFA 3JTEA 4O5AA 3TO5A 2R1JL 3H5VA 4MR9A 3RH0A 3T95A 4ZPJA 3KG2A 1ZH4A 3QX8A 3MF4A 3OQNA 1Z17A 3OO0A 2O4AA 2EWTA 2PUDA 1NATA 2IPNA 2L18A 1NXXA 4MLCA 4MLDA 3F7NA 3EDCA 1YSEA 3P9YA 4GNRA 1T34A 4Z9BA 1DWKA 1LJLA 2P9HA 3QWGA 3FMVA 5KQGA 3HEBA 3DNVB 1NXWA 4IF4A 1JF8A 4F8JA 2E4WA 3ROTA 5I4CA 2H0AA 4LZLA 2EF8A 1A2OA 4LE1A 3W9SA 4EVSA 1YMVA 3H5TA 1CJGA 4RK1A 6CHYA 3LKBA 1VKRA 4OLBA 5TE9A 2BJCA 2FSPA 2LCVA 4P1ZA 4YLEA 2ZAYA 2LYSA 3M9XA 3MM4A 4RY0A 3SY8A 3KKEA 4MAAA 4IMIB 2IPMA 5TPZA 2CROA 1OSLA 2L17A 4EGSA 1WETA 1DC7A 4JASB 4ETNA 4MCTA 1BDIA 3HK2A 2XSDC 3ROFA 2PJUA 5BRAA 5T7BA 2WWVD 1B0NA 3LUCA 5IULC 1YK0A 2IVBA 3MLFA 3C97A 4W5TA 3BDNA 2JBAA 3GBPA 1JYFA 1ZZ8A 3BREA 5T3YA 1GLGA 1U04A 4M88A 1OXKB 1RZRD 3FYMA 2BNMA 2MYTA 2EBYA 3T6KA 3QK7A 1XWWA 3IPCA 4MRMA 1LBIA 5TQJA 2FVYA 1AB6A 1ZGZA 2QXYA 1PRUA 4KQ9A 3BILA 2O38A 3CZ5A 1DP4A 4HNRA 3I5AA 4W5QA 3RZZA 3QLVC 1EWVA 3BBLA 2AXUA 3FFXA 5IEJA 3OM1A 2TMYA 1L5ZA 3IPAA 1P6UA 4JQDA 3QELA 5ABPA 3OMTA 3T38A 1YS6A 2R47A 3RQIA 3RVSA 5KQLA 1DBWA 2AW6A 3GA5A 3NNSA 3HZIB 1BVHA 3DZDA 1FQWA 4MCXA 1DZ3A 3D1NI 3SM9A 1KRXA 4JCYA 4X4HA 4MR7A 1EWKA 3ILYA 2XIUA 1NXVA 4I6UA 1X2LA 5KC9A 2HPHA 4KQCA 3LMKA 4N47A 1LK0A 3KLOA 1JL3A 4ETMA 2L49A 3QLUC 4E7PA 3NNDA 1E6KA 1D5WA 2GRMA 3S8QA 4TN5A 1YS7A 4XXHA 2IOYA 4OTZA 4PU4C 2GZUA 2VUIB 1C4WA 1SD5A 2QR3A 4JB2A 4RK4A 1F4VA 4OLAA 4PU8A 4P98A 4X4EA 2YHBA 1ISSA 2VYCA 5TQ2A 4Z5HA 2IPLA 2PPXA 4GHJA 1MVOA 4DADA 4KZKA 1ZUGA 4RXMA 3GRCA 3OLXA 3KXAA 3U3WA 1HF0A 3O1HB 3C6QA 4OG2A 4I6RA 4EUKA 4QYWA 1J56A 4YP9A 3FMYA 2GX6A 5IUJC 4JAVC 3O21A 4MYRA 2AWIA 1QQBA 4JCXA 1IIBA 3F52A 1Z12A 2A9QA 4Z58A 1NY5A 2B1JA 2N9UA 2NT4A 4G0QA 4QICA 3RVOA 4MR9B 1QP0A 3QEMA 2LYLA 2WY2D 3RVPA 3HXMA 4G0MA 1ZZCA 3KLNA 4LE2A 4RY8A 1AU7A 1AB5A 4G86A 2IVGA 1UXCA 1DRKA 1PEYA 4Z4IA 1D1QA 3L1PA 2FLWA 5DLEA 4OB4A 5DCLA 3RVRA 1FFGA 3PXPA 4YBAA 5CNJA 1LMB3 3QQ6A 1DCMA 4KFCA 3EQZA 4FE7A 3NHZA 3Q41A 3CFYA 4CBVA 5HKOA 2L8NA 5E3JA 4F3TA 2NZUG 1OCTC 1A0OA 1JYEA 2BGGA 1ZGGA 4D6YA 3EULA 3KS9A 2JVIA 2PLNA 2FN8A 1DJMA 4TLLB 4X4IA 2VUHB 4N0PA 4Z9AA 4EYKA 1CYEA 1Z16A 2LPMA 1ZDMA 3H5IA 1ADRA 2JCGA 3OLVA 5FWXA 1QMPA 2A9RA 1ZZBA 3KZ3A 4IGAA 3GBVA 3KSMA 3Q15C 4RWEA 2MSKA 2GBPA 5B3JC 3OMWA 2YHAA 3EJWA 3JXDL 4YS6A 5TQ0A 2LYKA 1TJYA 3R1FA 3B7HA 1A04A 2JBAB 2J48A 3CKMA 3O2JA 5C5EA 3HJFA 4KMRA 2H3HA 4PZ0A 3JPWA 4MRMB
chains in the Genus database with same CATH superfamily
2CHEA 2QRVA 3PTLA 4BRWA 4XWWA 2FEKA 3MT8A 1WL8A 4P7KA 2C5AA 4Q01A 1KQFA 3MIIA 2NLOA 2A0XA 2XYGA 3X2FA 1L5OA 2GBIA 1QQ7A 3HBFA 4KQXA 3EEOA 1RQNA 2O3JA 3F7TA 4YIHA 2WVAA 1NN3A 1BDBA 3JQCA 3QLTA 2OHXA 3DLAA 3BS3A 3KZMA 3DE1X 3IQDB 4BO3A 3KLMX 2QVBA 4HRAA 4X54A 1VIMA 5KBYA 3DAOA 3KEOA 5E8RA 5KQPA 1UFOA 5A1JA 1SVOA 2JFNA 2QZ4A 5LP6A 4DT1B 2VYFA 1WJGA 1N5LA 2IL1A 1M67A 3R5SA 4ARAA 3GRKA 5ALDA 3NS7A 4FYXA 5GGYA 1IQRA 2FUNB 1WTAA 2P4SA 1NW5A 2Z2IA 1NJ5A 2OD9A 2ERYA 3DBRB 1XRQA 3F6YA 1YBAA 4OA5A 3RV4A 4NECA 2ZUDA 4X6XA 5B1YA 4PZEA 5EZ5A 2I6QA 5FYQA 3UJHA 2CFOA 4Z3DA 2I3GA 4DNQA 4LF9B 2JHGA 1F12A 4FN4A 2CLEB 2PPVA 4Y2TA 1QGED 1J00A 3JQ7B 3U3KA 2CHVA 4L4UA 3WQRA 2QMZA 1K0UA 4G1EB 2LKCA 2VKTA 2DVMA 3PV0A 4J0FA 3BGDA 1OGJA 5D86A 5HP4A 4OOFA 4G5XA 4KITB 1Y5MA 3EPLA 3OTIA 3G7SA 2XE7A 4PICA 4ALNA 2Z5VA 1RCTE 4U39A 1RWBA 2GHIA 2R6DA 3RADC 4XM1A 2HSDA 3KIPA 5BR4A 4C3VA 4Y9RA 2ZT7A 3AW8A 1Y42X 3GFPA 1H2WA 5FP0A 4RMJA 3WGOA 2Q5JA 4EFNA 1ZM3A 3NDJA 4H7HA 3LW7A 2YMPA 4MINA 4P92A 1HG1A 1GSAA 4NP6A 1R8YA 5K6TA 1F4PA 1RYNA 3R7FA 4ZZ0A 1J39A 2CJFA 3VA7A 2E2WA 1GKKA 4M1ZA 4HNTA 1E0AA 1GN9A 2GXUA 1D6MA 2FDXA 4RHFA 5E1MA 4B76A 3OIFA 2LNDA 2EGHA 4IJMA 4OUDA 4JLOA 2ZTMA 4QBGB 3RE1A 1RAGA 4CM9D 4UNIA 1SHKA 4EJMA 4WXYB 1HDZA 1X7YA 1KEWA 1PR6A 2Q1UA 3PX3A 5CB0A 2P68A 2KBEA 4L4XA 4R68A 1UJ6A 4E4TA 3O9ZA 3LBNA 4GW3A 4AFNA 1UXKA 1JG7A 4IOJA 1M2NA 2PO7A 4ALJA 4CCYA 4I4NA 3QIAA 2O7RA 3PF9A 4AMVA 1A71A 3EZXA 4JIGA 1C7ZA 2HXYA 1JNYA 3EGCA 3PNVA 4TVSA 1Y8QB 4MVYA 2UZ4A 3THXA 3IBFA 1ODIA 1OLUA 4BAGA 2DGDA 4JOQA 3N5CA 1L1EA 2FE4A 2YXPX 2XXPA 1FNNA 1X7ZA 1RJ9B 3LYHA 2FH5B 3INTA 3BD1A 3PPWA 4IOLA 4MB6A 5IXSA 3GUUA 1HDXA 1SBTA 4YLGA 2H1HA 2VF2A 4RDHA 2R6FA 2R62A 2SKEA 3DFZA 5JAQA 2CV0A 2BFFA 2J3DA 4TT8A 1P45A 3GV0A 1QVAA 1SVWA 4PPNA 3PBKA 4UOQA 4N3CA 1O2DA 5BWOA 2HR1A 1QGAA 5J23A 3D8SA 1QYVA 5C4IA 3S2YA 1QIHA 2I2WA 4YUXA 1I1QB 2UAGA 1QDUA 1IAVA 1DEXA 3WXBA 5MFZA 5JBIA 2HSZA 1PR1A 3C5EA 4BKMA 1L7RA 1H9BA 1G98A 3U4IA 2HJ9A 1KRWA 4LEIA 4LVUA 4PIMA 1F3LA 3M1YA 5I9TA 2BSQA 1SC1A 2CL7X 3D8UA 3GOHA 3LCVB 2NZ8A 3AR4A 3GARA 4P3OA 3UCFA 1PKEA 1U0JA 1QFJA 3TZQA 3FY4A 1EP9A 2CJWB 4WECA 2PV0A 3AEXA 3DVSX 3MRVA 4JS0A 5KSPA 3TRKA 3OG9A 5ENVA 4ENWA 4COOA 3DGEC 5EJEA 1Z35A 2NADA 3M3DA 5FUQA 3UUEA 1V16A 3F6EX 1B6SA 2WAAA 1QH1B 1FF9A 2G9ZA 3D4NA 4MP3A 1VCIA 3VGJA 3VKWA 5J58A 5JBQA 3QTBA 3U48A 3WGLA 1R66A 1IWOA 1Y98A 4LXUA 3CUTA 1TUEA 4RTKA 3U5ZB 3TLGB 4R41A 3IAHA 1RAEA 3OC0A 3DA8A 4FFPA 2GN8A 1ZISA 4PCVA 2YXDA 2WOOA 1UTXA 3HKDA 1CT9A 2GJKA 3O1LA 4ZAVA 4D0RA 4KREA 3N2LA 4CQJA 2B6HA 3Q7QA 4X20B 2GI4A 2W2OA 3G2IA 2VQSA 3ONVA 4Q4HB 1URPA 4OJKA 4K9NA 1V2HE 2G6BA 4E5SA 3R0ZA 4CF5A 3ANLA 3K92A 1A9OA 3KOOA 2IYLD 3W3AD 4W8OA 1W0KD 2NSDA 4DW8A 2QEQA 1OROA 4ISBA 5HRCA 3JQBA 1Q3TA 4QXMA 3OLCX 1EJ0A 1KZHA 1PFGA 4XFKA 1YZGA 4LHYA 1U90A 2HK9A 4M9UA 2F59A 4J90A 2PS9A 2DWQA 3QXSA 3KJNA 2D1YA 5DTRA 2M1ZA 4EUFA 1LK7A 1NLUA 4MGEA 4PHFA 4R40A 2AZTA 1X2BA 2C83A 4X8LA 4B4OA 4M7OA 3DO6A 5IVPA 3WHKA 2Z6QA 4CKBB 3ANYB 1OX6A 2BDUA 2XRZA 3GL9A 3NBFA 1Y7LA 3RRMA 3RWOA 3C8ZA 2O2GA 3GEGA 4R8LA 4WNCA 3NM5A 2YUTA 1RADA 3U37A 2GTIA 3LQ2A 4MWOA 5A5VA 3GJSA 2G25A 3AF3A 1SCQA 5DHSA 4MK4A 3KYCB 2Y92A 2MU1A 4FUQA 4PQGA 1N2BA 1V9LA 3FYSA 4Y42A 4TXHA 1L7NA 4KOEC 3WMGA 2FUCA 2IS6A 2FP4A 4H4DA 2OYRA 5F23A 2QN1A 4F2DA 1U8EA 2A0YA 1J8VA 1IBMB 3ICQB 3TZHA 2C94A 1OT3A 3RSFA 3N1UA 4EI7A 4AN0A 1XXLA 3KU4A 3RFCA 3SFTA 1NMEA 2XI8A 1U65A 2BEJA 2XEXA 3O3OB 3ORYA 5C34B 5JAUA 1L5HB 3AP3A 3IVRA 5D01A 3HO8A 4TV9B 2Q2OA 1AKMA 2GPSA 2Y1GA 4MAMA 4W8GA 2RBEA 3MLEA 1SG9A 3TQQA 1U2DC 2EKZA 3RJMA 3UBMA 3H13A 4JOCA 4GQMA 2RGNC 1AV7A 4KQ1A 4ZVSA 1M2VA 2Q29A 3G88A 3HBAA 4D6YA 3TRBA 1PGQA 1MJHA 4JLAA 2ZUFA 5EQJB 1SKMA 2R00C 5JVDB 1WXHA 2PY6A 2Q5FA 3D4OA 1FUKA 3EODA 4PSKA 5ALUA 1PSZA 4WFIA 4F3NA 1UXJA 1VZ2A 5I8PA 4DR7B 1IN1A 3EZLA 1GUFA 4L50A 2Z2ZA 2W2KB 2BGMA 2CCJA 3GVHA 4V1CB 2AOVA 4TQGA 3SR3A 2AOUA 1IC8A 3JQRA 5AO9A 4KX3A 4EPTA 3SBDA 1M5UA 3W2HA 3ZNQA 1LCCA 5IBRA 3MG9A 3OKFA 3K0CA 5DTIA 5JS2A 5DLDA 3WK8A 3WYNA 1W29A 4N3BA 4J1WA 2EJUA 1LLFA 3B89A 3PDWA 2X1HA 3KWJA 4A1FA 2DERA 4GD3Q 2PQ6A 3K9NA 1EK0A 2IPXA 5LIPA 1EZ1A 3QF3A 3I6IA 4NBLA 5L8VA 1JXMA 4WLUA 1UDXA 1YC5A 1X70A 3R09A 3LDAA 1ZG3A 2R97A 3CE9A 5D1NA 1LPNA 1KSJA 3KHTA 1GDDA 3KOUA 4DLRA 1B73A 4X1YB 2WUVA 4FXPA 1RRPA 1A9XA 3OO1A 1N1MA 3ZU5A 2PIJA 1H2ZA 3B6IA 3HSYA 1YIOA 3M1AA 3LUHA 4RQAA 1C4KA 4CQMA 4RZXA 7MHTA 2ZIAA 2PCLA 2DQSA 2ZQ5A 3A9SA 2FRDA 3AHEA 4J0DA 4MS4B 4D9MA 4EHAA 1UP6A 1HDEA 1YKGA 3S5UA 4MRAA 4F9EA 1K27A 1V26A 3T5MA 1VMAA 2I22A 2VT3A 3U4AA 4QYIB 4MPRA 1NWCA 2GSWA 2JASA 1K89A 4G2TA 5KYWA 3BERA 3E23A 4ND6A 4UUQA 2F43B 2PZBA 4ARSA 4FS3A 3VPAA 4C5BA 3LBHA 4GI5A 5BQPA 1CY7A 5AXDA 3G2QA 5FR2A 3QF4B 5JH7F 1PEAA 3QHAA 5CRIA 2IBTA 2XGJA 2JNWA 1BVUA 1YQDA 5FTMA 4JEMA 3SXUA 4J76A 2I8LA 3K30A 4RJLA 1A7KA 2VOJA 2WIKA 3CVJA 4UHKA 1GCGA 1VSTA 4YGYA 2XUQA 2DSNA 3B1WA 3SZGA 2PWAA 4RM3A 3S70A 2FEWB 3BCHA 1FSPA 1W7AA 4XJSA 3JTEA 4LF5B 3SF8B 2XB6A 4B80A 5KSZA 3B1FA 4EF4A 4IIHA 3UCEA 1FVOA 1GTVA 3GVPA 4UFOA 3KYBA 721PA 1ZGAA 2ONYA 2OO3A 2K7FA 3PEYA 2BMJA 3WWZA 1VZ3A 5CVCA 3AIKA 3IVGA 1KBQA 5CB4B 4Z9BA 2ORYA 1FDWA 1WXWA 2QG4A 4TXMA 5ARBA 1VHTA 2R11A 3WTBA 1YSCA 3FMVA 4XQCA 1EEXB 1NI4A 3JYOA 1XEFA 4G4SO 4IF4A 4IJKA 3ND6A 4J29A 4F8JA 1KI2A 2IYZA 3INYA 3KOMA 4P4LA 4MDHA 1XZQA 5T4HA 2JIDA 4YRLA 3W9SA 5C8XA 2YIDA 3WMFA 2C7RA 4PZZA 4AO8A 1N7GA 2EQ5A 3S2IA 5EIXA 4YLEA 2EJVA 1BH2A 5AW5A 3JYHA 4AULA 5EHGA 1N34B 3A6PC 1E9DA 3I0NA 4DRXA 5F1YA 3JCZA 2CY0A 3TL2A 2Q1YA 2O8FB 3PE4A 2ICAA 1ZO8A 2TRSB 3IIJA 2NNLD 2ZRNA 3ROFA 3RROA 3MCZA 3X2EA 4DMRA 3ZZTA 2ZIVB 2ZJBA 3G5TA 3MFYA 4GGPA 1PR0A 2FSVC 1MBZA 2AC4A 1GPYA 2XE8A 2PA3A 2BEUB 4GH5A 4DIFA 5C80A 1P4JA 3PXEA 3P2IA 2PX5A 2R1VA 4NYJQ 5G2OA 1TADA 5IT4A 3FETA 4G56A 1V39A 2RGRA 1T9CA 1Z07A 5B2FA 2OL4A 1J2YA 3KQSA 2O38A 2ZPUA 2FW8A 1CIPA 4B46A 3RZZA 4JT4A 1DZIA 1Z6ZA 2D0OB 1KP9A 2VUSA 3AC0A 2VHWA 1ORDA 2CJYA 4HLNA 4JELA 1BX3A 4IAOA 5IKOA 3TLJA 1D4OA 1P6UA 3HZRA 4KR2A 1GEGA 1T2NA 3ZV5A 4J0GA 1C50A 4WHMA 3QKRA 5IAOA 5DHQA 1DBWA 3WAGA 1G8KA 3PICA 1X3LA 2DC1A 4B75A 5IJAA 2YRXA 1WBBA 5F3DA 1W1WA 1H93A 1KRXA 5EZYF 2HLDD 3WB0A 3TN7A 1SNYA 4I6UA 1TKCA 4FLEA 2ZBGA 4I50F 3T5TA 2HPHA 4Y2JA 1NMQA 4ICIA 4P54A 1X7WA 2FZ4A 1HTBA 3ZKWB 4WESA 4HWOA 4QOSA 1E6KA 2ZYGA 4AJHA 3S8QA 3TNJA 3I5XA 3ET4A 1OZHA 3GEPA 2PSEA 4B8WA 2EOAA 1I36A 5IAJA 4G1CA 4II2A 4EUHA 3HEAA 1ARZA 4X4EA 2PJDA 1E9CA 2HEGA 4KXFB 1BKDR 1SPXA 1ISSA 2VYCA 3AL3A 3OE5A 4AWXA 3K09C 1FA9A 1HDYA 2VHEA 1U9IA 2B21A 1U3FA 2HSEA 2XDQA 1JLMA 1HDGO 3PA6A 4TVBA 3BQNB 2OGUA 4RZ2A 5HCIA 2ZIXA 3MWDA 2HF7A 5K0NA 3LYLA 3P9RA 3WO1A 4JBYA 4BZPA 4P4SB 521PA 4E15A 3IBCA 1IBKB 1D03A 1SUBA 2FN4A 1TFUA 3BGWA 1PBNA 2X6RA 2JIOA 3GK3A 3HWSA 4ZRMA 3REGA 4B9AA 5IHPA 5TNXA 3QEMA 3KQNA 3I2HA 3HU1A 3KLNA 2EARA 3ND5A 5FNVF 4I3HA 2FZWA 3KOYA 1A5SB 2AS0A 4X65B 1ZR2A 1LQUA 4FWIB 3T5PA 1UXCA 4EY5A 2O05A 1PEYA 4BMDA 4CHGA 2BFBA 2V6FA 4MA0A 4OHPA 3ROPA 3T0IA 3A9TA 3P0EA 5EKUA 3DKIA 3V9PA 2D13A 4PNEA 1H2FA 5DHPA 2YMLA 2JD1A 5FEUA 4QJ3A 1L6IA 2O8EA 1MJNA 1MORA 3EPKA 2QRGA 3GOQA 4AF6A 4MKHA 4JD5A 5TR9A 2WNIA 3GJ4A 3AVYA 2XITA 1W49A 2C84A 4UE6A 1XMOB 3EULA 1H3EA 4J3JA 4Q37A 5E4YA 2PZAA 2AOTB 2ORWA 2BL4A 4WX2B 2ZIFA 1Y6GA 2FDCA 2XB4A 5JAZA 1P62B 4MUHA 4L08A 1VL1A 1JSCA 4H6VA 3VR3D 5IFLA 2FPUA 1MTOA 3ZBQA 4N5DA 3UEOA 1ULAA 3M5CA 4C3ZA 1WSWA 2BIFA 2J6BA 4NEGA 3B82A 4WBNA 1XZEA 5L3VA 4G0VA 3GFOA 4UEJA 4NV1A 2AKAB 3QSGA 4HNGA 2WQ7A 4R1QA 2QQ0A 1DUVG 3TF5A 3FDIA 3OEHA 1F2UA 3ENNA 3E15A 3INRA 4AK9A 1QU2A 5AHOA 2MTBA 4TMWA 1FUEA 1T8RA 1QGYA 4YAIA 5HKBA 1XU9A 5J2UB 5F7OA 1J1ZA 1UCFA 2Q7OE 2ZWMA 5AKGA 4YCCA 1Q3KA 1E4OA 5LWHA 1DARA 1QK5A 3LRXA 1PIWA 4JH0A 3JAWA 4QGAA 1MIHA 3FH0A 3LAWA 4E70A 5BW8A 1AH2A 1F2DA 4I1IA 1E77A 3QUBA 3ZY3A 1L5FA 5AESA 5WRFA 1E5DA 1DMRA 3BK1A 1G0NA 2Q3BA 4HDSB 1MNQA 4RVFA 3KTAA 1WP9A 1WE2A 1MDBA 2H92A 2XNHA 4KWCA 4CF7A 2PQ0A 2XCJA 3LFPA 3GZDA 5A05A 5KTNA 5M2QA 2DFPA 2OHIA 2ATVA 4TYQA 3LXRA 3CUYA 5ALLA 2ZTUA 2YWDA 5IJXA 3QWIA 3RS3A 5LA6A 5HW0A 5K0BA 1GQYA 1G3MA 1JQAA 1UJMA 2HU8A 2QV7A 3H1GA 5AM1A 3RO7A 2QL5A 3NHJA 1ZA2A 2ZITA 4DM3A 4Y6QA 2NZWA 1HT1E 5A5FA 5KQMA 2I2AA 2PT6A 3NBMA 4G0UA 1XMVA 2QM7A 1L6RA 2VHTA 4QDXA 5HJ2A 3BHMA 3FFWA 3HDJA 4QOJA 1XPRA 1PV4A 3OP9A 2ZCVA 2V03A 2IIBA 3W2IA 3W34A 1M76A 3N7UA 1AKNA 2IXDA 3QGMA 4M2LA 3AUFA 1R0XA 3WNQA 1P2UA 1JIJA 3HKBB 3UMRA 4AO6A 5H4GA 5ALVA 4P3NA 3NX4A 4K03A 1YQXA 2A4MA 2AR9A 2NO4A 2RDMA 1RM4A 2C58A 1IOZA 1I4DD 2GJ4A 2K5UA 4HX2A 3SQNA 1GAQA 1PZEA 1FMJA 2V65A 1H5UA 3CB4A 4IDFA 2HM7A 3RAFC 1YVUA 4YMLA 1BMFD 2ZYAA 4ZALA 2GKGA 5BR8B 2JK1A 2ORED 1D0SA 3FPJA 3PGMA 2C57A 2XYPA 2IHJA 3AIMA 3RWMB 2EU8A 5AXCA 4QAQA 1M1YE 1RLMA 3SHFA 2PS3A 3UYKA 4RSGA 3W5HA 3RC3A 2YZ7A 3R24A 1RHQA 1UPTA 3IL2A 1ICEA 4MKGA 1F20A 4MQEA 2EL7A 3K6SB 2CK3D 1N6RA 1H6AA 1Y3IA 1HEYA 1Q21A 1X9GA 2J67A 2VZ8A 2I6GA 2EV9A 3LX4A 4I8DA 4WZZA 4B44A 2ALJA 4NCKA 3SCGA 1PJAA 2HCRA 4O63O 4RKRA 5TDHA 1CVIA 5CT9A 2IQ5A 1L4BA 3RHSA 3QEJA 4LY3A 3TFWA 1TYEB 5IN5A 2BMVA 3DMDA 4K81B 4DV6B 3IAM6 1XEXA 4YJ3F 5K98B 1ZFNA 1YDEA 2ATXA 1SXGA 3EFEA 3MC1A 4NYJR 1L8QA 5BR1A 3W8NA 1BFKA 4AZ0A 3TGPA 2DPMA 4R8SA 3TNYA 3V7WA 1DEAA 1AJEA 5A4AA 1ILWA 1Z36A 4CG2A 4C2UA 1QS0A 4XGKA 5LSAA 1S2DA 2R63A 4IIJA 2Z83A 2HWKA 5K4HA 2GHQA 1QQTA 4DLZA 4LSZA 3EZ2A 3MOSA 2X4DA 2DH5A 3QTLA 1PD1A 1BYIA 3M6AA 3ZW9A 3QLJA 3PFFA 4LJ5A 5F73A 2OO5C 1NHWA 1U1IA 2J3JA 2VJDA 3Q7TA 4XGRA 4XSGA 4GWGA 4CG0A 4E4RA 1I1OA 2HLPA 4IQGA 4DV5B 1QE5A 1Z8DA 1CQWA 2OORA 3F46A 3F73A 1RC8A 4Q9JA 2I6UA 1V3VA 3AHDA 3BMQB 1EFTA 4BNTA 3H4VA 1AUPA 2PLFA 2R5FA 2ZAGA 3NAGA 2ZRMA 4MIOA 1UQUA 2CYCA 4LE0A 5AVOA 4CUZA 2EF0A 4EQ6A 4NMLA 5JI2E 3WISA 1PWXA 4C9BA 3USES 1JLLA 3QXCA 1D7AA 4ZGBA 3WWDA 3KWFA 3NH6A 3ZOZA 1TYCA 3PUIA 4NBSA 3Q10A 1VI5A 1B4DA 3ESAA 1FMTA 3R3JA 4HGQA 4CIDA 3KZCA 2O7VA 2O8CA 2ZI7A 3A4IA 2OV6A 1XZGA 3GFQA 3OIDA 3PCXA 2DTXA 4OH1A 4CQLB 5KOIA 4N48A 1RWNA 1Z25A 3CX3A 1L9KA 2X5NA 3S7TA 1JKFA 3K9CA 1AQ6A 1P2BA 3B52X 4XSHA 3FF1A 4BNZA 5AOVA 4QRDA 4R9NA 2BD0A 3SJUA 4IVZA 3E5NA 1GPKA 1IE3A 1KU0A 3H1TA 4KAAA 1UAYA 3R3XA 2WAOA 4REOA 1DAHA 3E9EA 3ETDA 1SQ0A 5DGDA 2DHCA 4MITA 1JXAA 1SCUB 2CFCA 5J5AA 3SLRA 3SXJA 4ASUA 4F8EA 2GCGA 1OXTA 4BVKA 2QR2A 4FN5A 5F2NA 4W5OA 2VEOA 1Y7TA 2WD8A 1NRIA 3STVA 2JFHA 3WV4A 2XKKA 3A3KA 1E7MA 1W35A 1Z6QA 1TZKA 3E5RA 3G9TA 3ZKCA 5JCOA 4AXBA 1THTA 2XCIA 4CIVA 1ISMA 1NVDA 1G2QA 4JBIA 1C9YA 1FU8A 4JP8A 1G8AA 3TIIA 6LDHA 3EDMA 1BG6A 2L2QA 3WYDA 4A0FA 4BKQA 4DV4B 2QXTA 2MCFA 1TMGE 3T5GA 1V3UA 2AJCA 2RHDA 1XA3A 2P3SA 4JGGA 3L3BA 3OZXA 3RRNA 3SX2A 3PJFA 1NG9A 2PL3A 1L4NA 4EHDA 3Q6IA 5EIBD 4UVHA 3BL6A 1E9VA 1DC6A 5FADA 4M9CA 4HXEB 1VLJA 1WMEA 4LXGA 3FWKA 5DN6A 2P35A 1OXBB 3CPSA 2XT9A 3WLNA 4DQXA 2FFJA 1YDFA 1FFXA 1O8BA 3K6KA 4W9RA 3QJGA 2GCNA 1K63A 2W70A 5IEBA 3WA7A 4XVUA 3REFA 4EMSA 1EK2A 2ZJAA 4O4IA 4L75A 2AQIA 1AA9A 4IVPA 1QIEA 5KCZA 3LGXA 3AJAA 1XPJA 2CMFA 1B43A 3VHXA 5LMZA 2KZ8A 2AXQA 1UAGA 5ED4A 3K70B 1QZUA 4UREA 4YONB 5DDIP 5HBGA 4AXXA 4EW2A 2VATA 2E4UA 2OFPA 4JXKA 5DNWA 5EMMA 3CH5A 3FJ1A 4EEKA 1G17A 3I9JA 1VPVA 1XTRA 4O1MA 1B0PA 2C4VA 1F8YA 3GEIA 3R7WA 4A8JB 4DM7A 4C0XA 1DJOA 2GD6A 2JAWA 3A1FA 4O08A 3UW1A 3KBBA 5HNKA 1L0BA 1XF9A 4DQLA 1QGZA 2V7QD 2Y1WA 3A0UA 2BBOA 1VRCA 1RMQA 4PSDA 4IYJA 2JLZA 2PL1A 5D6NA 1ZM9A 2Q27A 3IEPA 4KIUA 2ODQA 4K26A 4Q3AA 3TZCA 4BNJA 4PLPA 2AG8A 2C3YA 1DV1A 1HOTA 1OZAA 2ZYHA 3H9BA 1ISFA 1FFEA 2LD4A 4KPGA 3VO2A 5JYCA 3UM9A 5EKTA 2AEEA 2CSFA 1K7YA 4Y1GA 2PUBA 4UEKA 1RCUA 3QG1A 4KVFA 3OM8A 3WOVA 4GMGA 3HDGA 1GUAA 1XWRA 3N0WA 5TQ0B 1P7WA 1W9HA 2FI1A 4RW0A 4P0PB 2O2CA 4LVOA 2EZ9A 5CBKA 4AP5A 5EWMB 3UFDA 1DJQA 1LDBA 1DAKA 4IZHA 4V03A 1JKJB 1NOIA 1TMOA 1CQJB 2PL5A 4MB0A 1T5BA 2Z58A 3TXAA 4ZEVA 4ZICA 2C95A 4HN4B 5EY5B 2ZBFA 2G7MC 4KYVA 1YJXA 5CYOA 3RC2A 3QSYA 4Q47A 4BTEA 9GPBA 2IWHA 1PL8A 3OKAA 5JZBA 2NMVA 2PX4A 4U3JA 1H4SA 1U99A 3QBDA 4K6OA 5JXIA 2PBZA 4Y1EA 1QX3A 3E2PA 5BSUA 4WK4B 3DHVA 1Q0TA 5SY9A 4AN4A 3NR2A 4OGFA 1USUA 2AVDA 1NDHA 3DZFA 4WINA 4B6JA 3P5BA 2YW9A 4FYVA 3TW0A 3ZGZA 4PLCA 1VSUA 1YJ5A 1FVHA 4A8TA 5CVUA 3DZIA 4ZQFA 5IMSA 4I3FA 3ZK8A 3ZN2A 5EYPB 4BJHB 2B99A 2P3QA 2QQGA 4K28A 3NPAA 4O2RA 2BGRA 5LOVB 3NCHA 4V24A 2C03A 4PFSA 1PV2A 5CD9A 2Q0QA 2ZREA 2CHFA 2A6PA 2OP1A 4B5KA 4C20A 2H2FA 2Z95A 3UK1A 3I37X 1DKRA 3DDWA 3RTBA 4GI2A 5ERXA 3D2BA 1I94B 3TNLA 5DH9A 2L18A 4PYJA 4YRRA 3U7FB 3DTVA 4P4GA 3GFRA 5IN4A 1FOEB 1WA5A 4HB0A 2B9EA 4B3HA 5L6MB 1TYDE 5JU6A 4EUEA 3ENZA 2OORC 2QAGA 5I4CA 1AKTA 2EF8A 1R9MA 4FT4A 2O2ZA 2QN9A 3AEKB 5DI3A 3P71T 4N3NA 5KZMB 3WMRA 3DSRA 2Y71A 2WVHA 2LCVA 1NU8A 1OFHA 2J9FB 2QIOA 4H0CA 1PYDA 2C42A 3FWNA 3KUDA 1DEHA 3NKVA 3ISJA 4RKFA 4RY0A 5G0TA 3C3PA 3RRZA 4L5IA 1A72A 2IHKA 3VOSA 5A4DA 3E3AA 2DBVO 1DC7A 3T9FA 1NXQA 1EE1A 5THXA 2ZI3A 1VG1A 3R6GA 4WKNA 2NU9B 4WOKA 2CWWA 2HCJB 5IULC 1YK0A 2W2XA 4GSKA 2YOFA 3ASVA 4Q9NA 1KWKA 4W5TA 3EVBA 3KJEA 4KXXA 1X3SA 1SC3A 4N7BA 3VDRA 1UMDB 4DG8A 3VKHA 3DBLB 3PR3A 4V0QA 4BYMA 4ZIRB 4MCJA 3U6BA 1II9A 4IIYA 3IPCA 1M0WA 4MKFA 4C0SA 4NI5A 4NMXB 1NM5C 1U2TA 3L0DA 2O3UA 4DIOA 4C7VA 3G3EA 4RTNA 1WUTA 2R60A 4G3XA 4WZAE 5CXSA 1XMJA 1LLCA 2VLIA 1IDOA 2X14A 4LVCA 3RS0A 1U4OA 2XV1A 1YO6A 3O84A 3QLVC 3H2YA 5EJMA 1W36C 4Z7QB 2NO0A 4H59A 4BAZA 2Z2JA 1CUUA 3B1XA 4MW2A 1XQ1A 3PQ7A 4G9BA 1AGYA 5H0IA 5ABPA 3LP5A 2I78A 2NPIA 3UC5A 3WSWA 3K71B 4RPKA 3WRYC 3ZTWA 4IHJB 1T5LA 3DMTA 2G8NA 4DWWA 4X4HA 1I0ZA 1KY4A 1EWKA 1LZKA 2EFCB 2O2DA 2VSXA 3IUMA 3OX2A 3ICWA 4PSCA 3W5UA 4BQOA 3NBUA 3G0DA 4CETA 3WIEA 4BP1A 4MARA 4JKOA 3TG2A 2Z8YA 1FSSA 1JFLA 4KHZA 3BRCA 4N40A 3PEWA 3WADA 3ORQA 4CPDA 1WXIA 3K0AA 1E5QA 3Q4GA 1BWQA 4QLOA 3TSCA 4H16A 3JAKA 1HF3A 4EW1A 2GZUA 3AZOA 4GYYA 1SD5A 1Z56C 4YUAA 5H4HA 3B2QA 2PLWA 1GDTA 1CQZA 4P36A 2PPXA 3R8XA 2JLXA 1A4XA 2IYTA 2WF5A 2FEMA 3IIIA 1CDEA 4MVWA 3OZFA 1A4IA 4WVLA 2PMDA 4PV7A 5CEJA 5HJ7A 3PU6A 3CQ9A 2HREA 4MSUA 5BURA 1BWRA 1MFPA 1ZIOA 3WLKX 3HB4X 1OAAA 3Q85A 4ARCA 2UUAB 4H0FA 1VA4A 5DRYA 4N5MA 1N2GA 3PLNA 1E8MA 1IIBA 3FYUC 4TX1A 3T9EA 5DOVA 3RVOA 3ZU2A 1Y3CE 2XGSA 5EJ2A 2PMKA 3BD7A 4KLCA 5AI0A 4DWOA 5BVGA 2JFFA 2YHIB 2GBCA 3ZNNA 1UEXC 1X1RA 1A1VA 1XZ8A 2AH5A 2AFVA 2PZLA 4DLYA 2UVQA 3Q3IA 2HBYA 4H3SA 2A5YB 4CL8A 4KQ2A 3L43A 4YROA 4QOGA 5DISB 4JBWA 2QJTA 4DHEA 2IS1A 3VZQA 2NSJA 2OZLB 3FG9A 3BICA 3KLBA 2AG6A 4G0WA 2NZUG 5G0VA 2XA2A 1H4TA 2BFPA 2FMXA 2GBLA 3MJRA 1SCIA 3PHLA 3P9PA 4XCVA 4CV0A 1INLA 1GTRA 3KUXA 1OFUA 1DKNA 1B8UA 4J7XA 3AWIA 3VHLB 4CM8A 3QE3A 2YDYA 4J4BA 2BUBA 5E4JA 1F5SA 1VKJA 4NJOA 4R1LA 3PNMA 3F4BA 2B0JA 2NW6A 2ZS7A 4JEIA 4GP9A 3COVA 3CR8A 4OUKX 4R2WA 4ZHQB 1OYVA 1YRLA 4V3CA 2ZQZA 3B7HA 3SIWA 4OMDA 3CKMA 2V5AA 3CV3A 1KJ9A 3A1WA 3FBTA 4KPUA 3W78A 3YASA 4EKEA 5I6DA 3PGLA 4HPXB 3AR8A 2YWJA 1FVFA 1UZNA 1XDGA 3HSKA 4FOOA 4ZAGA 2G63A 1MP0A 3P9XA 3SJZA 4MQ4A 4RH1A 1ZMXA 2PLRA 1V5EA 1ZJZA 3UH1A 1QO0D 5L4NA 1M1NB 2GAFA 4MEJA 3E5MA 4B3GA 3OZSA 1QMGA 5AJXA 3RHZA 3VR4D 1KYWA 1T6XA 1YBFA 4AYWA 3JD4A 4F38A 3KB6A 4C01A 3BHNA 4IGKA 5BWBA 3GLHE 1G8YA 1MAVA 3HJUA 3R0XA 4FDMA 3IS3A 1M6VB 4DJTA 1AY0A 1V2GA 3DBOB 1Z0FA 4OX9Y 4X8MA 4QJ4A 2WWFA 3B3JA 4X6LA 5JLAA 3ZQ6A 2RD2A 2OCIA 4AJKA 3NJ8A 4DUYB 3LXXA 2VA8A 4EO7A 3FOBA 4CZ2A 2ZIWB 3T4PA 2IBMA 4R2XA 3IT0A 4M0MA 2PX6A 1L7DA 4KODA 5IAAA 2ZXUA 2I4OA 3AUXA 3TR0A 3ODGA 1TCAA 3WP0A 4AJPA 4C4OA 3VZSA 1L7AA 2ZE7A 5C18A 4V0RA 1BXRA 1PR2A 4WTOA 3FPFA 4J9UE 3DMRA 4QPZA 1SBQA 1JLKA 3QLUA 5GZ1A 5J63A 4HWKA 2X1LA 4PZPA 4RD4A 3C3YA 2C1ZA 1ZNXA 5E1OA 2A1IA 1G1MA 2JCXA 1HA3A 1YB5A 2Q1WA 1WIWA 4I5EA 4X6UA 4XPIA 1YB2A 1UUFA 1ES9A 2HRRA 3U4MA 3A4LA 1T91A 4WBXC 3ZIUA 3L7KA 4FGUA 4G1MB 2FSUA 1NTOA 3URMA 5EQTA 2YN2A 4K6GA 3G82C 3R6TA 2I71A 4RBNA 4G5FA 1ZIYA 1TT5B 2YQZA 3KAQA 3LD9A 5E7MA 1CHNA 1RM5A 1K08A 1FYXA 2Y05A 4AJOA 1C0LA 1E9EA 3Q5EA 4HFNA 1Q7EA 4Z8YA 1FNCA 1S01A 3DXZA 3VK0A 1HSZA 2Z08A 4IOMA 4MCIA 5HRAA 3N2NA 4ZU1X 4ZT3A 4C0WA 2PJRA 3MWEA 2V59A 3PQ8A 7GPBA 3IE1A 2OZVA 1VXOA 4PX5A 4CODB 1RD4A 1X15A 1ZESA 4QE3A 3P2OA 3PDCA 4TYPA 4C0BA 3IPLA 1NP3A 4R9UC 3SJAA 5LQMA 3I9NA 3I6MA 4OIMA 4ECAA 2IS2A 2P0YA 2R8OA 3FKSD 2H1WA 1CUXA 2P2GA 4Q16A 5KJEA 2VJLA 4OQXA 4PAOA 5JZ9A 1C7EA 1M9NA 3AK4A 3HCDA 2K7ZA 3EAFA 2P8JA 2PXLA 1QLJA 4OHMA 3L2OB 2WWWA 1I14A 4JP3A 2OPHA 3EA0A 3PB3A 3FMPB 3M6FA 4MS1B 2J5RA 1NQVA 3DZGA 4QTYA 3KXKA 3EZ9A 1Z0AA 1R4MB 5DCWA 1MOSA 3H2BA 4Y9TA 4C05A 4HXGA 5ECWA 1JWAB 3TX6A 3WRVA 1ZCBA 2F1RA 3C24A 3A1EA 2E4AA 1TLLA 3A70A 2R4QA 3AETB 3L4BA 4IIDA 4MJXA 1QLWA 4PYKA 2M6KA 1Q2XA 5K51A 2R4UA 3PJGA 2V58A 3V5NA 1Q95A 3ZJYA 1AC5A 3DMTC 4B31A 1R7RA 3VSEA 4GICA 4BO6A 1QRUA 4YUYA 3QI7A 1CHDA 2X4LA 1L4HA 2XGGA 4QPNA 2NAPA 3WNDA 1SKQA 1QFYA 1GGMA 1RXSA 3C45A 1WW2A 2PMEA 2AHOA 4S2EA 4YC7A 1MB3A 1Z2DA 3A7EA 3ONWA 1NZJA 3ZCUA 3AEQA 4UPEA 3SVLA 1M7HA 2IHTA 3QFCA 4YREA 3ZHIA 3V8QA 5HJ5A 3ZPXA 1DO2A 1HOXA 3EWAA 2YICA 1K6IA 2ZSJA 3VSAA 2R66A 4Q3NA 3WZ2A 2RMKA 4EY6A 4UARA 3H2IA 1U7PA 1RRVA 3HB5X 2G06A 2JIPA 3REQB 5CDSA 5K8CA 4DQUA 3EPHA 2VA9A 3PPXA 2D7DA 1PEDA 4P33A 4XLLA 4D3SA 1TZJA 2EG5A 2Z8YM 2F1IA 3N59A 4I4CA 4EMUA 4RHCA 2XRFA 3O90A 4PLWA 4TKZA 4ZMBA 3ADPA 1C7JA 1UXHA 2OCYC 4L0CA 4WNAB 1Q15A 4MB2A 3IBTA 4PNZA 5FUMA 1EHIA 1AGPA 1NYTA 1ZEMA 2JC3A 3CGWA 3MPUA 4L27A 2AGVA 3UCXA 3HI4A 1EJBA 2BVNA 3IIEA 4MV1A 3W8DA 3BWEA 1QCYA 1W4RA 1KJNA 3IR7A 5IZCC 3HQ4O 3H11B 5ALWA 3CUUA 2W6PA 3CC8A 4EB8A 3LKDA 4RA6B 4ZCSA 2ID8A 2RHLA 3OQOA 2NSYA 4LWPA 1SXQA 5DLYA 4YR7A 2OZEA 3O2SB 3O9MA 4KH0A 2Q6KA 2PL9A 4PXYA 5TARA 3S8MA 1MF7A 3I9KA 5KNDA 2ACVA 4NZ9A 1Q0PA 4CTJA 5LP6F 3HNOA 4C5AA 5ISMA 1Y6QA 3AYXB 1PJLA 3D3NA 2YV2A 3O8OA 1BCSA 1SQSA 4L15A 5SZIA 2PXAA 1JDJA 4WJKB 2Y1KA 3THRA 1FNSA 3H6HA 3FUUA 5IYZB 2VRNA 1GNPA 2JGEA 4UAUA 1T13A 1T8UA 2J3EA 1ZNQO 4HRYA 4XGQA 4L72A 4MGZR 2XQGA 2H4JA 1CY4A 2C2BA 2YIMA 3LHSA 4B17A 5CFZA 1UKAA 4M1EA 2IDJA 1HG0A 5FUYA 2O50A 3ND9A 2QMHA 4FKMA 2DOKA 2J7KA 4NU0A 4DQKA 3RB8A 3LWZA 1JHPA 4F04A 3HR8A 4BN4A 1RC0A 3G2HA 3HDHA 1KO5A 1VBFA 3LNTA 1J90A 2FLVA 4FIZA 2R48A 4D0GA 3LISA 3O93A 2WJGA 3OZBA 3GN5B 2QLBA 3K1AA 4JODA 1G6KA 3EA4A 1CY1A 5JPCA 1P1IA 1QXSA 1CX9B 1UBEA 2IY9A 3ICCA 1FFSA 3KUUA 2QSYA 3AF2A 1WXQA 4FYYA 2ZR9A 3GJRA 4LMBA 4IX1A 3K6JA 4MRVA 3JRXA 4CFYA 4CV2A 1RI1A 3H5AA 4Q9LA 3O4RA 3BMXA 1NAHA 3R3WA 2GFHA 3KPYA 3VUEA 4IO1A 3IAM1 1YL6A 3DYBA 2F4NA 3ZVKA 4E21A 3PS9A 2CXOA 4IJQA 4MW7A 3KC2A 5KKCA 1GGFA 4GL4A 1NQOA 2XLCA 3PX2A 1OFTA 2J5BA 3TOXA 3W6PA 5ITWA 1EK5A 5I3ZA 3ZZNA 1YBVA 4YRQA 4IFBA 4OD0A 3HCCA 1O7JA 3NETA 5ALEA 3S2SA 3HXOA 4KR0A 1U5AA 1RBMA 3MLBA 1FX0A 1SCDA 3LS2A 4LYDA 4R54A 4UM8B 1O87A 4RVNA 3VR0A 4NENB 1TL7C 1RBZA 2G5PA 4I81A 5LIRA 4TMTA 1O0BA 4FFBA 4URHA 2V5UA 4Z5DA 1JI3A 2VDMB 5CR9A 5DBHX 3GFTA 2ODPA 4XX0A 3FOZA 1O94D 4QXQA 3T99A 3ZR4B 3TOVA 4BO7A 2XMQA 2WHPA 3MW8A 4BNYA 3IEIA 1R0LA 2CNWD 1XYGA 2FHSA 2MSEB 2W43A 3GZTB 4HJRA 1D6NA 1FP6A 1OD6A 4NKRA 2H5JA 1IHYA 1XI2A 4MW4A 4R31A 5DXJA 2W6ZA 4RTMA 2LBPA 3PJRA 4CI9A 3L02A 1Y6RA 1L5NA 3O75A 1OKKD 4BPBA 1BCRA 2CN1A 2GF2A 2PKWA 3FGPA 5A7GA 3KKQA 4UXJA 3JXBC 1T8YA 1UBFA 3PGXA 4AP6A 3ENWA 2XMSA 3GPIA 4HTAA 5FJIA 4B6SA 1V6SA 2QZJA 3QFHA 5JFOA 1IBLB 4M7PA 4QOFA 1C9KA 3VPHA 4CCWA 2I4NA 1RZVA 3VGPA 4C89A 3NM4A 1JR3A 4DLNA 1E79A 1QONA 4WH0A 2R7LA 2WMYA 5KYYB 1WB9A 1HETA 3GY0A 3M5PA 3VU9B 3I12A 3GWGA 3B85A 3BXXA 2XZLA 1R6DA 2Q50A 2F8SA 4BFVA 1SU7A 3AUYA 1LSOA 3HBNA 1TQ8A 2DPHA 4YWHA 3BRWD 3OURA 2ZRJA 2GAAA 5BMVA 4Q1DA 4DCOA 4ATNA 4YGXB 3STUA 2O54A 2O49A 3AESB 3GEMA 5LQDA 3D7SA 2NUBA 4CM4A 3QX3A 5L4LA 3IOCA 2A9KA 3AO0B 1C1XB 1I6LA 4RK0A 5A1TA 5KOHA 3P4UA 3NWOA 4LZZA 1Y8AA 4DE9A 4KG7A 6REQB 2AD5A 5KVCA 4ETIA 1QAMA 4NJMB 3IOMA 3RIEA 1EX6A 3T7EA 3BTVA 3RH0A 2FFAA 4G26A 1QHHA 3OCYA 1EMDA 4LK2A 3L4BC 1VFNA 3A11A 3EWSA 4KRYA 2O4AA 3CKLA 1KNQA 1DHTA 1GU7A 2OCLA 2Z1DA 3R6DA 4ZAZA 4MI1A 1E0JA 2H1LA 5SZJA 5FH9A 2HIMA 3G59A 1PT5A 4DSTA 1X77A 1LPOA 2WT8A 3DMHA 2LCIA 2V7VA 4EHJA 2P9HA 2P27A 4MGKR 3BD6A 5HF8A 3KJHA 3IEXA 1GQRA 2FPWA 3WDLA 3DNVB 4I6JA 4EJ0A 3AONB 3W5SA 1QFXA 1SOMA 4C22A 4YT8A 1TVKB 2ZBDA 1U8AA 2H2GA 1NMZA 2NXCA 3Q6NA 4HK4A 3VR6A 1P1BA 2IHVA 5BQXA 3FPKA 1FUUA 4ESEA 2O7NA 3DOJA 4IIXA 5A7HA 4I5IA 4L76A 3ZDAA 5FULA 1IXRC 1K8YB 3TVTA 3P2JA 4DUGD 5HPYB 5FTKA 3VH2A 4BVGA 1R6XA 2BE9A 1Y7HA 5K05A 5MN4A 3FUTA 4MAAA 3LWDA 4RUKA 4BX3A 5JQGB 2BHNA 2PT7A 3QOXA 2AZ4A 2ZB4A 1FDSA 5DM0A 1NYRA 2YX1A 4TOIA 1PP4A 5C8VA 5IBCA 2NP6A 1EFDN 4TZTA 4MCTA 4XDYA 5EMHA 4MI3A 2XSDC 1I9CA 3EFBA 1HLDA 2V5VA 1B0ZA 4LZWA 3GRFA 2JBAA 3A1SA 4F1JA 3THWA 4DTCA 5GAHi 1GKIA 1E2DA 5TS2A 3QE9Y 2Y1EA 5HIIA 1IOLA 2ZYUX 3QVSA 1W34A 5AR1A 2FOXA 2MYTA 1WUHS 4CMEA 3G5AA 3SEZA 5E1DA 3HYCA 1T5DX 5TQJA 3QHQA 3ZU4A 3GCXA 2ZWOA 3BK7A 1RABA 2IY8A 1GG2A 3CMCO 1IYZA 4QM7A 1ZP6A 3HC7A 1O08A 3L7CA 4L7VA 1F06A 4M0UA 1GL7A 1BHQ1 2QX6A 3EB9A 3G0IA 4WFKA 5KREA 3S7ZA 3ETJA 4H0NA 4KQMA 4RABA 5AIAA 3PHIA 4XPZA 4WCFC 3R76A 2PPLA 2F1HA 2XNJA 3D8NA 2Q41A 1EIZA 1RJWA 3FR7A 1G3RA 5LZ5A 2WTUA 1DQZA 2Q3HA 2IY7A 4LKRA 2X2PA 3KSAC 1U4NA 5DF1A 4FJ0A 1T9DA 2JAQA 4F3YA 2I9PA 4A82A 3D1NI 4US2R 1KQGA 1H3FA 4U2DA 2QPTA 2BEVB 2YWEA 3SHVA 3U9TA 5T4EA 3M6XA 3TS1A 4DUPA 5JWOA 2B5OA 3T9AA 3V34A 1JL3A 2DECA 4DMMA 2L49A 2Q2NA 1CNMA 3NNDA 2DWUA 1E5LA 2F62A 3IB3A 4IDHA 4NZMA 1TA0A 4PGMA 4HEA1 3D6HA 4BFUA 2VCEA 4Q7JB 1ZU4A 1JJAA 3JR3A 5K3FB 1E8DA 2IOYA 3WQQA 2QVZX 2JGNA 1V45E 2QR3A 5FTLA 1TQ6A 1VLQA 3JQ7A 1F4VA 3ZJ4A 4ZI2A 2FMTA 4P98A 1E1YA 3C39A 2XCTB 1GPBA 1F8XA 2SBTA 4G8BA 1U8FO 1KR5A 2PZFA 3FUVA 1GNRA 2A3RA 1T5SA 4RCYA 1UKVY 1AGXA 2Q5EA 3GRCA 4I1VA 3NAZA 3KXAA 4KGZA 4MLZA 1H69A 1H4QA 1IZ9A 5AOBA 4FW8A 1J56A 2PG3A 2XSZA 1HLPA 3HUFA 4P82A 4Q3OA 4Y7DA 5CT4A 5HFNA 1SCKA 3PEFA 2QXUA 3WAKA 2R7AA 3P4XA 2UVPB 3FBWA 3GLUA 3Q2OA 1YB7A 2VBGA 4MR9B 4ZEWA 4MWTA 3UPTA 5JG7A 1EG7A 3SS8A 1THGA 1CR4A 2A0UA 2ZRHA 1OIVA 4X3PA 2H1IA 5HTKA 4YDSA 3T3MB 4PZLA 3A36A 3LO8A 1O57A 3SOPA 3QYJA 2K2WA 3SQLA 3WQSB 1F1BA 1A2QA 1ZL0A 2V8OA 5C52B 3NDIA 3PXPA 2FFBA 3JX9A 3NOXA 5LUAA 1T5HX 2O2EA 2YIJA 1NN5A 1SMKA 1SZDA 1Y80A 5CPBA 5EJIA 5I8ZA 2ZLBA 4FC6A 3FMIA 4G1VA 4PYIA 3P2YA 3VR2D 2OCBA 2FWMX 3NHUA 5CDYA 3DG9A 1RQGA 1F17A 4S1TA 1QHYA 2CC2A 4WGGA 3ET5A 1KC1A 3GVCA 3D54D 2AL7A 2PR2A 4N0PA 1E2NA 3WGNA 1JKIA 1OXVA 2Z2YA 1CUGA 5BR7A 5LU8A 1OH5A 1EAMA 1Y8QA 2UYOA 3H3XA 3OAAD 4XQ0A 1YJBA 1RLUA 2DWPA 2QMEA 5FAXA 1T1GA 2RBGA 2GBPA 4F4DA 1HY3A 2GZSA 3PRKE 2CYBA 2GRJA 2ZRQA 4JI0B 1LFAA 1RJ9A 2P6OA 2R8EA 2OXTA 2B1IA 2XNSA 1C9EA 3F96A 2HKIA 3PWSA 1HYHA 1RACA 4NESA 2JGFA 1CJKC 2VH2A 3OKCA 4OHBA 4N6GA 2NACA 1I5RA 1JDVA 3VHQA 3SGLA 3VQTA 4D42A 5IT5A 4ZTZB 1UWLA 1IG3A 3A4VA 5J4LA 3AFMA 5B3LA 2VP9A 3HVRA 2NM0A 4JLDA 5DJ5A 4XVHA 3VR5H 5JRDS 4TN1A 2D3WA 3EXFA 1NQUA 5KNBA 4EF5A 1ISJA 4DNXA 1HUQA 1CJBA 1X80B 4OHFA 1NUAA 4YAGA 3KETA 4P2BA 1E60A 1U3TA 3NGLA 5EQDA 1WZEA 2CXPA 4MNTA 4DA7A 1R3UA 3GFFA 3AX6A 3HBMA 3PXCX 1L2TA 3LQ4A 5T64A 5D5PA 4ZCLA 2HQOA 4CMGA 5LBTA 3AJEA 2MEZA 2ZS9A 3KQQA 3MIZA 1QG2A 4PHHA 4ZWNA 3ROKA 2P9TA 5BSGA 1I5OA 1N5MA 5C35A 5MGNA 2IUTA 1M6WA 1GV0A 3WWEA 1GL6A 3BFKA 4JLPA 1QKJA 1JHXA 4ZGGA 2OD2A 4PG5A 5E38A 3E5HA 1U3GA 3QKTA 3TLGA 7REQB 1SBZA 1CF9A 1XYVA 2FR8A 2TS1A 3CX8A 4BNMA 3AY6A 2EG9A 3CLKA 4RIFA 1Z38A 2CF6A 5CNMA 4AB1A 4B47A 3O7MA 4TL8A 1XCOA 5D00A 3R7NA 4JL8A 3EEIA 3DMGA 3EZ7A 2NZJA 1ACLA 3EBOA 3OPYI 4Q4HA 4X20A 4EECA 2QGFA 5LCXA 3U44B 4KLAA 4YJ2B 2VRBA 5AW0A 3EIOA 4ZVKA 2CVOA 4RJTA 3PIRA 3N9IA 5LFAA 4DR2B 4DMHA 4DMGA 3GLVA 1V5IA 4XQEA 4MQBA 1KAEA 4S1PA 4ZA2A 1Z33A 1MAUA 3BZWA 1UEIA 2H7VA 3EDQA 4DLXA 1KEVA 4Q7KA 1E1RA 4W7HA 5FRDA 2G36A 1NTRA 1KDRA 2H7CA 2GHTA 2HA5A 1Y1LA 4C4ZA 1EUDB 3Q8KA 2VRCD 3E2MA 3K2QA 4EY3A 5CTJA 3U4QB 4XYMA 2NTNA 3WK5A 3L93A 4BV2A 2WT4A 1L5QA 2L19A 2VJQA 3ZC3A 1S3FA 2X0DA 3G0GA 2GN2A 3DEYX 3OBBA 2G5TA 3E81A 4CKBA 1CJCA 1K5DA 2IGTA 4JI8B 4OJMX 4GMFA 5IT9A 4U2FA 1CY2A 3IMKA 4UE2A 1S89A 1QP7A 3NTUA 3LHDA 1ZK1A 1DAPA 2PGIA 2VDQB 4N4AA 2CSXA 3KYDB 1RTKA 1SBCA 2AUMA 4BKRA 3OQIA 2RHMA 1DG3A 3TCKA 1D1PA 1WZIA 2AFRA 2AR0A 3CO0S 3KYCA 3QYXA 4KK3A 3LUDA 2EHDA 3ECAA 1NASA 2GM4A 4EFKA 3WGGA 5TXGA 4BMVA 1JH8A 3MTIA 3PQ2A 2ZAIA 4U0KA 1T25A 3PFKA 5FWXB 3OX1A 4ZPXA 3GPCA 1NI3A 2CE7A 3CT4A 2QI9F 2ZWAA 2ZR0A 1VKOA 3D3WB 3M33A 4D6PA 4D9EA 1L5HA 1ABBA 2ZULA 1I6KA 4RGBA 4NH4A 4N6NA 5A3RA 5C5CA 1YWGO 3RYIB 3G2NA 4ZAWA 1NXTA 3U39A 1GGKA 1VHDA 4WY2A 3ICPA 4M6WA 2KE5A 2BBSA 4M8SA 5HGXA 3E35A 2ICPA 3OJWA 1OX5A 4RVCA 5JVDA 1FYWA 1OHHD 4YO7A 3L7DA 5KWEA 1PRVA 1XMIA 3O9XA 5ALQA 4U7HA 3U61B 3L82B 4CKYA 2J7PD 1JAHA 2IUUA 3TPCA 3ZV7A 4JT2A 1US8B 1RRMA 5LQRA 2W2KA 2M1XA 4G1FA 1I3CA 1CS4C 1MU0A 2EFDB 2OUIA 3I28A 4UUAA 4WKPA 3VUFA 3ZXSA 3N7TA 2YWFA 2ZRPA 3AV0B 2XQFA 3VKFA 1KS2A 2P9GA 1FZTA 5K0SA 4BC1A 1R27A 1AT1A 3DR5A 3ASYA 4C06A 1BD4A 4RKWA 2PQMA 5IUKC 3WIUA 1KEKA 4KP7A 3ZWDA 2VRWA 4KMMA 5E2BA 4ZDWA 4YAKA 4YRBA 3NC1C 1ZJ5A 3WZMA 5ELMA 4EGJA 1Q1GA 2LDXA 4MYHA 1B15A 2QL9A 2XKAA 1XHEA 3TFQA 1I4WA 4E11A 4WBNF 1QU3A 4N82A 2OFYA 1JGTA 2E9SA 4KFSA 3TAXA 4WWHA 1LRKA 4LRUA 5A5EA 1CSEE 2CL6X 3MSCA 2WU1A 3GNQA 3HYNA 1VYTA 3TTVA 1TPYA 4QYXA 1XTIA 4GXRA 5JW6A 3LC7O 2MR6A 4GRDA 2CL5A 5E95A 1WVIA 4BFZA 1PLLA 4GRAA 4YDQA 4U7GA 4DBLE 2XZOA 3E2IA 3QX7A 3PEUA 4HADA 4MS4A 1I3NA 3QIVA 3UO8B 2GZHA 4BMYA 4JI7B 2PS1A 2RB5A 4OHOA 3SYLA 3WIBA 4C0AC 3R0QA 4EAQA 5A0TA 1P7PA 2XA1A 3LQFA 4BCCA 1P72A 2GUWA 4QYIA 5IK2A 1E7SA 2H5LA 1U0RA 4O4HB 4ROSA 3ZWBA 2JFPA 3OJFA 4DLSA 1CUAA 4RMGA 4BO1A 4JXXA 1TM4E 1TU3A 1NF3A 2IEIA 3A1UA 3CBQA 5SZHB 4B3JA 3V1NA 4RSHA 3SZOA 1QAQA 1YACA 3QF4A 4CG1A 4TMYA 3MHTA 1JWLA 3Q0TA 1U31A 1GHTA 4P6VF 1W94A 3V4OA 1I2ZA 1ULHA 1J49A 2CXRA 3HZOA 3RD5A 3H2KA 1B76A 3BE8A 3EUSA 5LA6F 2BFDB 3U0VA 3LVBA 1ZJ4A 4RE6A 1NDQA 1FSGA 2PJZA 1PN3A 4O1IA 4LSMA 1E3OC 3ABQB 1OUMA 2IHUA 3ASUA 3HUEA 3FDJA 1RMYA 3R44A 1SN7A 4YP0A 2FDRA 2DBYA 2TMDA 2COEA 3SF8A 1O6CA 2MINB 1LDNA 3GAAA 1H8EA 4EYGA 3ON5A 3UJBA 3D0OA 1FTSA 2IYYA 2QL7A 1HKHA 4PPQA 1H66A 1Y8ZA 1ONSA 1ZZ7A 2FR0A 2I65A 3EARA 1YBHA 2OB1A 1NJ6A 4MV0A 4YV7A 2EW1A 3GEHA 4LHZA 5FA6A 3UA3A 3WLAA 4B2YA 2QRMA 5KVAA 1N6OA 4DPMA 2PKXA 1KMIY 2GJAA 3BDVA 2ATEA 2MJLA 3KO8A 1UPUA 3KM0A 4RIGA 5ELLA 3DZHA 3VC3A 1SR8A 3LFTA 1QBKC 2P75A 3JZAA 1G8SA 1SA0B 3S1AB 3TE6A 4JUIA 2FMIA 3O8RA 4MVJA 1LDYA 4QUBA 1JFFA 4D8VA 1XO1A 1ZSNA 5I4BA 4NOJA 1NW7A 3TD9A 1WQ1R 3ZD9A 1A8QA 1DT3A 2ID4A 1W36D 3G9QA 5A0FA 1ULTA 3FRIA 1GSOA 4JLVA 4JX9A 2AXZA 1M6YA 4Q66C 5DMXA 4OBMA 3U0BA 1L4UA 4FZVA 4DDHA 3EG9A 2RGYA 2QPOA 1ZONA 3RVLA 3WRXC 2H4HA 1Z6XA 3P9SA 3MLAA 3ZDBA 3BJZA 3I2GA 5CVEA 2WIDA 5F1OA 2DTDA 3KZXA 2W11A 2WJYA 3V8EA 5BSHA 3EPJA 4EKNB 2SICE 3MGAA 1UZLA 3A4NA 3K96A 2HINA 1HDRA 4TXLA 4Y98A 3X0DA 4ZMSA 1ZS4A 2ZSEA 3V00A 5HS4A 2Y0EA 1D9XA 2RHOA 1DKMA 1ULSA 2E55A 3IJPA 3OZTA 1A77A 3QU9A 5HGJA 4DCSA 5LP1A 821PA 1D7OA 2WZCA 3GN2A 2X5XA 3MPOA 3AF4A 3LUFA 3INNA 5FPYA 3RM3A 3X1ZA 4EB6B 4EPWA 2XHEA 2BHSA 3Q9SA 3SPXA 1P5RA 4IIJF 1LUAA 2ASVA 5CCDA 3VH3A 1GZUA 4C7XA 3E1SA 3R7BA 2WYWA 3DQQA 2A8YA 3MXTA 4JI1B 3NT2A 2EKDA 1T43A 5AUOB 2Q3EA 3BN3A 4Q1AA 3WLPA 4EKDA 1U98A 3I2JA 1KY2A 4H3VA 4AKSA 4W99A 1C2YA 1RWVA 4W6ZA 4WW0A 1VFPA 3AUJB 4RH3A 3C1AA 3IR6A 5BRJA 3I62A 3C3WA 1SQ6A 3PL1A 3CLHA 4HWSA 5M5BA 2XAUA 4GLBA 1UQRA 2K87A 1R6AA 2I6XA 2WK1A 5D3MB 2PANA 1EGAA 2ZOSA 3ZKWA 1G59A 2F17A 1EFAA 1XNJA 1AM4D 2E4XA 4OQPA 4UM9B 2VTBB 5K8LA 2BZGA 3NGXA 4M0DA 5AM4A 2H5EA 4UDNA 4OI4A 4E3ZA 1N5IA 3A1DA 1HYEA 1ZAKA 2O0HA 4JN6B 3G0BA 1GRNA 1PDWA 3FYHA 3LP8A 3W2TA 5CBPA 5CFPA 4R7GA 1HX7A 1T9ZA 3BWCA 3QJ5A 3UFXB 1Q12A 4KIFA 1GNSA 5BN3A 2MSLA 1FLVA 4TRNA 1A7AA 1Y7PA 3UANA 2H2WA 1P0CA 1VJDA 1VIVA 4AUNA 2ZZNA 1IHXA 1S8AA 2CDAA 4P4SA 2GTPA 1NEQA 1P74A 1SUFA 2FX3A 2NQ8A 3WLLA 3RFUA 4BJ5A 1L4MA 3HYTA 1B6GA 3QV1A 3CF0A 4N7RA 3G13A 3VHRA 4FJ2A 4WOPA 1NNUA 4WDRA 2H2AA 1T2UA 4TVKA 1CEQA 1SHZA 2J8ZA 4Y1FA 2EWTA 3EGVA 4ILKA 4IEEA 4JHXA 2G5CA 4LMPA 1SEVA 3I2IA 1HO3A 3SS9X 3B9QA 2FPKA 4P0TA 1GFZA 1GNTA 1UK6A 4QULA 2H9IA 5BSFA 1E4VA 1NXWA 2Z6VA 1NKVA 3WKEA 5C4MA 2F7SA 5U9CA 4A6DA 5JDCA 1N5RA 2OBLA 4FNMA 2XZPA 4LE1A 2VYQA 2AI3A 4JSYA 4M0LA 4X92A 5JANA 1O96B 1VKRA 1UFRA 3G0OA 2CLOB 4GX2A 5GM1A 5H82A 4LNAA 4Q1EA 4ER6A 2Z30A 3F4KA 1Z8NA 2ENUA 1YJ8A 4RFSA 5FL7A 3SZLA 5AVSA 4QQFA 2I1QA 3ZG6A 2CJPA 4NLLA 2ZSHA 4MWZA 3K1ZA 1AUXA 1R64A 3GC6A 2CKDA 3AUAA 4P08A 2O0JA 4G85A 4LFCB 5K3OA 1XQWA 5H70A 2QD4A 2WWVD 2NTYC 3EIEA 2C0PA 4MDYA 2BKLA 2D06A 4EQZA 3CPJB 2OHVA 5CCEA 1OT5A 1U04A 1AVTA 2R79A 1CR2A 1YHZA 2YMQA 4MHSA 4IQ4A 4UAJA 4E2ZA 1U7XA 4FHGA 3LH5A 1CNEA 4MTCA 1YOBA 5TY0A 4BMCA 3QK7A 5L95A 2PXBA 2X8JB 1WPXA 3LA6A 3UMGA 2JRCA 4DR6B 3DNPA 5J2UA 3NEYA 4O4IF 2QJFA 3PLAE 2O48X 1TC1A 5EIAA 3RUDA 3F8WA 1E1MA 2B8TA 5G0UA 2FFHA 1XOIA 5DYGA 2PRJA 1MO6A 1EHYA 3AGQA 3A2KA 3HK2A 1QWSA 2RG1A 4U9HS 5EHXA 4OAQA 4BN5A 1CIJA 1P1CA 1T2AA 2BDEA 2FPOA 2K4MA 3O8QB 5LXTB 4XCQA 4AWAA 4HDSA 4XM2A 4ARVA 4KKVA 3LPCA 1F9AA 2REQB 2WUDA 3CF4A 4JCYA 4D46A 2P6NA 4WKOA 4QJBA 1LWNA 1GT6A 3GEBA 4Q34A 2XIUA 1LGYA 2PXXA 4DZZA 4KQCA 3H0CA 4PZUA 2Y67A 4QARA 5E6UB 5BV8A 3AKDA 2E0IA 2PIAA 3O31A 4WZBA 3WLRA 1OFUX 1J0DA 3OKZA 3HG7A 1D5WA 1A5BB 2JGDB 4OYYA 3RS7A 2HZBA 4I1OA 1G1AA 1SQ5A 1R8QA 2EERA 5J4YA 2GSDA 4MJLA 3GUYA 1XLUA 1CBUA 1F0YA 3ZDEA 2V7PA 2RJ3A 1YQ9A 1U1CA 2JZOA 4J1SA 2O19A 3ZDDA 2VEDA 3CX4A 3JD0A 5L7WA 1H3NA 1DO8A 2NIPA 1GVHA 1JT2A 1VE1A 1SHUX 2GASA 4KZKA 3LOQA 1XZIA 2C8KA 4HAOA 1JHDA 4MMZB 3IGFA 4IIGA 3ED1A 1DAOA 5EL0A 2NO6A 4I5FA 2DCMA 4EUKA 3NBQA 5ALKA 1AX9A 4LRXA 5LMNB 4U7JA 1FTYA 2JIZA 1C3OB 2AK3A 3GEEA 3BBPA 3U80A 1N2SA 3B7PA 1E6EA 2EP8A 2B2XA 3CZAA 1UBKS 4MUMA 3GQBB 3ZCVA 4OIFA 3T3GA 3ZXYA 1YA6A 1HKUA 3GGGA 3KOWA 3RARA 3PFGA 4E07A 5TT1A 1EK6A 1RQ2A 4RY8A 4CIBA 1ONNA 4UDYX 2DQZA 2A5FA 3COPA 1FIUA 2GNOA 1GGHA 2RBKA 3I8OA 3UK6A 3TRFA 3WWPA 1E62A 1X2EA 1F5NA 1OIWA 2YV4A 3ELBA 4QHSA 3QVOA 1VCNA 3ELUA 1EXMA 4TS1A 2QX9A 2A86A 4F2PA 3TG8A 1WS6A 2ZE5A 3K6SA 2VPIA 1MPXA 3LCRA 1PTJC 1RXWA 2ZVPX 4WK6A 5B1SA 5CAEB 3E0XA 3AUKA 3ANSA 3PE5A 4Z7JA 2XBMA 3NHAA 1NURA 3UAOA 1L5RA 5JZVA 2Y99A 2HRBA 4MVJM 5H80A 5JZSA 5IAGA 3PNLA 5DN9A 4B3SB 3A32A 4XGIA 4NPHA 2QI9C 3UTDA 3CMMA 2XMRA 5DNAA 3SIXA 5JT1A 3IH5A 1MIOA 1RSZA 5F35A 3WFZA 1ZRSA 1R9NA 3L84A 4N8SA 2IOQA 4CKWB 1GG9A 5F9MA 4RDIA 4MKIA 1DSSG 5TEVA 1DAGA 1TD9A 3K0BA 2ZYWX 4FINA 4I4TB 4JGIA 2HHAA 4O0MA 4KN5A 3RYHA 3SWWA 2WICA 2EW2A 2J48A 3EOZA 4R6XA 1W4ZA 4UUNA 4KL8S 1JUDA 4R0NA 5K0CA 1G41A 3O2JA 1A8PA 5LQNA 4E5NA 1KJ8A 1XYYA 5CMLA 2FZVA 4ZO9A 2JI4A 3I2YX 5F52A 4BEJA 5EJ9A 3BB1A 1P5FA 1ZMRA 1PFUA 3CLUD 4HVTA 1T4GA 1EWRA 3NATA 4FFLA 5ESXA 1R5BA 3MTEA 4LA4A 3CVWA 2R7NA 4KPYA 1NPDA 3TVDA 2IYUA 2C2KA 5JY6A 2ADFA 1Y0BA 3VYSB 1U6KA 2IYNA 2JDID 3JPYA 5DX1A 1CJTC 4RV5A 3R41A 1DBIA 1S02A 2B8NA 3C41J 1CDZA 3PFHA 3TQRA 4EFDA 1FP2A 3TMAA 3FVQA 1VM6A 1E6LA 5TGTA 4J91A 3ID6C 5ESRA 1ZGCA 4HGZA 3PNOA 4OXNA 1GU0A 2AF3C 1Q0RA 4XUCA 3QPWA 1X8XA 2JJ2D 4H7KA 5KDDA 4JQCA 1N2CE 3E1KA 4D9CA 1CUZA 2RI0A 2Z8ZA 3BDIA 1DE0A 4TVOA 3TW4A 1K6JA 1XCPA 4TMXA 4CQLA 4KMSA 2IVQA 4J6FA 3N2ZB 3NU1A 3MRSA 4YRKA 4J16A 5JYDA 4HWPA 3RW9A 2I7VA 3DBVO 3DE6X 3W2EA 3DCIA 5AK4A 1Q16A 3L0SA 1LTHR 4RV4A 1VGRA 3CURA 4A6PA 10MHA 2JARA 3L0OA 4P53A 4DARA 1EDZA 1RXIA 3JARB 4OKSA 4DXAA 1ECFA 2MQKA 2FW6A 3ACBA 4XUDA 4OB6A 1ZCAA 3FSJX 1L5GB 4B3BA 1J70A 4QQNA 4G0XA 4UVDA 5TQ2B 3ZWKA 2VDOB 4EHLA 4HSGA 1YHYA 3NYIA 4J07A 1E63A 1QZZA 4HWRA 2BSXA 4G5YA 4GEKA 4UU7A 5JCJA 4EHKA 1XPOA 2FJPA 4PLFA 4IHQA 3K9HA 4RDCA 3Q8WA 3L18A 1GU1A 3PI6A 2VDNB 2KJQA 4WNYA 2WYOA 4C1NA 4I66A 3FDFA 3EIQA 3LECA 4F2HA 1USGA 5BP7A 3BE6A 4JEUA 1W0JD 1Z2EA 3IHTA 4IGFA 4DLVA 1EA5A 1DXQA 4M22A 3ZDCA 3KSUA 3KVVA 4LGMA 5AK6A 1C9JA 2GK7A 2QP4A 3W5JA 4V0MA 1ZD9A 1T15A 3IMCA 4LYGA 3II6X 3JQFA 4ZYYA 3F47A 5IKXA 1FL9A 1Z5WA 2B35A 5EWJB 5KYTA 1S96A 1L3IA 3KZOA 5DB4A 1IUKA 4R8VA 3RT1A 2CNKA 3K9FC 2A30A 5EI5A 2VDJA 1WH8A 5TQVA 2YNMD 3WYFA 1EFUA 5I7OA 1KY5A 2E6UX 4RVDA 2OUKA 4WT7A 3CX6A 4ARBA 2WHRA 4D1YA 4XWOA 3U5TA 4K8OA 3D81A 4D96A 5EJ8A 1TTTA 2DPLA 4TMFA 3BZUA 2YN0A 3HVUA 5REQB 4MRSA 3JQAD 4HNSA 4B3RB 4U6NA 1EFPB 1HYQA 1R0YA 1USVA 1Y3DE 3K4HA 3DFUA 2Y1DA 3LT5A 1EUZA 3AOEC 3QVGB 2FXVA 3WMWA 2OCAA 4BMNA 1I13A 2GRAA 3QW2A 4RZSA 1ZAYA 1EP3B 3FRHA 4GE0A 1G8JA 3RTCA 1T3SA 1UBTS 4MV5A 1C8LA 3OOJA 4DL9A 2IP2A 3CROL 3B2NA 4JJ6A 3C8UA 5IDYA 2VQ3A 2IZ5A 5JATA 4HEJA 2HGSA 3TNDA 4BLUA 1BS2A 4U2CA 5J9FA 4A3SA 4A8JA 1G20E 1GGNA 3P27A 1NNEA 1IEWA 4BLRA 2QYHA 3VNQA 4U7DA 3M8KA 3GMIA 5HQ3B 3LIPA 1ILEA 5JS7A 2W2MA 3LBAA 3O73A 4KUHA 4N8DA 1E61A 3T5DA 1JALA 1V1MA 2OGZA 1ORHA 1XU7A 3L8ZA 5HIMA 4F12A 2QLFA 4HDKB 2J85A 5K6AC 2GLTA 1LC0A 1Z4OA 2PKQP 1I01A 4PFJA 2ODRD 4HBZA 3R23A 2V74B 3ZHCA 1UWVA 1YFJA 5JSKA 3RUHA 3COYA 4ZAFA 3IHLA 3N8NA 3TSOA 4IFEA 2RCNA 4YA6A 2WJ4A 3ICVA 2HQ1A 4PX3A 1MB9A 5EWMA 3AVPA 1R0KA 3OQJA 3QFSA 3M3PA 2I66A 3I4CA 3MINB 3PDHA 1JKJA 4F9GA 3JW8A 1CQJA 1MUUA 4J03A 3UKJA 4NCHA 1N6LA 1BGVA 2H1CA 2X9NA 4IUBS 2H8RA 2LW7A 2EHJA 3W05A 3RIYA 4CM6A 4EX7A 3E7DA 4IXNA 2VHYA 3WJAA 4RS4A<