2PUDA

Crystal structure of the laci family member, purr, bound to dna: minor groove binding by alpha helices
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
338
structure length
338
Chain Sequence
TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLEANTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*AP*CP*GP*CP*AP*AP*AP*CP*GP*TP*TP*TP*GP*CP*GP*T
publication title Crystal structure of LacI member, PurR, bound to DNA: minor groove binding by alpha helices.
pubmed rcsb
source organism Escherichia coli
molecule tags Transcription/dna
total genus 118
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 1997-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2pudA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pudA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pudA02
3H1FA 2GX6A 5KQLA 4WZZA 1VLZA 3KJXA 3QLUA 2ICTA 4EYQA 2PJUA 2PUBA 3NNDA 3GN5A 3U3WA 2KZ8A 1YK0A 4MS1B 4MRMA 4FE4A 2IKSA 3T8YA 2IPNA 4RK1A 3DGEC 2FTKE 1RXIA 5ABPA 1XWWA 5JS1A 2R1JL 3N8IA 4YG7B 1DZ3A 1P6QA 2RJOA 5HM6A 3QF3A 2PUFA 4GHJA 4MGEA 1L5YA 2GBPA 1XHFA 1U04A 3HDVA 2PLNA 4IF4A 2QV0A 5DTEA 2XJ3A 2FVYA 2IVQA 2WIUB 1Z2EA 2QW1A 5DLEA 5JNVA 2MEZA 5JNRA 1ZITA 5HQJA 1ABEA 2PL9A 2L18A 5CNMA 4HNSA 3RVPA 3H5IA 4OBBA 2MQKA 1T34A 4XARA 4ZPJA 4E7OA 1M2EA 1ADRA 1EWVA 2HQRA 3B7HA 3BS3A 4HNQA 4ZJPA 2LYPA 4JAVC 5JNWA 2FMFA 3R1FA 2PUEA 4IGAA 4MPTA 3RVMA 1Z15A 3DGFC 3G85A 2YHAA 3H5OA 1P6UA 5KWSA 3CKMA 4GNRA 3I09A 3QLVC 1JFSA 4OG2A 3RVLA 4Z4CA 3I5AA 2BNOA 1DBQA 4MS4A 3HJFA 2JBAA 3C97A 4YR7A 2GKGA 4L4UA 4Q6BA 4Z5DA 4JQDA 3HUTA 5IUJC 3MIZA 4H3HB 5KQPA 4NCBA 3KHTA 2AWIA 1JH9A 1CHNA 4P1ZA 4RKQA 1RPJA 5TE9A 4EUKA 4DN6A 1Y9QA 2IV1A 2MSWA 4MLCA 3ZHIA 1ZAYA 1NTRA 4NV3A 2WB4A 3JS5A 1SQ8A 3CRNA 1DC7A 4TLMB 5IC5A 5KI6A 3URMA 1APBA 2YHBA 1Y7YA 2L8NA 4FBIA 1SXIA 1USIA 1K66A 1NXSA 1JHZA 1Z13A 3H6GA 4RY8A 3NNNA 1M5TA 4LE1A 3TB6A 4DQDA 4RU1A 4YV7A 2VUIB 2IUOA 1ZZBA 1Z17A 2BNMA 4PU4C 4EVRA 4WXEA 1EWTA 4X4BA 4O1HA 5EWLA 2HJ9A 1YIOA 3K9CA 2LYSA 1NATA 1J56A 1ZPQA 3OQMA 2IVBA 2E4WA 4LE0A 1U0SY 1FQWA 3E3MA 4LDAA 4UHJA 3DBIA 1LJLA 2A9QA 4RY9A 4NCAA 1BAPA 2R4QA 4KV7A 2J48A 1AB5A 4IMIB 4OB4A 4M88A 4X4IA 1MB0A 2CD7A 5B3JA 1ZESA 5T3YA 3JVIA 4X4GA 1LLIA 3LKBA 3SY8A 2KYRA 4QYMA 3L49A 2O20A 2WUSR 3D1NI 4IVZA 2Q5CA 3O2JA 3P9YA 3Q41A 3Q7RA 5I4CA 4X4EA 2GRLA 2LYRA 2OENG 3QYXA 3LMKA 4G0YA 5KQGA 3GN5B 3HSYA 3Q7SA 1QP4A 4JASB 3RVJA 1QQBA 2LYJA 4MRMB 3GRCA 5C5CA 3FFXA 1OCTC 3H1EA 4KQCA 1A2OA 4J1XA 3R0JA 1DW9A 3MF4A 5CNIA 2A9PA 3OQNA 3NNSA 3LOPA 3KZ3A 2QR3A 2LBPA 1TM2A 1Z2DA 4HYEA 2M1ZA 4S05A 4D74A 2A9RA 3RVSA 3LTEA 3GBPA 3RH0A 1ZZ6A 4J1WA 1MVOA 4W5QA 3DLHA 1U2QA 3RQIA 2HPHA 4I6UA 1NY5A 2LUOA 2MYTA 2BNNA 1QP7A 3O1JC 3QK7A 4Z0NA 3CECA 2E4ZA 3OO1A 1E6LA 1USGA 2XI8A 3N75A 4KMRA 1JBEA 4QYWA 3F51A 2ID9A 3KYJB 2PIJA 1B0NA 3O9XA 2IU7A 4FN3A 5FBKA 4OLBA 4MR9A 1ZZ7A 4LDZA 1PRVA 3F6WA 2WJWA 4RWEA 3JPWA 3M9XA 4JCYA 2B5AA 1WETA 2LIVA 3O1IC 4TN5A 5TQJA 4Z4IA 4O1IA 3N53A 2AYXA 1EHCA 1QKKA 2NT3A 4MS4B 5ED4A 3EAFA 1ZVVA 4F8DA 2JBAB 2JVJA 1DP4A 2JK1A 3L1PA 2O38A 5KC9A 1A04A 3HZIB 4IWRA 5BR1A 1D1QA 2ZWMA 5FWXA 4O8BA 4W5TA 1D4ZA 2RGYA 3RVOA 3ROFA 4JOQA 1UTXA 4RK0A 4Z99A 1DRJA 4ZYLA 1NXWA 4IILA 4RK6A 3DZDA 5C5EA 3RVKA 4Y42A 5FBHA 4ZMRA 1Z25A 3A0UA 4EYKA 2F8SA 9ABPA 3MLFA 1Z16A 4F3TA 4GQMA 5DGCA 5DKFA 4P98A 1ZY2A 2IYNA 2RJNA 4W5OA 4MLDA 2AW6A 3IDOA 2QVCA 1PHRA 1DC8A 3JY6A 3CNBA 1GCAA 1E2BA 1RPEL 2JVKA 2L49A 4RY0A 1UXDA 4G0OA 5HKOA 1DRKA 3JXCL 3GT7A 3KYIB 5BQ3A 4NICA 3EGCA 1DG9A 1BA2A 4PZ0A 3T95A 3EJWA 3VK0A 3CG4A 1TMYA 1R8JA 3F52A 1ZHHA 4D6XA 3QEMA 1U8TA 4X4FA 7ABPA 1A0OA 3ILYA 3QELA 4UHKA 3SCGA 1YK1A 4YP9A 3H5WA 3VNBA 2FMHA 3OLWA 3CROL 3W9SA 3LUCA 1POUA 3BDNA 3QX8A 3ZHMA 1BDJA 5CNKA 3IP5A 1NXPA 4YG4A 1U2PA 2ICPA 2A6CA 1YS7A 1YS6A 3EULA 3JTEA 4PE5B 5D2CA 4ZMSA 4N41A 1S8NA 1I3CA 3LUGA 3MA0A 3GBFA 3I42A 3QLVA 2X7XA 3IP7A 5TPWB 3HDGA 4XXHA 2PUAA 1QPZA 1DBWA 1RZSA 2MSLA 2R25B 4MQEA 4KRFA 3NHZA 5JS2A 2FQYA 4ML3A 5F64A 4Z58A 2KEJA 4RDCA 1PERL 1QMPA 3RVNA 2H3HA 3G5GA 1YMUA 4MQFA 2JRLA 4YARA 4KPYA 2LP4Y 3UK0A 2WMYA 1FFGA 1IIBA 5TQ2A 3FMVA 1DCMA 4N47A 1ZH4A 2FLKA 1Z18A 2FQWA 3VNAA 4KFCA 1ZZ9A 1JYFA 4L85A 3OLZA 4O5AA 1WIZA 3O21A 4EYOA 2AXUA 1RNLA 2D5VA 4QICA 2RDMA 2GRMA 3IVPA 3H75A 1UXCA 4GPAA 4MR9B 3KLOA 4KNYA 1DCFA 4KK3A 4HNRA 4YCSA 1WH8A 2LCVA 2VUHB 3KLNA 3BRSA 3DLBA 2QU7A 3H6HA 3QEKA 4KQ9A 2E4XA 2FLWA 1PRAA 1E6MA 3MM4A 1BDHA 2HSGA 1GLGA 3C6QA 3L6UA 3OMXA 2KEKA 3D8UA 3QX9A 2AUWA 5PNTA 5E3JA 5FWXB 3HVRA 3H5VA 3LUJA 4PYRA 3LUFA 2QXYA 4YS6A 3FFWA 4Q6WA 3BREA 3FDFA 1ZH2A 3LFTA 2EF8A 4Z9BA 3OM1A 2OQRA 2PUDA 4ETIA 1JX6A 1NXOA 3T38A 4PU7A 4YWHA 4D6YA 3QWGA 2FN8A 4Q7EA 2WWVD 1DWKA 2BGGA 2FMKA 3GV0A 2R48A 5IUNC 2VYCA 1K68A 1F51E 4MCTA 3LUDA 4H3KB 2FMIA 5EWJA 3F73A 4PU8A 2IOYA 2MYUA 4F11A 1KRXA 3E61A 2AXZA 3FYMA 1MIHA 4ETNA 3HEBA 2HQBA 3RZZA 4PU3C 4XAQA 5KC8A 3UUGA 1OXBB 2CHFA 2KPJA 2MYPA 3HV2A 4YG1A 2XIUA 2WJAA 3CG0A 4MS3A 3DNVB 1GUDA 3A3KA 1GUBA 3GWGA 3MMNA 3N0RA 1LQCA 3OMWA 1WH6A 3QEMB 2W42A 4EY3A 4I8TA 1FFSA 1KGSA 2IPAB 4RXUA 2LYKA 5EWMA 1QP0A 3FMYA 3QELB 2VK2A 5CHYA 6ABPA 3F6CA 4X4HA 3HM9A 2V0NA 2PMCA 4ETMA 5IEJA 1NEQA 3EDCA 3GL9A 3CFYA 1QO0D 4MYRA 1W9HA 3TO5A 4KK4A 4E7PA 5JNSA 3LISA 1TVMA 5CNJA 4X4CA 8ABPA 3SAJA 3M9WA 3SM9A 4LRQA 3B2NA 3KXAA 3K4HA 2AYZA 4OTZA 4EYGA 3H5TA 3KTOA 2JCGA 1XWRA 2FN9A 4MQEB 2H8RA 4KVFA 4RXMA 2GI4A 4TMYA 5TQ0A 1L1MA 1ZS4A 2TMYA 4XLTA 1OXKB 3RVRA 1H9CA 1CQTA 1ZN2A 2XDYA 2HQOA 1OSLA 2PPXA 1RZRD 2B4AA 3FGZA 5IEBA 3HZHA 4MR8A 2PAFA 1EFAA 1LJUA 4MQFB 4TLLB 3H1GA 4DADA 3T6KA 5TPZA 1R63A 4G0XA 4G86A 3G1WA 4EGSA 4KREA 3GYBA 3S99A 4MCXA 5TQ2B 1QO0A 4JA2A 4G0ZA 1LBHA 3OLXA 2IVGA 4XFKA 2FQXA 3JPYA 4MR7A 1D1PA 1YSEA 5EWLB 1LK0A 4Z4GA 1PEAA 1PRUA 2PKXA 1NERA 2ZAYA 4IMJB 5A7LA 1PNRA 3I45A 2R63A 4FE7A 4NDWA 1CJGA 4CBVA 3HK2A 1RZRA 2CWDA 2NZUG 3A0RB 3C3KA 3KKEA 3QLUC 3SG0A 1E6KA 2MYNA 3D02A 4RK5A 1S7EA 3LUKA 1ISSA 1BDIA 1ZZCA 2LYQA 3TRBA 2MSKA 2PUCA 3KG2A 1JYEA 3LUAA 3TX6A 1LBIA 2NT4A 2L19A 2FKAA 5K98B 3UFDA 1M5UA 2ID7A 3HCWA 1SXHA 1QNLA 3ILHA 1CEYA 3KSMA 4Z5HA 4WWHA 4LE2A 4I6RA 4IRXA 4B09A 2E4YA 1NXXA 1JDPA 3SNKA 2FXIA 2XSDC 4F06A 3IP6A 1NXVA 1ABFA 4RKRA 1P2FA 4X4DA 4RXTA 4N0PA 6CHYA 1HF0A 1FSPA 1VRVA 1W25A 1ZDMA 3CLCA 1GCGA 1XHEA 3CZ5A 3EQZA 1PUXA 4JP1A 2CROA 2OFYA 4RK7A 3RVQA 4YGXB 5EWJB 4G0QA 3FYAA 1YMVA 3OLYA 2CSFA 2R47A 1KMIY 4EVQA 1EAYA 1MAVA 3BD1A 5T7BA 3OLVA 3HO1A 1Y1LA 2PE5A 4JB0A 4F12A 2QVGA 3HS3A 1LMB3 3GBVA 5FWYA 4I6TA 4EVSA 4N03A 4MS3B 3QQ6A 1ISRA 1MB3A 3PXPA 3TMYA 2PUGA 4WT7A 1USKA 2IPMA 3BRQA 5IUKC 5GOTA 5IX8A 1SD5A 4Z59A 2FEWB 1LCDA 2P4UA 5EWMB 3BBLA 4Z4EA 1EWKA 5IULC 2BJCA 2LPMA 3M6MD 4Y9TA 2OR1L 2L17A 5JNUA 2GZUA 2QZJA 3JVDA 4JB2A 5DCLA 4YRZA 1BVHA 1PEYA 3JXBC 4MAAA 3IP9A 2GWRA 3C3MA 4XASA 4Z4FA 3KS9A 3LUHA 1D5WA 4YBAA 3N6VA 3CLKA 2O4AA 2LYLA 3F6PA 3IPAA 1M2FA 4RSMA 4OATA 4WUTA 3Q7TA 4MS1A 4RZSA 1SXGA 1JWLA 5TQ0B 3ROTA 3JXDL 1D2AA 1DCKA 1JFVA 1Z12A 1JL3A 3GA5A 3O2QB 1JF8A 4G0MA 2NUBA 2E4UA 3NHMA 4MR8B 1P8AA 4PEVA 4RS3A 3IPCA 1GT0C 3H5LA 3O1HB 4OLAA 3OQOA 1UDRA 1F4VA 2JB9A 4FB4A 4RK4A 2F8TA 1O4XA 2EWTA 3KCNA 1ZUGA 2IPLA 1AB6A 1JLKA 5BRJA 4Z9AA 4YLEA 2AXVA 2FSPA 3OM0A 4MR7B 5B3JC 3TD9A 1QQAA 4LZLA 2WY2D 3MYYA 3O74A 5HSGA 1DBPA 1YVUA 1HEYA 1Z26A 4IA8A 2QSJA 2IDMA 1B00A 3CU5A 2H0AA 3CZCA 1JFTA 2NZVG 4W5RA 4WXMA 1TJYA 1TLFA 5JNTA 1RIOA 1X57A 3N0XA 2A9OA 1E3OC 3LKVA 3CHYA 1L5ZA 3LFPA 4KZKA 4Z4HA 5TPWA 1JDNA 1KRWA 3S8QA 4LX8A 3SQNA 3Q9SA 5TPZD 1ZGZA 4JCXA 1CYEA 1ZZ8A 3N0WA 5GQSA 3G7DA 1LCCA 1C4WA 2B1JA 2PL1A 4QPJC 5IBQA 2FW0A 1VKRA 3O75A 3ZKCA 4G0PA 2HINA 3MQ4A 2M98A 3HUUA 4PICA 3CTPA 2KEIA 3OO0A 4N76A 4N0QA 1IC8A 2L2QA 3A10A 2WRZA 2FEPA 3BILA 1FFWA 3FFTA 4NQRA 2I6FA 3SCHA 4W5NA 1X2LA 2XCJA 1RXEA 1ZGGA 3QLTA 3Q15C 3O2SB 1R69A 1PNTA 2N9UA 2DRIA 3EUSA 5FWYB 5KQMA 3OP9A 3SCFA 1AU7A 2EBYA 2CHEA 1C0EA 4RV5A 2JVLA 1URPA 1NXTA 3NBMA 4H60A 2FJRA 1SRRA 4YO7A 2P9HA 5BRAA 4F8JA 3C3WA 4S04A 4G97A 2O49A 1DJMA 3OMTA 1VPWA 2JVIA 3CS3A 3EODA 3EQ2A 3F7NA 3UKJA 3HXMA 1YTUA 4Z5CA 2FEKA 2E4VA
chains in the Genus database with same CATH superfamily
4H4DA 1QRUA 1UWVA 1M9NA 1N2BA 3D0OA 4XM2A 1NJ5A 4UM8B 4LDNA 1K88A 2XTMA 1B2RA 3NNDA 5IK2D 3CEPB 2J7UA 4HX9A 3BMQB 4CM1A 2C4HA 2JHPA 4YONB 2OBNA 4II3A 3G3EA 2WU4A 1AK2A 3HTXA 5LD2B 1AM4D 1GFSA 4F3CA 4YR9A 1PDVA 4M6WA 4NWIA 4YG7B 9GPBA 3QXCA 1CUHA 4J0QA 3MCZA 3MWDA 4N65A 4XDYA 4MGEA 2W7TA 3VAAA 2QDXA 1OXMA 3GAMA 3ZBPA 4YQEA 2Z56A 1VE7A 4RJIA 3IHTA 3KZMA 2DSNA 2YNMD 4MUNA 2BE9A 5ARDA 3PXGA 5JISA 4PU0A 1P4SA 3HCPA 5ALLA 1ZITA 3WDKA 2FK8A 2X4IA 4N3BA 3L4JA 2ZI3A 2X4GA 4DREA 2BWJA 4OBBA 1T34A 3IPLA 2QHXA 2LXNA 4MVCA 3ZLBA 1ZIXA 4G8DA 2YXDA 1HY3A 1HC7A 3HR7A 3NS7A 4OQQA 3ZWAA 1R74A 2BI8A 3PTLA 1BMFA 3IUQA 3MTAA 1JG6A 1R9NA 1TQ4A 3RK1A 1UC4B 2GRAA 2Q9AA 2V6BA 3G49A 2Q4TA 1M0WA 1RC1A 1C1DA 1K0FA 3GFTA 3QLVC 4MTCA 1ZD9A 4MW0A 5THKA 4D41A 4MWGA 3Q88A 3RS9A 1ORTA 4U5XA 2DGDA 2H1HA 3T9FA 5K6AC 1XTKA 3M1IA 2DP4E 5IUJC 1CDZA 3OZCA 1X80A 2EF0A 4KYIB 3WB0A 4LMPA 2G1JA 2CJWB 1CHNA 1JAHA 1GARA 2OD7A 2HZ7A 3DH0A 1EJBA 1MCZA 2I3GA 2RK4A 4Z9FA 2QTGA 4Q37A 2VZ8A 3QYFA 2JLSA 2KSQA 5C35A 4RL4A 5GM2A 1XTSA 2WB4A 1M6VA 4CCYA 1YNOA 4JBWA 3CR3C 4RHYA 1V35A 4ZCMA 2XDQB 2JCSA 4DSAA 1K9VF 1PUIA 2XT0A 1T8YA 4B9AA 4X6LA 4YV7A 5JXHA 2BH2A 1HQYE 3G5TA 3PWSA 1V95A 1LVHA 1EH5A 1CYDA 3ICPA 3ZY4A 4UNRA 5KWVA 2VP6A 1LDMA 2OT3B 4FWTA 2WK1A 2LDXA 2GK3A 2XIQA 4NZOA 4RHEA 2ZR7A 4K46A 1LJLA 3NFYA 1MDFA 5FOSA 1T8SA 3G2QA 2E85A 5AI4A 5C7IO 5BYJA 4LZZA 2C4VA 3DZGA 2Z8YA 1DRVA 5HJ7A 2P2SA 4HRAA 3B89A 3OT4A 4PAWA 3ZVLA 2FP4B 2XZLA 4LRTB 1G6Q1 2J3HA 1MJNA 1YASA 4EDFA 4CL2A 4G1UC 4H15A 1CJUC 3SYRA 1R00A 4RH3A 1NMYA 3M6LA 3D7NA 1XTIA 3Q41A 2I3AA 1R0WA 2V6IA 4I50B 4MRNA 2OENG 5CM2Z 4HWOA 4XJXA 3MC1A 5AOBA 3UG7A 4C5CA 2P2GA 3HSYA 5EIAA 1CDDA 3QOYA 4NAVA 4IHJA 5M5BA 1QF9A 1EM8A 1N3YA 2GDJA 4GI3A 2F55A 2P62A 3SC4A 1GTJ1 1Z0IA 4M1QA 1PGNA 2AG6A 2G04A 3MVEA 1RYNA 1UBJS 2IS1A 4FBLA 4HWKA 3O0DA 5KNCH 1ICIA 4LCEA 1M73E 5B6JA 2C00A 1Q91A 2J3KA 2PO5A 4GPEA 1GGVA 3QQ5A 4D74A 1GNPA 2V3CC 4XGQA 2QY6A 3H2KA 3BIXA 4L2IA 4DY4A 2YXBA 2Q2WA 4BTEA 1JHXA 1GGJA 1P2DA 4HWGA 1ZINA 4ENSA 5JO0A 1KIFA 2VTEA 1ZXBA 4Q00A 5CLJA 4G0UA 3NGXA 3PZBA 5DTJA 4CTOA 1E3WA 1K6MA 2OD9A 1SOAA 3FVQA 3QK7A 2E4ZA 3OO1A 3CVOA 3PVZA 2PKYX 1OHHA 3FM9A 4H1VA 4IJ5A 1J33A 4JA0A 4W7SA 2CLOB 3PR1A 3G5UA 4F4UA 8MHTA 1QUFA 4B48A 1POWA 1CQJA 1O1YA 4X6YA 4M0MA 3REGA 3UHJA 1RKXA 1RM4A 2NXJA 2WAOA 3FHTA 3IXLA 4EHJA 3WRXA 3RHSA 2AOUA 1FNSA 1RYFA 3UBMA 1UIMA 3HZIB 1BRMA 1G3UA 1JXAA 5KREA 2PRJA 4M46A 4KJXA 3P2YA 3RVOA 4D4KA 1RYHA 3UNXA 4DG5A 4YMUA 3P2IA 1VDZA 4WINA 2QSUA 4RK6A 3PDHA 4J7CA 4JCOA 1XPJA 1JHUA 1KVUA 1LU9A 3T3HA 1UDBA 3HDTA 4PXSA 3WDSA 9ABPA 2QL7A 4MVJG 1ML4A 3O3CA 3U31A 1VIAA 1C30A 3AY3A 3O4RA 3F5MA 4AO6A 4ZAFA 3VZCA 1GD1O 3DOUA 4BPRA 4IZ6A 1B6GA 3RKRA 2VTBB 3EVCA 5KJEA 1R6AA 2O2EA 5A6SA 2BUBA 3OQJA 4G84A 2Z3WA 2L49A 3S1SA 4I3HA 1PG2A 4HATA 4HDCA 4QQRA 5ECGC 1OZGA 1E2DA 1QHIA 3PF9A 3T95A 4QXOA 3R3ZA 1VPLA 2XCQA 1EVQA 3GK3A 1SVOA 4WKPA 721PA 1AURA 2C94A 5A1JA 2B2XA 4XQCA 4UUPA 1ODIA 3VBEA 1A0OA 4A2WA 4D9FA 1L4NA 2YZNA 4RV4A 4UVGA 4G89A 1A4IA 2I8CA 1B74A 1KJWA 2RH8A 3IELA 3RG2A 1POUA 1CRWG 4YCMA 4UHDA 1GY8A 2D1TA 4XWWA 2J9YB 3U7QA 2WFLA 2HMSA 5E9WA 2HV9A 2EBUA 3FX2A 4ETNA 3I34X 3QXJA 4P93A 3I42A 4FUQA 3ZTYA 1JBKA 4DCGA 4J90A 1G5HA 1WUIS 1TF5A 3PGJA 1RZSA 2E4AA 1TRKA 2V7UA 4MQEA 2PV0A 1TYAE 3I0NA 1Y1QA 2HDNB 3VMFA 3B51X 1P5ZB 2PL5A 1R0XA 3PQ6A 4DDHA 1TQ6A 2A1UA 2BJWA 1QZ3A 4QXMA 4TYPA 4MYSA 2C5SA 1BJTA 4PRLA 1R5BA 2XTZA 1Y4ZA 2XMPA 4XLLA 4ES6A 2VHXA 3DMRA 2Q8QA 3CY6A 2XWPA 3ZLUA 2ZXUA 1VG9B 1ZH4A 1A9RA 3CRQA 1SCJA 1C8VB 1Z47A 4TVOA 4WBNF 3RTBA 4M9RA 2ZS9A 3GLVA 5E1MA 4DLWA 3QW2A 4M4SA 1WJGA 2B69A 3HR4A 3CZPA 4R1NA 3PDUA 3C5HA 1F6DA 4UOQA 3GJ6A 2HBZA 4LJ4A 2FG5A 3K09C 3HVJA 1ZK2A 2C5HA 3DUWA 1MG0A 2JCYA 1S1MA 2AJDA 3TMKA 5F12A 5IKMA 3H05A 3ZOZA 1PLJA 1GGEA 3OESA 1RKQA 4KQIA 4OJTA 1DS6A 4EDHA 2M9MA 5BYKA 5JRDS 3H5VA 3QHPA 4ERNA 2VEOA 2FNAA 2Y2VA 3MMXA 2F8LA 2JFGA 3A70A 3QU7A 4L51A 2VDVE 2H00A 3IH5A 4H18A 5HA5A 3V4VB 2DAPA 4PG8A 5HXAA 1BGWA 2WJHA 2BMWA 1WHSB 1MXHA 3LH5A 2ZRIA 3LT0A 3OICA 2WM9B 3QWAA 1FMTA 4FGWA 3CO0S 4OSOA 2WWVD 3R5HA 2G25A 3PG5A 4BMDA 4IY1A 5AIBA 1K68A 5CLFA 2ZSIA 3V4OA 1FU8A 2QX6A 1YOBA 5KYVA 1FVOA 4QFMA 4FP9A 4OJYA 2JFFA 1AGXA 4DA8A 1SEVA 2J85A 4DPMA 4QPZA 5AM0A 4BNFA 1KK1A 1KWKA 1GNRA 1UXKA 5KC8A 1U0FA 3A8TA 3W3AA 2GM9A 5CHEA 4MS3A 2OC4A 1TYBE 1Z6GA 5A05A 2C2OA 3BTVA 2N47A 1XVLA 3I64A 1VE5A 3IVMA 3LT5A 1LBEA 2CUTA 4FN5A 4HAVA 4JUBA 3RSLA 5EWMA 1U94A 2Z1NA 5EJ4A 3E48A 3UCXA 2WSMA 5JBQA 1EK0A 2VK2A 5EQJB 3WMRA 3WY9A 3R40A 2Q8PA 4C4XA 4EB6B 3FKJA 4XX0A 1ZGCA 1ZXXA 3ESDA 3R7FA 3IEVA 4RVUA 4BNXA 1DTEA 1W5TA 2ODTX 3EGEA 3EH2A 3FB1A 3IUNA 3TO5A 5JNSA 1XD8A 1ULHA 2A7XA 3QPUA 4KLAA 4L6CA 4C0WA 3SM9A 2KHZA 4EUFA 5BW8A 2AYZA 1I51A 2QSYA 2X15A 5JS8A 1UMDA 2HCTA 2JCGA 4Q1VA 4XIIA 3DEZA 3Q8MA 4C6RA 3RVRA 1L1MA 3PIRA 3EYWA 1EQAA 3OURA 1WDTA 4Q4JA 4EHLA 1RZRD 1GAXA 2F1RA 1CU1A 3AF4A 5B4TA 4QUAA 4DUYB 4ER7A 5DRYA 2UVDA 4H9GA 2F2TA 4M7OA 5E8RA 3E9EA 5F21A 2FEAA 4XEHA 5G4LA 3RSFA 4PZ9A 2C61A 1QO0A 4I5IA 1A9ZA 3OE7D 2E82A 1D0SA 3JQBA 3PQ7A 2XWSA 3SX4A 4A0GA 4CM8B 2J41A 3LLVA 2BKXA 3W6PA 1XV5A 4CMGA 4QO8A 3BORA 3UC9A 1CRQA 3AZPA 2OPHA 4KR9A 5YASA 3OJXA 3KE8A 4OHKA 4U7GA 3DONA 5JBIA 2PCLA 3GLUA 4FNOA 2REQA 4JC0A 3FPFA 4R1QA 3COJA 5IVKA 4OUDA 2EP8A 4JL5A 4B6JA 3DSRA 6Q21A 3Q3GE 4DC0A 1YACA 4L8VA 1CUWA 3L0ZA 3B6JA 5EJEA 2NT4A 3HCWA 2BP7A 1SEPA 4UNNA 3AJAA 1X39A 4AZTA 3KT6A 3FDJA 1A9SA 3JYPA 1JDPA 2R7AA 2C7OA 2ZI6A 2FXIA 2HPVA 1UK9A 1E89A 5MFPA 4C3UA 1N3IA 3TSWA 1J90A 1P2FA 1QYRA 2Z1MA 3KAPA 4LSGA 5FUWA 3V1MA 3VZPA 5C8ZA 5J3JA 3LZ6A 4QBGB 4RK7A 3KQQA 4A2PA 4EPVA 5CVJA 1RQ2A 1H8ED 1ZI8A 2CYCA 2B8WA 4BB5A 1ORDA 4UBKA 3WWYA 4CXMA 4W7IA 3ZXIA 1DKOA 2O07A 5FL7D 3GH1A 4QOJA 4NL4H 4RJ2A 4HNAB 1OD6A 2VZ9A 4A26A 5AM4A 5FV7A 3BQMB 1UUFA 1VXOA 3CQ9A 3ZI4A 4XDGA 1B73A 3DE4X 3DBHB 3QQ6A 1MB3A 5T4EA 3LA6A 2I2AA 5ENDA 2A9FA 3HZRA 3R7LA 3BRQA 5KTKA 3UOAB 3EBPA 4KKXB 2X9VA 2H4WA 3BBLA 3D64A 3OPYA 4YRTA 1R15A 4B7ZA 5IULC 2LPMA 1BGXT 2PXXA 3QLEA 5CM8B 2UVPB 4X84A 4IUBS 1SGWA 3RJ9A 3ZCUA 2GNOA 5DX0A 4EHIA 2EATA 5AVXA 4B6FA 3OUUA 3HYSA 2PX5A 2B36A 2X2OA 2YWGA 1RQGA 3KS9A 1LPSA 1TCAA 3PGMA 3PVSA 4KTVE 3UENA 4TKVA 1UJCA 4LWPA 3ER6A 3CLTC 4L8GA 1ISGA 3TECE 4EW3A 2PS0A 2W2XA 3FSGD 4NI5A 5U4XA 3ZDQA 4UOEA 2QV7A 2MDTA 3IBCA 4WUVA 2ETVA 4O4HA 2AJLI 5CH8A 1DBVO 1I1OA 4A8JA 4EG8A 1TIPA 1FPMA 4OK6A 4KR7A 2O5EA 1UCFA 4PEVA 3NDRA 3WJAA 3BFVA 3D6VA 4F85A 5ED0A 4QXQA 2QMHA 2DT5A 1U7HA 1U9JA 4HXYA 4ZVRA 1UJ6A 3C87A 4RK4A 5LLTA 5CURA 4H31A 3V7NA 1BXRB 1AQLA 1Z4KA 5TIIA 4F92B 4Y2VA 3F97A 3VSAA 3GD7A 5HEKA 1QRTA 4LHWA 5H9WA 4L9RA 4RVCA 5DNUA 2Q6KA 4OLFA 3WOHA 3DO6A 2XF8A 4JBIA 1HFEL 2D0OB 4GLFA 4BKUA 4UMEA 1SBYA 2P9TA 3CRW1 3A1NA 3FMPB 3I9KA 2JGIA 4MW4A 3W3ZB 5K03A 4P34A 2HYDA 1SB8A 3EA0A 4C7OA 4UUQA 2P77A 2XNCA 2C2YA 4HHEA 4HF7A 2ATIA 5JNTA 1OFVA 3EXIA 4BLTA 1QRAA 2ZWIA 1IY0A 1IN5A 1PK8A 1JLLB 3QU4A 1QHEA 3HDHA 3RU2A 3I0MA 4NCKA 3OBBA 4QBIA 3OQ6A 4JCXA 1ULZA 4YP7A 1PS9A 4WKGA 3GLHA 3KKMA 3WAGA 3UMRA 2C7VA 4QPJC 5LOVB 1CT9A 2FW0A 2QUZA 3R7SA 1CJVC 2GRJA 1ZN8A 2O2JA 4L0MA 3GZNA 3BWBA 5D3ZA 1PL0A 4D8WA 3KWJA 1KFJB 2AK3A 1YKSA 3NO4A 3AUFA 1T9BA 4ALJA 4ALKA 4L8LA 1K8XB 1O6ZA 3QVJA 4W8OA 2IH4A 3D7KA 2X0EA 4J43A 1RQ7A 2B0JA 4JBHA 4Z51A 5AUNB 2VRBA 4OAQA 5KTPA 1NULA 3F8SA 1Z5PA 3QEOA 1WXXA 2HN9A 4IQ8A 4BVJA 4JC5A 1V1JA 1O97D 1XIVA 2PS1A 1NXQA 3B3QA 3EXEA 3H3FA 5FPPA 2CHEA 4LX0A 5CA0B 2H9AA 3ITEA 3L2OB 2PVPA 2JVLA 2ENUA 2GN1A 3ANYB 1M6YA 3FB4A 1Z3CA 2RI1A 3H1AA 3M3HA 3RFCA 3ZVRA 1GU7A 1N9KA 4R2HA 5AJZA 4QOIA 1JRLA 3C6MA 3ND7A 2NQ2C 4P2GA 4S0XA 1LNZA 4LHVA 2BW0A 4UJ3A 3IUYA 2X3YA 4O4IB 1FU7A 2D4HA 3G8BA 4H7IA 1U28A 3RRXA 1FP1D 1AN0A 3GRUA 5B1HA 1JTEA 3GNLA 2XGGA 2VLBA 4JLBA 4KE6A 4XYGA 4RLQA 3BB3A 4EYQA 4R3WA 3L43A 2GPWA 1E9AA 3L8CA 4TKUA 5I7EA 3G9TA 1COWA 4LEIA 4F9FA 3K0HA 5DYIA 3PP8A 1OIVA 1ZFNA 2A1IA 1KXZA 1XZNA 2QX8A 2UYOA 3ZI0A 5D6NA 3L7YA 3F1LA 4DXHA 1DI0A 4EMTA 2H9IA 1DJOA 1M1NA 1P1FA 2R65A 1WF6A 2QGFA 5EFOA 1R12A 1NVGA 3OZGA 3JQCA 1B76A 1P74A 4Q9AA 3UCFA 5EJIA 2WQZA 4C1NA 2BVNA 1KQFA 3LZDA 1IG0A 1J0AA 2AN5A 4BV3A 3GFGA 5KNBD 1A8PA 4BZXA 1JQJC 1WXIA 2FSVC 4XIYA 4CQLB 5CA1A 5D85A 6AT1A 1GJRA 1UWCA 2BGTA 2VAPA 4HNSA 3ZKWA 4H27A 4DDTA 1BEUB 4DR5B 3ABOB 3DOEA 3DZCA 4YJDA 4LC0A 4O3MA 5AW6A 1KXJA 1CF9A 2OCXA 3ANMA 1JKJA 1G21B 3PNOA 4IDFA 4J1SA 1YGYA 5GONA 3U4QA 3PITA 1VHLA 3K0SA 1P6UA 4IAOA 5FAXA 3CRMA 4AXBA 3CKMA 3P32A 3R75A 4FFSA 4EA8A 4G8BA 2JAWA 3FGNA 3JQ6A 3LT4A 4EKEA 5LDDC 4FHEA 4R8VA 5G53C 2ZRBA 1O5TA 5ESWA 1OXVA 3O2NA 3VKGA 1YV9A 4L4UA 1G38A 2WMDA 3IEKA 4G36A 2DETA 3MMZA 4PO9A 3TKLA 5DM70 1WMDA 4L0CA 2MSCB 3OZ7A 3BE6A 4EUKA 3FWKA 4O2AB 2P11A 3RFFA 2XXPA 3BMCA 4G5QA 3KVVA 4K9MA 2RGNC 2D5IA 3IMEA 4CIYA 3K5HA 1EUQA 3PJGA 1SC3A 1X7XB 1OFTA 5JQGA 3I5XA 2VBCA 1A7AA 1QO7A 1CV2A 2VHQA 2XQVA 3EEBA 4US1R 3ZCVA 3NNNA 4DNOA 4LE1A 2CMHA 4DQDA 5DSXA 1PCXA 2VQ6A 1GNSA 1L5VA 2ORVA 1FFAA 1TUIA 2QNIA 3L04A 3EWSA 2I4TA 3KALA 5KJFA 2D5LA 1I4TD 2GAJA 5AI0A 1J56A 2ZB7A 3KQYA 2Q6LA 1ZOSA 5AKGA 5KDLA 1TK9A 4PGAA 5NULA 4GWLA 3CLUD 1L5HA 3BGVA 3CX4A 4DRZA 4Q02A 4M9UA 2QPOA 7MDHA 5L4LA 4MB6A 3A9TA 1YUNA 3AIOA 2C2HA 3ZHRA 3QFCA 3A6JA 4R3NA 1ZBQA 3D3JA 1X1AA 1EVLA 2A8YA 4I5GA 2BM9A 3V8BA 5T3YA 3A9CA 3WXBA 5KDOA 2PXUA 4TRNA 2OO5A 4FMCB 3S5UA 3P9YA 3SZRA 3J81A 2O8EB 3BKXA 2PXBA 4P38A 2WIDA 3R0XA 4ZOLF 3SYTA 1G6HA 2HXGA 3GRCA 3O0TA 3HDJA 1XD2A 3CGGA 4L5BA 5EPUA 3H42B 5C5CA 1WIWA 5M29A 2IODA 4KQCA 4XWAA 3BQNB 5SYAA 2RB5A 4GOMD 3EVZA 3TFOA 4ZYZA 1XJQA 3VHQA 3B1ZA 5FUMA 3D5QA 2HCRA 4BFLA 4UTZA 3AU8A 3N58A 4TUYB 4JUCA 5A02A 2BEUA 5KKNB 3B8EA 3G02A 4R54A 4MIOA 1CY0A 5ARBA 1FU4A 3DOJA 1G66A 2ESRA 1GSAA 4FT4A 4Y7CA 5AKEA 5DNCA 3MTDA 2JZOA 4ARCA 2ODWA 5JJBA 1ZL0A 3FHOA 3O1JC 1TZCA 1EDDA 4KIFA 4U2FA 1DO2A 4RTRA 1JBEA 1KFBB 2R7LA 1ISHA 5COQA 4B7AA 2O2XA 2CDRA 5A5DA 1E2LA 4Q1CA 2OVFA 4LDZA 4ZVLA 1RMTA 4TYWA 2H31A 3GG2A 3DAHA 3CNQS 3M9XA 4GIBA 2FK7A 1TT5B 4XIGS 1KOJA 3CCFA 3ZKAA 1XVUA 1R6UA 4TGLA 2Y67A 4MWSA 2QYHA 2Z8YM 2PRZA 2OBMA 3FJ1A 4N5NA 4TXJA 1DP4A 5GIPE 2LWIA 3Q7EA 5HVNA 4OY3A 1ZU4A 2WVGA 1M2GA 1GAJA 3EAQA 3K2IA 4W5TA 3PD0A 1KAGA 2IA5A 3EIQA 4D9CA 1T2AA 3TLGB 2DJIA 4QAQA 1XALA 4IBOA 2UYCA 1AKTA 1O77A 3EGWA 3DZDA 2XT9A 1SD1A 2AFIE 2P1DA 4HS4A 1AUQA 2O1SA 4BFWA 4M99A 4EYKA 3PV0A 4PG4A 2I4RA 2P1ZA 1CUYA 4HQFA 4A6PA 3CVVA 2LRHA 1EFRD 2DVMA 3WIOA 5E8JA 5EIHA 4JBYA 3U7RA 3AXTA 4XYBA 1MPTA 1Q84A 1VE6A 1EDEA 4OYYA 3IB3A 1MO5A 2PS9A 3AESA 4M36A 4RY0A 2B25A 5HKOA 2VXOA 1DLJA 3JXCL 4H7EA 1LRLA 1G8MA 1JHVA 2AVNA 1BA2A 5TMPA 2PZKA 1N2SA 3ED1A 4CIXA 1TMYA 1R27A 4V1CI 1ZHHA 4KGVA 2GPBA 3USZA 3JZIA 4PGHA 1B93A 3NI2A 2PPLA 3WIVA 2BH9A 5HDBB 1GV0A 2QRQA 2XE4A 3CLRC 2X0DA 2IEBA 3RUCA 3S70A 4GP6A 4URVR 1LDEA 3ZHMA 3JZMA 1SA0B 3G0GA 1II8B 2P9GA 3IP5A 1U2PA 2EKZA 3AG6A 4PE5B 1CZRA 4N12A 2ZR9A 3I1FA 4IUYA 2ZJ2A 2JCXA 3GBFA 1MKYA 1X7ZB 3WLOA 1BO6A 2OXFA 2H7CA 2TRSB 4FOPA 4L8YA 4EUHA 4HAOA 1DHRA 4CF3A 4IF6A 4D92A 1RRCA 1XNHA 3UK1A 1II9A 3NYRA 4O2BF 1T5BA 4WXHA 1UPAA 1HQ1A 2O2GA 2EZ4A 3JQ9A 4L3WA 4TKZA 4BX2A 2ZJZA 4MQFA 1GGHA 3K0CA 2ORWA 3OKZA 1NN0A 4IVPA 4YJFA 2WINI 1EX7A 3MBKA 3LDHA 3LIIA 1UJNA 4TOIA 1ZUHA 3R6GA 2EIXA 2P7HA 4OYLA 2QI9F 2JANA 1TQHA 1CUGA 4IV0A 4C1BA 2OK7A 3GJYA 2ETXA 3IALA 5BW6B 1OH6A 4MPPA 4Q9KA 1U8FO 4ZAVA 1QP8A 1H6DA 4FYXA 3ZE7A 4A10A 4D42A 4EYOA 1KEKA 1Q6ZA 4YT5A 3VWSA 1C4OA 2RDMA 4EQ6B 2QEQA 4OMCA 2C9OA 3TPZA 3KP1A 1R8SA 4X64B 4KNYA 2WJZB 1ZW1A 4OA5A 5LR6A 1KMHA 4XCQA 2G9ZA 3PLAE 2QTVB 3QEKA 1E7SA 2JJQA 1E6MA 2FFQA 2XV1A 4G2NA 4B81A 4Z8YA 2GD0A 2GRUA 1ZNQO 3D54D 1CXZA 3RIHA 1QH1A 2C5FA 2JFNA 2PD3A 3GJXC 5IG2A 1ISPA 1AS2A 3VDQA 1B0UA 4ARVA 1YVDA 5EJ9A 1Z28A 4E07A 1L8XA 1ITZA 4YS6A 4LW8A 1OZHA 3GNSA 4LAFA 3KR1A 4MV4A 2DR0A 2YFKA 4RDXA 2JFBA 5ITWA 1N9GA 4E32A 1JE1A 4RFVA 2VQ3A 1E2IA 2CXQA 3OM1A 4I66A 4E2YA 5DN9A 1PQWA 4YRKA 1FSZA 1NXOA 1PDOA 2LVBA 2VBGA 4MYCA 1JDJA 4CTKA 4OLHA 4AU1A 1KMNA 4BRSA 5LUAA 3SC2A 3UT0A 5F7OA 2DY0A 3ONVA 2JH8A 1BU5A 2AC7A 4H3KB 5LDGA 2HMYB 5JOQA 1JUDA 3EF3A 4KAAA 4C7KA 1UBMS 4F11A 3GVIA 4EJSC 2RGEA 2VQDA 4Q1EA 3PR2B 2QRJA 3GPIA 3TVYA 4YAGA 5LWHA 5J5AA 4Y0VA 5JVDB 3VX4A 5I8PA 1NR1A 1XKXA 5DEIA 3REQA 1VPEA 1M3SA 4RJJA 1GUBA 1FTSA 4X24A 3K2QA 4QT0A 2Z3VA 1W4LA 4W4TA 4YPOA 1MQ8B 3AHCA 1IVSA 4Z7NB 2WB2A 3FMYA 3HN2A 4GE3A 4NMLA 3K9FC 3RVBA 2UUPA 1KVTA 3EDCA 3L05A 1D8AA 3A2LA 4CE6A 1NVEA 4KTTE 4AJJA 4NYJR 2O2YA 5KTNA 1XTZA 2BTEA 4HVAA 3MAJA 3QFTA 1C3OA 1EIZA 4LRQA 5LMUB 2I33A 4LBVA 5IARA 3QVGA 5FEMA 3GT4A 4V0KA 1L4KA 1ZSVA 3FMIA 4XIFA 4ZQFA 3WLAA 4F46A 4AKIA 1NQAO 2SHKA 3D3KA 1NE2A 2PPXA 2VNSA 1TU4A 2ZRHA 3FGZA 5SYMA 2C04A 2CUZA 1D0VA 2PD4A 1J9ZA 3ENQA 2H92A 2J3MA 3VDXA 4B2IA 2AN3A 4S1TA 1M6WA 4G1FA 1IMJA 1R63A 4G86A 2PXQA 5C7LO 3OCJA 4R51A 3PX3A 4WNYA 2WKPA 3A31A 3DDSA 1I2ZA 1VBNA 4JA2A 5AI8A 2YOFA 4EW2A 5LKRA 3EZ9A 1RM0A 2WIGA 1HNWB 3IR5A 4LOKA 4ND6A 3UHAA 4B75A 4NDZA 1GP2A 4M1TA 3AR2A 4XIJA 2WAXA 3ZHOA 2D6FA 2Q28A 2ODEA 1XCBA 5K3CA 2L69A 3I45A 1P8JA 4CBVA 5L3SB 3H9QA 2OORC 2VF5X 1YJQA 1BS1A 1S7GA 1BCSB 1R66A 2BL4A 2CJYA 4TVSA 3LCUA 2D1RA 4IZHA 4HFRA 1ZUNA 5T4HA 1QGYA 2QKYA 2A78A 4IMPA 2L1PA 3UMYA 2NVWA 3SLGA 1PJQA 3H2IA 2GEBA 5K0BA 1XP8A 1S2IA 2ATVA 1OTYA 2A30A 4XQ0A 2R00C 1JJFA 3M4JA 3G89A 5FI3A 5JECA 3UYKA 4GBGA 4EL5A 1RCTE 1N0HA 2Y1DA 2PK3A 3OE1A 3SNKA 4LFBB 1T5HX 5CITA 3ME5A 4RXTA 4BX9A 1RWPA 1P73A 1XWIA 1V47A 2BEVA 2FGJA 4UKDA 3I5UA 5A2GA 1N78A 4HI0E 1FSPA 3Q6MA 5AD1A 4WXYB 3TQFA 1PUXA 1UMBB 4XFJA 2OA0A 3THXA 1XRLA 3E2MA 2J0UB 3KSBC 3IBSA 3LQKA 1XNGA 2XCIA 4KMOA 4X5OA 2B8JA 3ZJ5A 3ZCTA 1EAYA 1H66A 4OB7A 3A6PC 5T7BA 4QWWA 3HRIA 3JCZA 1DJPA 5B3LA 5IAGA 4DEYA 2J5XA 3JTMA 2EGHA 1KA9H 3I3SR 3ROMA 3ZE2B 3VH3A 5TSDA 1U8AA 3WDLA 4WT7A 1LUAA 3FCAA 2VSNA 3W1WA 2I2WA 1JGTA 3OCVA 4RACA 4WZBB 4HZUB 5B64A 4DV0B 4P3NA 1N0IA 3N87A 4LJ8A 2PO7A 2QZJA 4HXEB 2AA3A 2QR2A 4AO7A 4N8EA 3NPMA 1U8EA 1YE8A 2DTEA 5BN4B 3F46A 3COPA 3F8WA 1B8OA 3RJTA 1N5KA 3AUTA 4PFSA 5LYJA 4C21A 5D3KA 2NIPA 4EGQA 2EJTA 1BX3A 3RYHA 2CLIB 3GFFA 5G4KB 2AFHE 3Q7TA 4P5PA 3B5JA 1JLHA 4IZIA 4RW0A 4CR8A 1GZ6A 1EAMA 4HRXA 1V16A 1THTA 1WRBA 2R62A 3W5IA 2RKWA 5CYPA 4ZO8A 1UMKA 2XZTA 4PC3A 2DEUA 3O1HB 3ZK9A 2I2XB 3K9GA 5D51S 5LP6A 3WX0A 2A1TS 4LYGA 2ZB3A 3NVAA 4QBKA 1LJ8A 3LHDA 2QX7A 4PPGA 5DW0A 5FFNA 3SHTA 3SJBA 1VG8A 2PUJA 4BX0A 4PAGA 4YMLA 4J2TA 4OFBA 3KL2A 4M8SA 2ISSD 3QLJA 1QHFA 2O7QA 4WY8A 2WWGA 4LZLA 1PO7A 4PGGA 4F84A 3HO8A 4US0R 1H1LB 5E6RA 3D6JA 2KPOA 5H83A 1GO2A 1XDDA 3TJRA 1Z5ZA 1EE9A 1L7XA 1JHDA 1L4BA 4LXYA 4ND3A 3GPLA 1AMUA 3TD6A 1I4DD 4RY2A 4AJLA 3ESBA 1P0CA 2JLBA 3H6KA 3KE9A 3U7HB 3CHYA 3L46A 3E1GA 4BVKA 4LGCA 1VKHA 2WUVA 2EAUA 4D98A 3B1YA 1KJZA 2UZ1B 1RXSA 2OAP1 2G5CA 2FKNA 3F2IA 3MGGA 2H1FA 3RFXA 4KQFA 3N0WA 2OZPA 4YT2A 5LIRA 1W34A 4KDEA 1DJNA 1RWQA 4NYJQ 1J4AA 3JD3A 2HIHA 4DMMA 1E77A 4KRGA 2XHZA 3LPDA 3ASUA 1OXXK 1NOKA 1N3LA 5FPKA 1B6SA 4GPTA 3QPWA 4FXOA 5LQCA 3IOBA 1QHGA 4N0QA 4IGEA 2HWXA 2G28A 2FPGA 2P75A 4N9QA 4OKSA 3WK9A 5J4KA 3WBKA 1DC5A 1FXWF 1SU8A 2PRIA 4A1FA 4FYYA 2R6HA 2ZSUA 1H94A 2XCJA 2EKLA 5LXTB 1EM6A 3QLTA 3LQXA 3ENZA 4FYKA 3W5SA 3P0FA 1J8DA 1AKYA 3FR8A 3PWKA 5H1YA 1K8ZB 4L0DA 1QBKC 4HEJA 4ZYVA 3WMEA 1PFWA 1P45A 2H2DA 3LL4A 3HKCB 3IDFA 5HFNA 1ZD5A 5AW5A 3E7WA 3IIKA 3INGA 3AY7A 4LJ6A 4ZC8A 1E2FA 2Z83A 4RZUA 3GN1A 4MLZA 1FX0A 4JUIA 5K09A 2O06A 1T26A 3BFJA 3R9XB 2FEKA 3B52X 1BE1A 2B5WA 4PSAA 4PX2A 2ISCA 3KKQA 2P7IA 4ZAXA 4DNPA 2AR7A 2XYVA 3HYRA 2GEUA 3IX7A 4K9LA 2CSXA 3RF7A 1C9YA 1W96A 1EVEA 2GVNA 4DF3A 2I7XA 3IQXA 3V46A 4BLPA 5IWAB 1Z34A 1QO9A 2W4QA 3BKWA 1AKUA 2QL5A 4TSKA 3EFOA 4AIRA 2FCRA 3EGXB 2RHRA 3CNHA 4TV9B 9ATCA 2NP7A 1RKUA 2ADMA 4FR0A 1EB9A 3K96A 4X7MA 2QE6A 2CMDA 2EDAA 1LFAA 4XB1A 1KBQA 4LJLA 4HO1X 2R6CA 4PQGA 3G7SA 4BNNA 4OQMA 1ILEA 3AERB 3BRWA 2IC5A 2N75A 1GT91 4U02A 1P44A 1C7FA 2Q2QA 3D6AA 3ZWDA 2HF8A 4GM0A 1GFWA 3H5IA 1IUKA 2NXWA 4KIJA 2F3QA 1EWVA 3AVYA 3BS3A 3QVKA 2JAPA 2JGLA 2LE0A 1E0SA 1GSIA 2OGWA 3L6EA 2GXAA 1PP4A 2FMFA 2JAOA 2YV4A 5CFQA 3LBAA 3DCNA 2AFIA 2O50A 5BWNA 3F98A 1L3BA 1K6IA 1VPVA 3JXEA 3KZNA 1N5RA 1PT5A 1PVDA 2HMUA 3N8NA 3NWJA 4QOHA 3V3KA 3S0JA 1TRHA 4F7WA 3HJFA 3BSFA 4YR7A 1QTRA 3HUDA 1UH5A 3FFAA 1Y5LA 3O6VA 1KKUA 2G7MC 3L4KA 3AIMA 2HK8A 1WS6A 4L8WB 4EEZA 2VTVA 3S81A 2V54A 2FETA 1TJ5A 4GX2A 2ZRJA 4E5YA 1KYYA 4TWJA 2GETA 3B13B 3P8ZA 4IDQA 5JCOC 5CLLA 4ZU1X 1LPAB 3JYHA 4OUKX 5IC5A 3AVPA 3VR4D 3PEEA 3VR6H 4BMPB 1QIGA 4ZAGA 3DJYA 1J2EA 2DUWA 1OVGA 1UOEA 2FR8A 3ACBA 5IUKC 5JV5A 3SQXA 2ZTVA 4ZTBA 2E7ZA 4M9CA 2P27A 4J4BA 4XD7A 1U7PA 5U1PA 8GPBA 4BGIA 1J5EB 3NOXA 1VKNA 3MLBA 3PNPA 1B16A 3MMPA 1VLVA 2ODAA 4WOCA 5T5QA 1H2FA 1W52X 1NDUA 2IIPA 4R8SA 3RUHA 5EN4A 1UOPA 3QA3E 2VDWA 3MTBA 4G1BA 1AQNA 1EVJA 3IAFA 4QDXA 3FRIA 4F9EA 3EXAA 3EZYA 4C05A 1AB5A 2HA5A 3LXUX 3PGA1 5AJUA 3ZZNA 4NATA 4L4SA 4X4GA 2F4NA 4R2XA 3VC3A 3DTVD 3ZGXA 4AUEA 3ROZA 4FBGA 2P6MA 2RAFA 2HK7A 3E7XA 2GF0A 3LPAA 3Q7RA 3P71T 3GZ4A 3E9NA 4IH1A 4F0JA 2NU9B 2B6NA 5KQGA 2B1RA 1K06A 1W88A 2F3PA 4RF3A 5A7HA 3VDMA 1SXJE 2O1WA 3TE7A 3CEMA 3R6DA 4MW6A 4EYSA 1OH8A 3ZGVA 4MW7A 1L7RA 1XDGA 2MR6A 2HPZA 3ELDA 4A16A 3I58A 2VQEB 3ZJUA 2IZOA 2PJRA 1CQZA 1MIOB 1ZSYA 3K9LA 3LOPA 1K8QA 4G4IA 3DDUA 4GYYA 1Z0AA 1E1MA 2M1ZA 2ZRMA 1K3FA 3OWOA 4DSZA 4QEKA 3S29A 3ZNPA 1P0PA 3CN9A 3S7TA 4OXIA 5CK4A 3QUTA 1RFGE 2VN8A 3KJHA 3E70C 4LRWA 1KO8A 2PRSA 2JI9A 2F17A 2WVAA 5DI9A 3PF8A 2LUOA 5G1PA 3ZGYA 2Y27A 1E66A 3HU2A 1Y5IA 4Q4HA 4BNVA 5SZJA 1USGA 3U1VA 5TDHA 4B3IA 1NGSA 1QDLB 4KN6A 1I7LA 4UAVA 3R7AA 2R1ZA 1DX4A 3KJQA 3FYUC 4FIZA 3VTFA 2B5AA 2JW5A 1VHJA 1UODA 4WLUA 4K6KA 4D96A 3WNQA 4CCSA 2I2FA 3ORHA 3UIEA 3F47A 4YDRA 3JR7A 5JXJA 3ZDAA 4D25A 3R5JA 2W6JA 1J42A 2V59A 1XJ5A 4GFDA 2A4KA 2I6UA 3AL0C 1HYEA 2D7JA 5BR1A 1GYPA 2FW9A 3LX6A 3MJDA 2ILTA 2G9RA 2Q3BA 3VISA 3RFTA 1XQ1A 3CX6A 4BQFA 2O59A 1CJMA 2VF7A 1RWOA 3L6CA 2YYSA 3LX4A 2R7MA 3QTTA 1ACMA 1SB9A 4JC4A 2QRMA 4D4JA 3IT1A 5C5EA 3FTFA 1ZZGA 2VL7A 1GPNA 1QGOA 2IDKA 2EW1A 5EVJA 1AC5A 2X4DA 5B1SA 5FOWA 3GUHA 5ADUS 3BJZA 4K0RA 4DIUA 5L7WA 1T9DA 1I4OA 3CMCO 3L8GA 2QIOA 3OU7A 4FQ5A 3X1ZA 4E13A 4A15A 3QF4B 1Z6QA 2CXXA 3UWMA 2FGKA 3EIFA 4Q18A 2R79A 1G41A 4TTQA 3DW1X 4TWBA 2FJPA 3WLLA 4HDRB 4GS5A 2JGEA 3LU1A 2OKCA 4G0OA 1DRKA 1QSGA 4JQCA 3VPCA 3GB9A 1IZZA 1R16A 3ICOA 5J5CA 5AM2A 3BJIC 4DWWA 5E0OA 2P6PA 4OBEA 4IKEA 2Y1WA 3DG9A 3R74A 2CUKA 3I72A 1O97C 1R8QA 4X4FA 3DMFA 7ABPA 4YHHB 1FTGA 1TIKA 2YOGA 5REQA 4FUTA 3SCGA 2AV6A 1OGIA 4F6RA 2BJVA 3OLWA 3VNBA 3TZBA 3ZWBA 1O5IA 1O6CA 3LUCA 4PSCA 2HD4A 1F7VA 1HKHA 4LK2A 5DSZA 1VKJA 4LF9B 5ALJA 4I1YA 3EULA 1E7YA 1SKUA 4ADSG 1NUQA 3EVDA 3LUGA 2YRFA 3CLSC 4DV7B 2X7XA 1U1EA 3PUXA 4PG7A 3RSSA 1J8VA 3PHLA 3V3TA 5EXXA 1SG0A 3IP8A 4HAXA 3WKEA 1SIBE 2JGMA 3UUFA 2VDPB 4PHHA 3VM6A 3OFVA 2EFYA 4Q3LA 1HE1C 3DEYX 4JR2A 3GJ5A 2RGBA 1LF5A 1QJCA 2WJIA 4LY3A 4ZV9A 1RP1A 3F71A 4FILA 3MXTA 5ETJA 4HGOA 4B44A 4FW8A 2NMVA 1FQOA 1WDMA 4JL8A 2BM1A 4QRIA 5AI5A 3ETDA 1M76A 2ZTHA 1W5BA 3PE4A 2HA6A 3CJTA 3K9BA 4RF4A 1QYCA 4CIVA 5DMHA 5ESRA 3HJBA 3ZWMA 5BNTA 2ZTLA 5DB4A 3GW8A 3I01A 1UXCA 3L6OO 4WSOA 3STWA 4MQLA 3IQGX 3N2LA 3UMSA 4B84A 1EUDA 1WH8A 1PNQA 2VPWA 3FR7A 3ID6C 4KRYA 4BU0A 1NM5A 1SPXA 3IIJA 3G2JA 3KVOA 1W8IA 3MCWA 1D07A 1VL0A 4C7BA 2D74A 3FPKA 3ZY6A 3C6QA 4GQAA 3OMXA 3BDVA 2EG5A 4R8MA 5CT4A 1KDTA 2N1BA 1EQUA 2OFPA 3KBOA 1BXKA 1KTVA 2R8EA 2JFVA 3KZVA 3LZCA 5PNTA 1PQPA 1QHYA 1XF1A 3DTYA 5E3JA 1QC5A 1G6KA 1X1SA 3IT2A 2I76A 3LDFA 2MU1A 2AF3C 3BHMA 3FSEA 3CMMA 2HH9A 3LQRA 3ZDFA 2B2NA 1CUAA 2C4UA 1L5RA 1Y33E 1GTVA 2C99A 2GN6A 3T1NA 4D6YA 3L4BC 3HB1A 3TIXB 4XVRA 2EDCA 2GJ9A 5IUNC 1PJCA 1I3LA 4HEA6 4JELA 3DV2A 3N2GA 2P8SA 4FT2A 3WK6A 5H16A 2AEEA 4I8DA 1YVEI 3ITNA 4LXIA 4XQEA 2J6IA 2XB9A 5HBRA 2ZYVX 3DZJA 3T1HB 3LTNC 3QVVA 4MQ6A 4CV3A 4ON9A 4ILEA 4PC6A 2HTEA 2AFHA 1H0KA 1CW2B 3R3XA 5GMOA 3V4SA 4EPYA 5K0JA 1MVNA 4IH4A 2Y9MB 1DAKA 5JC8A 3LPMA 3D6TB 1WH6A 5A5FA 3COYA 1FJGB 3QELB 4RPIA 4MARA 1P29A 3F6CA 2Z08A 2DUNA 2V0NA 2C03A 4IXWA 4UJ5A 2ODRD 2HW8A 1ONBA 1GGFA 5IAJA 2OUKA 3IE2A 3SR3A 4FC6A 3L0BA 4L3VA 2OKGA 4GOND 1XPOA 3W6UA 2JAHA 3LOQA 1VMKA 1ZMOA 2GD1O 1NU6A 3OZTA 3ECSA 4EJ0A 3U44A 5K0NA 3NM6B 1JIKA 4D44A 4BBZA 3OWQA 1QHHB 1HR0B 5JDCC 2NO7A 4L07A 5EPOA 1WXFA 5G0SA 4WKOA 1CR6A 2R96A 4L9WA 4MJLA 4E1AA 4NBWA 5B30A 1Y0BA 3DZHA 1Y1SA 2G40A 1T9ZA 3GQBB 4URFA 5F5NA 4GVLA 1T5OA 7AT1A 1QIJA 1NX6A 5CVEA 3DMDA 4RCVA 4ZQIA 5E4FA 1JDTA 4X95A 2J5BA 1I1QB 4AUKA 5HPYB 3EIXA 4JLSA 4LTMA 3BH7A 4IPTA 4M1SA 3VHLB 3HO6A 3OQIA 1NIJA 5EE5B 2C2KA 3B36A 4EIWA 1CJBA 3G0BA 3DO8A 4HX2A 1T2CA 3SZMA 3AHGA 1E58A 1LK0A 4MULA 4OYHA 4B4OA 4HVCA 2XGMA 4YK7A 4IMJB 5ESDA 3ZDDA 3RSCA 1MXFA 3LW7A 1IZYA 1LKZA 5E2BA 5EEHA 4JP5A 3SE0A 2OBXA 4Z7JA 1GQQA 1OV4A 2VYVA 3D02A 4NHOA 3FIUA 4FD3A 1ISSA 1ZW6A 5K8CA 1RW4A 2JKVA 4UULA 2O8BA 4K9OA 1Q0LA 3K6RA 1ZI6A 1L5OA 2HO4A 4DM3A 2H17A 1JKFA 2I3ZA 5FLXA 3PL1A 4UASA 3PJFA 5LBTA 4LRYA 2WYUA 5CYFA 1NN3A 2NUAA 2FW6A 2RGRA 3OCCA 4KMMA 4KQWA 5E7IA 3TRJA 4GU5A 3TEJA 4F06A 3F96A 1J21A 4FHGA 2C5LA 3AQIA 4X4DA 4GR9A 6CHYA 1EM8B 1JAIA 1VOTA 4F91B 3E5HA 4FNGA 1T1SA 2NVUA 4WCFB 1E7WA 2AFVA 3MZ0A 4EAQA 1DXQA 4R6WA 1U0EA 5BWCA 4Z1OA 3G2NA 1TNDA 4NZMA 421PA 5JSUA 5JWRA 1ENZA 2GJSA 1D1TA 2HF9A 4E33A 1KMIY 2H29A 3R5XA 3WB9A 5KYNA 2PE5A 1B26A 1P0FA 3ZTWA 4GBED 2JJYA 2C7QA 4M2LA 2QZ9A 4FDMA 4I6TA 2QMEA 3IXQA 2XUQA 3PNKA 2QBYB 3NORA 2JGRA 3JAWB 4ED9A 1XELA 5IX8A 1USKA 5CT9A 2UYYA 4D3DA 1IUOA 4N6OA 1N7GA 1IUPA 4OOEA 1V7PC 2YY7A 1BA3A 2P9EA 4AQYB 5IU6A 4MQBA 7YASA 1IXYA 5DF1A 2OBLA 4FYJA 1VGVA 4JB2A 2EZUA 5DCLA 1K3UB 1FLNA 4MAAA 5HKKD 2FWAA 3C5WP 2J6HA 2YASA 4GR5A 4Z4FA 3GZTB 2YX1A 3EEIA 2P5YA 1P5FA 1W36D 1O5OA 4H6PA 3MOIA 3UMFA 4M1EA 1KK3A 1KY3A 4NHEA 2OOKA 3O91A 1JWLA 5TQ0B 5GPBA 3ROTA 1PG5A 3LRTA 6NULA 2VXYA 3OTWA 2VHUA 3DLIA 3CUEF 3DWFA 3K8OE 1FFYA 2AQIA 4OQDA 1XK6A 2JHGA 2FUNB 1TC1A 2JJ1A 1B14A 1KI7A 1C9JA 2O8VA 3C48A 3GVXA 5M34A 1T4CB 5DK6A 3I2YX 2XWQA 4DY6A 4LNUA 5HIAA 3IV9A 3ZWQA 4C6HA 5B55A 2QX9A 4OQFA 1R3UA 1W7AA 3WGTA 2OXIA 1HT1E 1NLMA 1E1LA 3PIIA 2RHDA 3FPSA 2Q1XA 2VDOB 3F3MA 3JYLA 2JIBA 4TV8B 5TGDA 4DSNA 2FXVA 4BNUA 3HI4A 3BE8A 2QZZA 3I37X 3BAFA 3R6WA 4K9NA 1KC3A 1M75A 2BFEA 1WDLA 4AN4A 4NH0A 2QU8A 1B00A 1SQFA 3VJRA 4IGKA 2XMRA 3CH4B 2XUPA 3Q3IA 3R6LA 4WXMA 1NJSA 4JZYA 1TLFA 3K35A 1OMOA 2CNKA 3KTAA 3OZFA 3ONFA 1W1UA 3RUPA 3TDKA 5EGSA 4PYLA 2HADA 2YZ7A 2ZAGA 1KRWA 2V6JA 4QOSA 3VZQA 4YV2A 3NV7A 3ILVA 4ARZB 1RWXA 5EPEA 2EQAA 5F7XA 4KQHA 3VSDA 1NNSA 4IQ0A 3F6SA 3S5JA 2OLKA 4IH9A 5COAA 2LLVA 1C81A 3G7DA 1T8WA 1FYVA 2XIJA 5JADA 2AHOA 2QQFA 4MUMA 4GX0A 5EINA 1XMVA 5I9LA 5KNBH 3U26A 1DT3A 2VJQA 3RFVA 5G0UA 1WMEA 1DADA 3NRJA 1A88A 4Z49A 3OZBA 2IHZA 2JFWA 2AZMA 3CSDA 2GAOA 1MFQC 4YQYA 2A1UB 2FEPA 4YRSA 1X3SA 3LVQE 4GSKA 1PJZA 1Q3KA 5DCWA 4UTVA 5L3QA 3SCHA 4BB6A 1X2LA 1FTNA 1XF9A 2JJ2A 3NC0C 5ERXA 2XCOA 1FNBA 1P9LA 2AUNA 3LCMA 1YBMA 4HNGA 4KN8A 2DRIA 1Q83A 2ECFA 1SXJA 1ZJWA 2C3MA 2RI0A 1EKXA 4BZQA 5JALA 2WHXA 1PGPA 1ESZA 3UANA 4G5HA 2FN4A 3WRXC 2ZSAA 4FWBA 1QYWA 3W5UA 4LXUA 2QL6A 4GYWA 1JQEA 1AUOA 4FW9A 4IGIA 1U0OC 1Q95A 2CUNA 3LFHA 3BRCA 2WDZA 1K97A 3GRVA 2B99A 4C07A 5LSAA 2F4VB 2G5TA 2GO7A 2PVSA 2V3WA 5K4AA 3SI7A 3T61A 3M0EA 4GKBA 4HOYA 2FW7A 2KZ8A 1NBOA 2WJJA 3FYHA 2GTHA 4JLOA 4JEHA 4RD1A 4XGKA 3ZQUA 1LEHA 5SY9A 2IKSA 4GLBA 4XX1A 3NTLA 1C7ZA 4QQ8A 4A6DA 4BS9A 2C8JA 1YQQA 1G7SA 1LNQA 2DQSA 5HM6A 4B1FA 1JA1A 1KYVA 4J75A 3E9YA 4GHJA 1OVMA 2Z5VA 3GUZA 3ZHBA 2PZGA 1V9CA 2PLNA 2XE6A 3AHFA 4FBMA 4UUNA 3KFVA 3DCIA 4I55F 3A6FA 3HMQA 1Z7WA 3NHSA 1HEIA 2FVYA 3E1KA 5KX5A 2BUAA 1YR9A 2BI4A 2AWNA 5IYZF 4CKEB 3RODA 4ZCTA 2JS7A 1BXGA 3GIWA 1I2CA 4P3XA 4I1RA 5LNK1 1E1QA 3DDWA 4IEFB 5HCUA 4CV0A 3X1XA 1ZM4A 4HNQA 5DASA 3IYLW 5PGMA 4HAUA 2V5UA 4UBIA 3R0IA 4BFSA 1MENA 3H2SA 1ZH6A 2HCNA 2R66A 3E7DA 4IGAA 4MYHA 2D7DA 4TTIA 3R44A 4Q16A 4HQ6A 1EEXB 2QXUA 2W0MA 1KY4A 2HXYA 3G2HA 2KQUA 3WWDA 1AIPA 3DV0A 4E1VA 4Z4CA 2YC2C 5BPFA 3T99A 1UBGA 2D5CA 1VM6A 4LZWA 3WVNA 1K1EA 4CF7A 2HJHA 4A23A 1KIAA 4XB6B 4D56A 5HRCA 3HB4X 5LMNB 1CS0A 2B4TO 1HL3A 3CIOA 2GA9A 3K1AA 4INPA 4P1ZA 4XDHA 1RPJA 2GYYA 4B46A 4BTVA 4ACAA 5JPDA 3PDWA 3PQEA 4LBZA 5EMHA 2YN2A 2GLUA 3GVPA 5LQSA 4P4SB 4MJ7A 4CFYA 3ZWWA 4ZTZB 1D9ZA 2BHTA 4WZAB 3OM8A 1E7RA 3AIIA 3PQ3A 3L7KA 1CNEA 2Z5LA 3ZWOA 4AN0A 5LOVF 1D6MA 2PNJA 2DCUA 3BMOB 4DLSA 2K87A 2QN2A 3CF4A 3OCUA 1LRKA 1E20A 4MPDA 4BQRA 3LPLA 4INZA 1E2EA 1NOJA 1PV4A 1QGUA 1SC9A 3FVVA 4J76A 4JKYA 3FUVA 2C78A 1SQSA 2AQHA 2HFKA 5CG2A 4IOMA 1D04A 3EA4A 3WMFA 3OQMA 3LUBA 4ZVSA 4CMJA 3WA7A 1U0SY 1XZLA 4NX2A 1SUPA 2HGZA 3L7BA 1E0AA 5IT4A 2QVBA 1LSSA 3CR7A 4Y6LA 3VPGA 1C8LA 1ZQ1A 1SXPA 4U6NA 3NWBA 4HQLA 4KR0A 4JOBA 4IIHA 5ALYA 5JMPA 3V8RA 2NACA 3E0QA 3OY7A 3TAXA 1PQ4A 3UBTA 1N2XA 1YZTA 1FQKA 2JEZA 4I3FA 5I4CA 5IDQA 4X4EA 3QYXA 1ESMA 4I5DA 4YPFA 1ZS9A 4JASB 4PBTA 4RPJA 1DAOA 2PIAA 4RNDB 3L02A 3MYRA 3V1UA 3ZLVA 3TRFA 3PEYA 1EP1B 3SJCA 2QM7A 4G41A 5IT0A 4OI0A 1AH2A 3SC6A 3R9WA 3OEYA 2G63A 3NNSA 4FSXA 4P7JA 3S3TA 2JGNA 3LNCA 4LI0A 1SHJA 4TTVA 3ROPA 2LBPA 2XMGA 5HRUA 3QE9Y 3G2IA 2DHRA 3NT2A 3I5MA 1ZC4A 4BNHA 4HRVA 4EF6A 3M5DA 3GY0A 4OA8A 3KX2A 3NGLA 4KFTA 1RJWA 2DBYA 4RA6B 2II6A 1U2QA 2IHJA 3L79A 3FRHA 3NP7A 2GCEA 2XUOA 4IEEA 2P9ZA 2C8VA 4UZEA 1LQ2A 4M98A 1S8FA 3KV1A 5K3FA 2ZEJA 2MYTA 1KR5A 1WLYA 5KYYB 4I8IA 2DWUA 4J0DA 2WM2A 2XSZD 1KOLA 5C1IA 2ID9A 3S7ZA 2D0DA 3WHLA 1EVKA 2O6HA 3OTHA 4MLPA 3WLJA 4X94A 4RX1A 2OVBA 2B4QA 1BFUA 3JQ7A 4NENB 1SVUA 3GGOA 4RDIA 2XT6A 2WT4A 5AK0A 1U3TA 1P62B 1XRSB 2OV3A 3PFKA 4F8DA 2JBAB 3AETB 3KPUA 4FYPA 1O9GA 4G23A 3U9LA 1Y42X 1QRDA 1CD5A 3B6EA 4QECA 4ER6A 3PENA 2ZWMA 1J5XA 5FWXA 2X1MA 3BRWD 5AH0A 4YV0A 5A4DA 1U2TA 3VR5A 2BMFA 1TGYA 3OF2A 5L53A 2DPGA 1UDXA 3OJLA 5DK4A 1GUZA 1UPXA 2GAFA 4URZR 3MINB 5B53A 1T0UA 2Q2VA 1SUCA 3HP7A 4NMMA 1X7WA 4XE5A 3RTAA 5BWBA 2YFQA 1N5OX 4ZIRB 3JQBC 1RHUA 1Z8FA 4JVLA 4OKNA 3W7VA 1ZY2A 3L0DA 1CBUA 3OKCA 3NB0A 1P75A 4LWQA 3KKPA 4O4HB 1W0CA 4ZVKA 2DERA 4C2UA 2K4MA 4LMAA 1LVGA 4I6JA 1VIYA 2UYGA 3RR2A 1FS4A 1DPFA 3D3WB 5CB4F 2PM8A 3WL3A 4ARSA 5KTSA 4RIGA 4NKRA 4URHA 5EHIA 3DHYA 3DEKA 5C51B 5ALNA 3GEHA 3L1IA 4RH0A 4CI0B 1U8UA 1XNQB 3AL3A 1NI5A 1AF4A 3MK31 1U65A 5CDTA 2HA2A 4E6EA 1CVLA 4EG6A 1U2RA 4FMPA 1KO5A 2BZ0A 2DBVO 2V6GA 1IWOA 3HJGA 5DLQC 1VIDA 3JYOA 5F4ZA 4W9NA 2C2MA 5FFMA 3ZE0B 1DKPA 4B7CA 3A1DA 5C1PA 3CROL 5C8YF 2DZDA 3QX8A 3HRKA 4XD2A 3UAGA 1XVVA 2JIQA 3AWIA 4JLVA 3M4NA 3SWWA 1GG5A 3V42A 3S55A 1S9DA 3H13A 3FOCA 4TX1A 1WCYA 3B12A 4CQNA 1U7TA 1XZAA 3A6DA 3DDNA 4XD7D 5ALTA 3RG8A 4AG5A 4B3GA 5KZMB 3K1ZA 4YJHA 2D2IA 2QB5A 1QOQB 3BBPA 3RYTC 2AXQA 2G82A 4DPKA 1MLDA 2H4YA 2JH3A 3NU1A 1DOZA 1FLDA 3ESZA 4HBZA 4JLJA 4XEUA 2KEJA 2VNIA 4YNBA 1WZEA 1V2GA 2REXB 1NQVA 2CLHB 3LNTA 3LQFA 3CEJA 3UB2A 3MJRA 1O4VA 1YMUA 3S8YA 3MJCA 2WWTA 3B78A 3DTVB 621PA 1X19A 4I9UA 1WMSA 4X63A 2DQZA 3LAWA 4OHWA 3TPCA 4KX3A 2W37A 5TQ2A 1PGOA 2FE4A 2WD7A 3VZRA 2FLKA 4YCNA 2C7PA 1G8FA 5AVJA 4HZGA 1Q16A 5C18A 3EXG1 3DMNA 3OLZA 1WIZA 2DJ5A 1ZMRA 2D5VA 1QUEA 1X92A 2QP4A 3IO3A 4U00A 3EVFA 4EY4A 3C15C 4K8RB 2CVFA 5AOAA 1VI6A 3BF7A 1E9EA 2OY0A 2F9LA 4LYYA 1M8GA 4QJ5A 1GA1A 1IBCA 1C9NA 2OG1A 2QRVA 1C8KA 3D4LA 1U7DA 2N0SA 2PAAA 3FDZA 3H6HA 1GPJA 3QPDA 5CEEA 2IYRA 2WIFA 4MGIR 2Y1XA 3NDBB 1JPVA 2QUKA 4ACBA 3FPBA 4M60A 1NUUA 4WX2B 4A8JC 3RYFB 4DMRA 3SQOA 2ZJ3A 4YEDA 1UM9A 4AZWA 1N0VC 2YWFA 1GZ7A 5DXFA 1T1JA 2BGUA 4MO9A 1F38A 4W63A 2R86A 3CH6A 4U9UA 4M8KA 2EFEB 4ONEA 1F3OA 3QWGA 4MP3A 5KTTA 2DFDA 4RM3A 1NVKA 1Q7EA 2O8DA 4W8GA 4K2HA 1ZICA 1TM7E 3F73A 2QQGA 3IAEA 3DQZA 3PFNA 3BD9A 1LA2A 4KGDA 2O0HA 1G8AA 4OHXA 3DQQA 5FCDA 2WD9A 3OKPA 1HQKA 4ZEOA 3T7AA 4RH1A 4AFNA 2JD0A 3N6XA 2XPCA 4AMUA 3ZQJA 4DMGA 2LNMA 3BA1A 3PUJA 5I9TA 4PU3C 2W6JD 5DGTA 5L95A 3O9ZA 3NVDA 2CHFA 1U8YA 4N3AA 1A3CA 1YB2A 5D3MB 4DSOA 3O8RA 3KUDA 4R9SA 5A9SB 4CMIA 3NBYC 3OMWA 2CZQA 4QUDA 2PUHA 4I8TA 5JE8A 1G291 4XQ9A 2NO0A 4BZWA 3BS4A 3QWHA 4L95C 3ZHVA 1JJVA 2AWOA 2JKYA 3N7AA 3HB5X 1FEZA 3WXMA 1T15A 1DO8A 4BLVA 5T8KA 1U3WA 1LZLA 1M6NA 1I6LA 2XAUA 3DKRA 3HXPA 1F8GA 3M2PA 3M9WA 4H3VA 5B5SA 2FMTA 3IUMA 4FK8A 1DFGA 1RAEA 4EHDA 3I23A 5TJ9A 1UBSB 5E7QA 1L1RA 2NGRA 2ZPTX 5DLYA 5IN5A 2BR5A 2O7NA 3V8QA 2XDYA 1DAIA 2YMMA 3MOSA 4HS9A 5F1YA 1I32A 3MGCA 3N59A 4E21A 3UUWA 1EFAA 3BMCB 1LJUA 3AEQA 3O8OB 1K7EB 3OQPA 1B15A 3OT1A 4MWZA 3R7BA 4DADA 2GD2A 5A6VA 1XDBA 1E18A 1XRJA 3G1WA 4BFCA 1REQB 3TGWA 4EGSA 2IP2A 3DE5X 4H4EA 3U3ZA 4RTLA 3DOHA 1W4RA 4LXXA 3HXQA 2R11A 4NPHA 4C4AA 2JCBA 4O4LB 3D8TA 5B1IA 3NTQA 3OFJA 4M1YA 1UIRA 1XTTA 1D2EA 4MR7A 1H5NA 2VPPA 4DSUA 2A5YB 1GUAA 2JIZD 1RPNA 2XYQA 4C88A 2GNAA 3A04A 4MX8A 1GR1A 3Q7PA 4URUR 1U28C 1T4BA 2ASVA 4Z2YA 5CFOA 1HE2A 1G20E 2JI7A 1RVV1 3C3KA 2XADA 3OPVA 4HDMA 1Y37A 3D1JA 4I81A 1HWYA 4KSCA 4P0PB 2F3SA 2Q07A 2Q6IA 1Q15A 3KLBA 3JV7A 3WGKA 4CIAA 3PYMA 5ALDA 4B3MB 4OQ4A 4CKBB 1LBIA 3BDIA 1QM5A 3N76A 2FKAA 5K98B 1BS2A 2QMZA 4JB3A 4OHMA 4RMJA 5K4HA 5AMXA 4COOA 3H1PA 1KDZA 1P1RA 2HRRA 2OR3A 2FSIA 2ZXEA 3BA6A 3AF0A 3OG9A 4X1YB 3ZU3A 4XTRA 1CUSA 2OEPA 1LQUA 2WF8A 4OOFA 4WJZA 5HIIA 3EK2A 1X13A 1FLVA 3RWOA 4UUBA 1W25A 1ZP6A 1XD9A 1Z07A 4JL6A 5E3HA 3CGWA 5HGXA 3MJFA 4WY5A 3VKVA 1GRVA 3GGJA 3K32A 4KCGA 4M55A 4BCBA 5JJKA 1WD5A 2OCGA 3ZDZB 4D46A 5CEJA 3FSJX 4ND8A 4REQA 1UZMA 3LY5A 3BD1A 4K6HA 1L4HA 5HZHA 2DXIA 4NCJA 2DT8A 5G0WA 3JZAA 4GSYA 5JSQA 1LMB3 1TZ2A 1NPYA 5AKKA 5AHRA 4I6GA 3CINA 5MGNA 1CIPA 3CTMA 1ZMBA 4JEMA 4K81B 2P4UA 4HDNB 1XL1A 5TVGA 1OFHA 3ECAA 4G1EB 4UD6A 2OR1L 5DN6A 3BCRA 4FOLA 2YDXA 4HNVA 3BZWA 5IXJA 1GEEA 1NN1A 3VGJA 5JROA 1JQ3A 1UDCA 2CL7X 2EFHB 1F60A 3KKOA 3IPAA 1XEXA 2BJHA 1FDTA 2VH5R 3IIEA 4HAWA 4M89A 1C1XB 5DWVA 4C4YA 1NVFA 3ROXA 1YUBA 5GGXA 1WKVA 5C1BA 3S2EA 1RYBA 2FFRA 1F9EA 2YXEA 2B98A 3FNIA 3RARA 2WSSD 2RI6A 2YL2A 4LDJA 2EQBA 4P86A 2DH5A 4INAA 1GTZA 2A9VA 3PFCA 1CERA 2ZBRA 3OIVA 3PC2A 3WBJA 3DEJA 3TELA 1MH9A 1QVVA 3B7PA 2CMKA 1B4DA 3EPJA 3OF3A 4UPEA 2AE2A 3VSEA 3KXPA 3KAQA 4MCHA 3TK1A 1OGYA 3X2EA 5FHRA 5IASA 2CNNA 2B7BA 4FHCA 2BFCB 2Q5HA 2Q5EA 1DDGA 2ZB8A 3BWXA 3EF1A 3AM1A 3S40A 3BQ9A 2ZYUX 1Z6XA 2OO5C 2X14A 1YVUA 1WM1A 2HV8A 4LYDA 4NVRA 4R7ZA 1DKRA 5IJAA 4CNBA 3CBQA 1SELA 2VT6A 4JLDA 5AOCA 3IE1A 2CT8A 1J5PA 2EFDB 2XE7A 3L82B 4WDQA 1Z38A 4TL6A 4F9GA 4DA4A 4OJKA 4B45A 1UBKS 2E89A 3FPJA 3OH8A 4YT8A 2PSEA 2J0EA 2XMCA 5SY6A 2FZWA 1QFSA 3V1KA 1DC6A 2X0IA 4UAGA 3U6KA 2CKMA 1UC8A 3UKDA 5LQKA 5IRCD 5TQVA 3AXSA 5AJWA 2HAEA 1ZZ8A 1FC0A 3DTNA 4AKTA 1QF6A 2ASEA 3FTDA 1YRHA 3M89A 1KEWA 2HEIA 1PF7E 1XCGB 4TS9A 1S6YA 2I2CA 4YJ3B 3CVJA 2OHFA 3AV3A 3RS4A 3NEAA 1NTOA 2EJVA 1V8BA 3SICE 2J4DA 1KEEB 3MWGA 4HLNA 4UTNA 1PWHA 5E7JA 1TZJA 4N76A 4JIGA 1JVNA 1G8GA 1POXA 2GPSA 4BFTA 5CT5A 2WYIA 4CLDA 1NRIA 2WFMA 4RTNA 2XD4A 3MOGA 4LTDA 4YVFA 5DU2A 5GM1A 2Y71A 4NQRA 1M1ZA 1H2YA 4M0CA 4D79A 5FJJA 1ZGGA 3GLFA 3WBBA 3GF4A 3M81A 1U1IA 3FIJA 4QLOA 1HTTA 1Y9AA 2NU7A 3FF1A 3PXAA 1OUMA 1Y1RA 1ZD8A 4MITA 4CKZA 4ZZIA 1J8YF 1YZGA 2J59A 4J1NA 4WESA 5HOQA 2ZDHA 2VK4A 4S04A 1YF3A 3OMTA 1YC5A 4JC8A 4OM8A 3PUWA 2PKWA 4KHPB 1R0RE 2V6MA 1J0DA 1E69A 4CKXA 5CR9A 3VR1A 3WG9A 3OWHA 3UJ8A 2X3FA 3OJWA 5KQLA 1A97A 4AY5A 1UKAA 1KH3A 1QV7A 2ICTA 4UTPA 1XQ6A 2IU4A 2QK4A 1LDYA 2QPTA 3CCBA 4O0MA 5CTJA 2OZEA 5C46F 3BXEA 3FCUB 2A6PA 4BP9A 4UU0A 1YDMA 5ABPA 2FTKE 4B74A 3G9ZA 2I3DA 1KNQA 3OIFA 2C8KA 1QQTA 4ARAA 3L7LA 4B4KA 4WXRA 1OIXA 4JFRA 4DMUB 2D3TA 3PC8A 3HCFA 1GR0A 1YZQA 2YWBA 4RC9A 3TTXA 2BZGA 2J7KA 4YCLA 1SBCA 5ER9A 5ALOA 4AG3A 2HB6A 2ICAA 4HDQB 5JNRA 4EEKA 4ZU3A 1XA4A 1W36B 1BJRE 2WWYA 1R0KA 1HYQA 2IPXA 4XSVA 2MQKA 3MS2A 5E7MA 1N6OA 1JPJA 3C4JA 1E2HA 4LZAA 2H4ZA 5JNWA 2ON6A 4YFYA 1NR5A 3FETA 1KNXA 1P0MA 2LKDA 2BUCA 3BFKA 3ET4A 2AR9A 3CX8A 5DNAA 4ZOQI 1EZ1A 4KFUA 3SKVA 4OG2A 3MMSA 3QMMA 1KI1A 2BNOA 1VL1A 2CL0X 3MWJA 4HGZA 4IQGA 5DPMA 4ARZA 3SSAA 1PR2A 1SQ5A 4K28A 4A5SA 1H69A 3IUEA 1EDBA 1ZMXA 1BHO1 4H3HB 5FOXA 5EIXA 1I8TA 5T3UA 3ADBA 3KDSE 1TKAA 1PJLA 2B8NA 5E2IA 3JQ9C 4PZZA 3RAJA 3ITDA 3F8TA 2Y1CA 3K0CC 4L4YA 3S2YA 1SCUA 4J94A 5E0KB 1ZRMA 4EYEA 4TLMB 1DC7A 1F5NA 1QH8B 5F7JA 4ALMA 2XA9A 2ZFUA 1K66A 3ESYA 3H6GA 2P0AA 3IAM1 1ESNA 3QVSA 4HH0A 5JHHB 4BEBA 1ULTA 5BUCA 1AQJA 2VUIB 4XTCS 1Y3HA 4YV1A 3WA6A 1S5PA 5CIQA 1EI9A 4Z1MD 3K9CA 2J9FA 3K70B 3A9WA 3O03A 3O8QB 1OT5A 3W2TA 2DFVA 5LA6B 3TVDA 4HNUA 2IVBA 5CFRA 1FQWA 2DLDA 4I5FA 4AZ0B 1QK5A 1MH1A 1X3LA 4FFRA 2PPVA 5BXQC 5DT2A 4BGDA 1Y8QB 2J48A 1EUCA 2P2NA 2Y99A 4UQLA 5B2EA 5DIFA 1MB0A 1I14A 2GQ0A 2J3LA 3FUCA 4LN1A 3EPPA 1YI8A 1X38A 4BP8A 3JVIA 3RCBA 1THZA 3DAPA 1BCRA 1U2GA 2Z2YA 2OZLA 1C3VA 3B8HA 2Q5CA 2XRYA 3VUFA 3C3CA 3UICA 3R9IA 3ZZ0A 2V45A 1PFVA 2P0YA 1U8ZA 3PPIA 4GL4A 4ODIA 1R0BA 4MRMB 4OIMA 4DRXA 3R1IA 1OY1A 4WVLA 2H5LA 3RHZA 2C77A 1W36C 1WP4A 4YRFA 1ZOLA 4MHSA 1LLDA 1RACA 3UGTA 4COKA 2R8RA 2X5KO 4PSVA 1FFHA 1SXJD 3CKLA 4HNHA 3GOQA 4MRAA 3FKQA 3I92A 1P33A 3NWPA 1N2ZA 5FV4A 1VYUA 4JK3A 4R1PA 2BEVB 3WK4A 4FFVA