2PUDA

Crystal structure of the laci family member, purr, bound to dna: minor groove binding by alpha helices
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
338
structure length
338
Chain Sequence
TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLEANTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of LacI member, PurR, bound to DNA: minor groove binding by alpha helices.
pubmed rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*AP*CP*GP*CP*AP*AP*AP*CP*GP*TP*TP*TP*GP*CP*GP*T
total genus 118
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 1997-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2pudA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pudA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pudA02
3JVIA 3QEMB 1QPZA 3FYMA 1ZZ8A 3MQ4A 3CZ5A 1UDRA 2FEWB 4FB4A 1A0OA 1SQ8A 2LYRA 1QP4A 3RQIA 3GN5A 1OSLA 4NQRA 4MGEA 3A0UA 3N75A 2FTKE 1GT0C 5GOTA 1ISSA 3JPYA 3HDGA 4PYRA 3F6CA 3QEKA 2KYRA 4OTZA 2PLNA 3Q7RA 2FLWA 3O1JC 3ZHMA 3DBIA 2FMHA 5IEBA 3C97A 3MF4A 2XIUA 2OFYA 1YS7A 2YHAA 4RZSA 2OENG 4LX8A 5I4CA 5FWXB 3FGZA 5T3YA 3K9CA 2KPJA 3MA0A 2FMFA 5EWMB 3Q15C 1Z12A 4O1HA 5ABPA 1XHEA 1ZHHA 3SCHA 2JVJA 2E4YA 3VK0A 4KFCA 3F52A 3T38A 1CEYA 1ZUGA 2LPMA 3QLUA 1LQCA 1W25A 3O74A 4PICA 3TB6A 2IPMA 3N0RA 1DCMA 3F73A 3OLYA 1ZVVA 4MS3B 5ED4A 3OO0A 3TX6A 3KSMA 1QQAA 2FMIA 2XJ3A 1DJMA 4RK0A 3FMYA 4IWRA 1NXPA 1R63A 1JYEA 1P8AA 4YG1A 2AYZA 2N9UA 2TMYA 3A0RB 3LUKA 2ID7A 2FKAA 1ZS4A 1A04A 4YWHA 2R48A 2F8SA 4Z9BA 4YGXB 3QLUC 4TLMB 3H6HA 3D02A 3RVQA 5IUKC 5BRAA 3OMXA 4GHJA 3DGFC 4N0PA 1FFGA 1JX6A 1JL3A 4XASA 1P6QA 3CU5A 1Y7YA 2GRMA 5JNWA 1P6UA 4KV7A 4LE2A 4YG4A 3SAJA 1M5UA 3FYAA 2FXIA 4ETIA 4OLAA 4I6TA 1DWKA 1MAVA 2AXZA 3BDNA 1RXEA 4F11A 4F8DA 1GUBA 5IC5A 3QF3A 4P1ZA 2VK2A 1P2FA 1LK0A 1ZGZA 5FWYB 2NUBA 1ZGGA 2XI8A 4RY8A 4S05A 5EWJA 1DRJA 4UHKA 1SRRA 4RSMA 4EY3A 5BRJA 4LDAA 1JH9A 3LKBA 4MS3A 4ZMSA 4KRFA 3UUGA 4MCXA 1JLKA 3H5TA 4Z5HA 2I6FA 3CECA 3OMWA 4KQCA 1TVMA 2CSFA 4GNRA 2WWVD 3OM1A 1QQBA 1EAYA 3LTEA 1RIOA 4G0ZA 4YS6A 5HQJA 3C6QA 4X4IA 4TN5A 3JVDA 3DGEC 4W5RA 1PRAA 1DC7A 4FE4A 2JRLA 2RDMA 3KLOA 5KQGA 3JXBC 4NDWA 2A9QA 2L19A 1E6MA 4ZPJA 2L8NA 5IEJA 1USGA 4KK3A 1FSPA 4RY9A 3A10A 4J1XA 1YMVA 1Z17A 2WRZA 2EF8A 3F6WA 2R25B 2YHBA 1VKRA 1RPJA 4LRQA 3BILA 3EODA 4L85A 1EHCA 4JP1A 3QQ6A 2PUCA 1DCKA 1JF8A 1USIA 2FLKA 2R47A 4ZMRA 1XHFA 5BQ3A 1AU7A 4MLDA 3Q7SA 5GQSA 4TMYA 3NHMA 1LLIA 1VPWA 1QO0D 1U2QA 2L18A 2PAFA 4O1IA 3RH0A 5TPWB 3ILYA 4XLTA 1GLGA 1ZZCA 1DZ3A 3JXCL 4RK7A 2GWRA 3JPWA 4EVRA 4M88A 5PNTA 4PU8A 3BREA 4N0QA 2BGGA 4X4DA 4EVQA 1BDIA 1FQWA 3LFPA 3IPAA 1K66A 4CBVA 1LCDA 4JB2A 1PRUA 3L6UA 2IVGA 3RVPA 1B0NA 4IF4A 4RXMA 3LISA 2NZVG 4Z99A 3SNKA 3MIZA 3OMTA 1ADRA 1ISRA 4OATA 5B3JC 2HJ9A 3G7DA 3BBLA 3LKVA 3SQNA 4HNQA 3IVPA 3QYXA 1PEYA 2CWDA 3OQOA 5TQ0B 4RK1A 3SCGA 3TO5A 1R69A 2JB9A 2L17A 1EWTA 4RXTA 4I6RA 5FWXA 2KEKA 1B00A 4KNYA 4GQMA 4WT7A 5EWLA 1AB5A 2D5VA 4QYMA 2PJUA 5JNRA 4KREA 1E3OC 4JCYA 1EWKA 1JDPA 1MIHA 2FVYA 4Q7EA 1JWLA 2KEJA 1F51E 3E3MA 3GT7A 3UKJA 3RVMA 4KQ9A 3NBMA 3KYJB 5DKFA 1W9HA 4JOQA 3CKMA 5E3JA 2PIJA 1PHRA 4HNSA 2L2QA 4MQFB 2IV1A 4KPYA 5FBHA 3NNDA 2E4ZA 4Z5DA 2FQYA 3RVLA 4Y9TA 3OM0A 1XWRA 2IKSA 5HM6A 3QEMA 3GBVA 4W5TA 3KLNA 4FN3A 4Z4EA 5HSGA 4N76A 4JB0A 4PU4C 3IPCA 1ZN2A 2HQOA 1CJGA 4PU3C 2CHEA 2GZUA 4X4HA 1PNTA 1LBHA 2J48A 2WJAA 3TMYA 2AXUA 2WUSR 1SXHA 3CZCA 3HUTA 4D74A 1C0EA 4YARA 2FN9A 4DN6A 3IP6A 1Z26A 4NICA 3SCFA 4IGAA 5IBQA 5JNTA 2W42A 2RJOA 5F64A 2AXVA 1M2FA 5K98B 2JVIA 4L4UA 3I5AA 1USKA 5CNMA 4GPAA 1JFSA 1NXTA 1GUDA 4MS4A 2HSGA 1JFVA 3CFYA 1NXOA 4O5AA 3KKEA 3MYYA 4JA2A 1POUA 1QNLA 2E4WA 1R8JA 2WY2D 4Z58A 2LYJA 4Z4CA 3GA5A 9ABPA 2E4UA 3ZKCA 4IILA 3G5GA 3H1GA 2FQWA 2EWTA 5CNJA 3RVNA 1KRWA 1NXSA 3RZZA 3B2NA 4RWEA 4MRMA 4MCTA 2XSDC 2JBAA 2LYQA 3IDOA 4KMRA 4RS3A 4Z0NA 4IRXA 5JNVA 4X4GA 3O1IC 4NCAA 3DZDA 3GV0A 1KRXA 3CNBA 4RK5A 3QX8A 1ABEA 2CROA 4LDZA 5TE9A 2BJCA 2O4AA 2PKXA 3EQ2A 4G0PA 4JASB 3EQZA 2NZUG 4Z4FA 3C3KA 1LJUA 2PL1A 3LFTA 3NNSA 4NV3A 5JNSA 3HS3A 4MYRA 2AW6A 2ZAYA 2PUFA 3HEBA 1NY5A 3G1WA 3L49A 3LUAA 2JVKA 4EVSA 3I42A 3QLVA 3LUJA 3GYBA 2FMKA 1NERA 4MR9B 3HSYA 2IOYA 2O20A 3BS3A 3BRSA 4OB4A 4G0XA 3LMKA 4FBIA 1LMB3 1OXBB 1DCFA 1ZDMA 2ICPA 3K4HA 1QP0A 5JS2A 3GRCA 3H1EA 4Q6BA 3HZHA 3D8UA 3I09A 1MB0A 4MS1B 1K68A 2BNOA 2O38A 2LCVA 1ZH2A 4Z5CA 3URMA 2GX6A 4JCXA 2VYCA 4RU1A 1YIOA 4NCBA 1DBPA 3T95A 1PEAA 3CHYA 3QELB 4MAAA 3RVRA 4E7PA 2MYPA 3HCWA 3OLXA 4N47A 2IPNA 4Z9AA 5DTEA 3GWGA 1JFTA 2QSJA 1DG9A 4X4CA 2XDYA 4MR7B 2XCJA 1QKKA 5KQMA 2PUEA 3QLVC 3HVRA 4PZ0A 3R1FA 4J1WA 3OO1A 4RKRA 3F51A 2HQRA 3H5IA 3VNBA 5IUJC 5T7BA 2IPAB 5C5CA 3M9XA 4MR8B 1YMUA 4EYQA 2OR1L 1EFAA 3JS5A 3N8IA 3CS3A 4G0OA 3MM4A 3P9YA 4KVFA 4UHJA 2PL9A 3IP5A 2R63A 3ROFA 4YRZA 4YCSA 2LYSA 2FEKA 3LUFA 1CYEA 1HF0A 1L5YA 4WUTA 1Z13A 6ABPA 1D1PA 1DP4A 2HQBA 2QVGA 4MR7A 4HNRA 1Z2DA 4S04A 3ROTA 1E6KA 1I3CA 5TPZA 5TPZD 2QVCA 3LOPA 1RZRD 1X2LA 4I8TA 2M98A 1Z2EA 2Q5CA 3HUUA 3KS9A 4OBBA 3SM9A 4DQDA 2FQXA 3GBFA 3N0WA 1C4WA 3N53A 3R0JA 1U0SY 3PXPA 2LBPA 4RY0A 3QX9A 4G0QA 4G0YA 4EUKA 1ZPQA 2A9PA 3EGCA 1XWWA 4H3KB 1FFSA 3QWGA 3H1FA 4G86A 3HM9A 3JXDL 1ZZ7A 2IYNA 1NXWA 4D6XA 4IA8A 2LYKA 4WZZA 1TLFA 4RK6A 4F06A 5BR1A 3C3WA 4RV5A 3W9SA 1Z18A 2B4AA 2FEPA 3I45A 1L1MA 1KMIY 1URPA 2IU7A 4XFKA 2OQRA 1Z25A 2MEZA 3DLHA 4EYGA 1LCCA 3F6PA 2A9RA 3NNNA 4ETNA 2RGYA 4XARA 4N41A 1IIBA 1E2BA 3MLFA 3O2QB 1BA2A 1ZH4A 2H3HA 1E6LA 4F12A 1AB6A 2JBAB 4ML3A 4W5QA 2DRIA 2CD7A 4QPJC 3H5VA 1ZESA 2HPHA 3KXAA 2GBPA 3FFXA 1WH6A 1JDNA 4MRMB 4D6YA 3CG4A 3KZ3A 3F7NA 2R1JL 1VRVA 1IC8A 4E7OA 4W5NA 2IVBA 2GKGA 5KC8A 1PNRA 3CRNA 4G0MA 5DLEA 4RK4A 3SG0A 5HKOA 3N6VA 5JS1A 3M6MD 1BDHA 1UTXA 2LYPA 1TJYA 1SD5A 3O21A 4ZJPA 3OQMA 2ZWMA 3O2JA 2JCGA 1NTRA 4ETMA 4EYKA 1JHZA 2BNNA 1RZRA 7ABPA 4EGSA 5C5EA 5CNIA 4YP9A 1WIZA 3KHTA 3RVSA 2PUBA 2PE5A 3CTPA 2L49A 4KK4A 3MMNA 2O49A 2PPXA 1ZY2A 4RXUA 2QR3A 2QW1A 2WJWA 2CHFA 5D2CA 5DCLA 5IUNC 5KQPA 5TQ2A 2VUHB 1PUXA 3B7HA 2KZ8A 2MYTA 3HV2A 3OQNA 2QV0A 2WB4A 1PRVA 3O75A 4H60A 1UXDA 3VNAA 1FFWA 1RXIA 1APBA 1YVUA 3BD1A 2ID9A 1ZZBA 4WWHA 1U2PA 1VLZA 2QXYA 3KG2A 2IPLA 1DW9A 3CG0A 4MQFA 4MS1A 3OLZA 4QICA 4EYOA 4YR7A 3H75A 4MQEB 1A2OA 1ZAYA 1JBEA 2E4VA 2A9OA 3QLTA 2P4UA 4FE7A 3T8YA 1NXXA 3DLBA 8ABPA 3ILHA 1CHNA 1U04A 5TPWA 1YK1A 1U8TA 2MQKA 3H5LA 4W5OA 3FDFA 3EAFA 1M5TA 2LUOA 4YG7B 1RNLA 4X4EA 2H0AA 2RJNA 4P98A 3ZHIA 4I6UA 4XAQA 1Y9QA 1M2EA 2KEIA 5IULC 4F8JA 4JQDA 3S8QA 1YK0A 2AUWA 3RVKA 2F8TA 3IP7A 4YV7A 3D1NI 3QK7A 4WXMA 4X4BA 2GI4A 4Q6WA 4B09A 2A6CA 2VUIB 3E61A 4O8BA 1YSEA 2IDMA 3TD9A 5KC9A 4H3HB 5FWYA 4Z4IA 3HK2A 4XXHA 2B5AA 4MR8A 4Z4HA 3EULA 1PERL 2FSPA 2IUOA 4IMJB 4OG2A 5DGCA 2AYXA 2ICTA 1H9CA 1J56A 3U3WA 1GCAA 4Z59A 3JTEA 3KYIB 2HINA 3Q7TA 4OLBA 1GCGA 3H5OA 2MSWA 3O2SB 1ZZ9A 3GL9A 5KWSA 3NHZA 4PU7A 3LUCA 2PUDA 3IP9A 4F3TA 4LE0A 1D2AA 3HZIB 4KZKA 3O1HB 5EWJB 2FJRA 5CNKA 3Q41A 3EUSA 1QO0A 3M9WA 1NXVA 4MS4B 1LBIA 3N0XA 5KQLA 1WETA 1UXCA 1CQTA 1QP7A 1ZZ6A 2PMCA 4IVZA 5KI6A 4X4FA 3HDVA 2AWIA 3KCNA 3OP9A 4LE1A 4MQEA 4MR9A 4YO7A 2FN8A 2V0NA 4JAVC 1OCTC 3H5WA 3H6GA 3O9XA 2H8RA 3HJFA 3CROL 4PEVA 1D4ZA 1S8NA 2B1JA 1HEYA 1SXIA 4IMIB 4Z4GA 2LP4Y 3LUGA 4MLCA 1O4XA 3CLCA 1S7EA 2MSLA 3GBPA 2QU7A 2BNMA 4N03A 1NATA 2GRLA 4YLEA 3KJXA 1DBQA 3HO1A 1KGSA 4HYEA 2M1ZA 4ZYLA 3LUDA 2EBYA 2LYLA 4RDCA 4RKQA 1JYFA 1SXGA 3BRQA 1QMPA 1TM2A 2QZJA 2P9HA 3LUHA 2MSKA 1TMYA 1ABFA 2JK1A 5B3JA 2X7XA 2WMYA 3FMVA 3C3MA 1Z15A 6CHYA 3EJWA 5TQ2B 1F4VA 3FFTA 3T6KA 3S99A 2JVLA 1OXKB 1T34A 3OLWA 5TQJA 2E4XA 1DRKA 1Y1LA 5EWMA 2WIUB 3RVJA 5FBKA 1YS6A 1BAPA 3EDCA 1YTUA 2NT4A 5EWLB 1WH8A 3Q9SA 3RVOA 1BVHA 3A3KA 3DNVB 3OLVA 2FW0A 3QELA 4YBAA 1BDJA 5TQ0A 3KTOA 3TRBA 2NT3A 3L1PA 5IX8A 2R4QA 5A7LA 4DADA 2PUGA 1D1QA 1RPEL 4G97A 1Z16A 1MB3A 3CLKA 4TLLB 4PE5B 4QYWA 5CHYA 4Y42A 3GN5B 1MVOA 3G85A 1D5WA 1ZITA 3HXMA 2MYUA 1RZSA 1NEQA 2IVQA 3UK0A 4MPTA 3SY8A 1DBWA 2PUAA 4WXEA 1LJLA 2MYNA 1X57A 3FFWA 1EWVA 1L5ZA 2LIVA 3JY6A 3UFDA 4LZLA 5JNUA 1DC8A
chains in the Genus database with same CATH superfamily
2BTOA 3FYMA 1QDUA 2G8NA 4GMKA 3P20A 3U48A 1DE0A 4AJNA 4Z9XA 3EFHA 4J6FA 4FQ8A 3ECSA 3PUWA 4YXWD 4ZCRA 1GAWA 2D7CA 3ROXA 2EX0A 2HWUA 4XJVA 4D56A 1K4MA 2XV1A 2IUEA 5KTYA 4NXNB 3FUXA 4TS1A 1U0HC 1NUQA 2V97A 5JANA 5JI2E 4R71A 3G0CA 3ZCPA 4QNRA 2HGZA 5AUOB 4YK7A 4HRVA 4CM8A 3UANA 1ST2A 5FPHA 1JSCA 3LCUA 4YDRA 4HQKA 2WYOA 1X7WA 4I4IA 1L4UA 4RZSA 5KMGB 4Q3CA 5FWXB 2FZCA 2PBFA 4HQNA 3WMEA 3Q15C 3G9UA 4GSYA 1ZW1A 4Z7NB 3CPJB 1X70A 2FMXA 1SC3A 2GTHA 3DHEA 1VMEA 2AMLA 1J8FA 3G0GA 3C7DB 4C4AA 4WFKA 4DDVA 4FI3F 1J9ZA 4CM4A 3P0FA 4MQ6A 1SC4A 2K2WA 3B82A 1T8TA 3BBPA 3DPSA 3EWIA 3NB0A 4GP7A 4LCBA 3C3XA 3QE2A 5E4JA 2X13A 1TZCA 4TYYA 3B8HA 4YRJA 1O57A 1B0AA 1S0UA 1UK9A 2FMIA 4FMPA 1E18A 2A5JA 2N9UA 2AYZA 5H02A 3A0RB 4MAMA 1OBHA 4JLWA 2O19A 3F9CA 4XD7D 2ESRA 2DQKA 5AK4A 5FUBA 5J4LA 1KRHA 3CF6R 1YI8A 2B0JA 4TWZA 2OQ2A 2WNHA 3ASZA 2FX5A 3KT8A 4JMLA 1YZQA 1UP6A 4Q4AA 2AN1A 3LWBA 3RVQA 2RBEA 1TECE 4G4SP 4GHJA 2EWVA 4R9NA 4X0EA 4EBFA 4S3MA 1GR0A 1OFIA 1KPHA 3R76A 2P2NA 5BMVA 4HDRA 4EO7A 3P45A 3C45A 4R1MA 1HLDA 4EJ2A 5EN4A 4F93B 1KAEA 2G1JA 1EFTA 3PE4A 2LZ0A 4QU8A 2YJGA 3HWSA 2LNDA 2IW3A 4KE7A 4H9GA 1PO7A 3WRXC 4G2NA 4P1ZA 2QOEA 3FA2A 1LK0A 1N9KA 1ZK1A 2Z30A 3I6IA 2XI8A 4FFBA 1UEXC 5DYYA 3UAGA 4D4IA 1QFJA 1P0MA 1TZ2A 4UHKA 3VAYA 1Z4IA 5ER9A 1F48A 1A5SB 5BRJA 4RUKA 4ZMSA 3SR4A 4KRFA 1JJBA 1U1FA 3N2YA 5KSPA 3ONVA 5DNVA 2MSEB 3TQRA 1E58A 1U3TA 3VR4H 3FVTA 2V5UA 2XX3A 2WSIA 1EPUA 2W8BB 4BX2A 4D5GA 5TARA 4MUXA 4UVDA 2F4VB 3ESAA 2Q9CA 3FTCA 5SYAA 1MX5A 3DGEC 2PMKA 3QFHA 4B0PA 2ST1A 5JZ9A 2JRLA 3CLVA 2XNHA 4ZVUA 3JXBC 5JAQA 2PWBA 1ORVA 1TZKA 1XU7A 3OESA 2G80A 5HJ2A 2J33A 1JMKC 2D1YA 4M76B 5BSEA 2IVFA 3UOWA 3AKCA 5A1TA 2EX1A 2Y2UA 2PCJA 3BILA 3TLGB 5H8WA 1FDVA 2HCNA 1DKOA 1EHCA 2P69A 2XXAB 2ZB4A 4PO9A 3GI1A 3KQTA 4M37A 1Y4ZA 4ARIA 1YB5A 1EK5A 3PUJA 1WMEA 1THTA 1XP8A 3INYA 1X8JA 2I7VA 2OBXA 4PWYA 4RFSB 4RK7A 4LJ9A 2FSUA 4BX0A 5IDQA 1CDOA 2O3RA 3NAZA 4M83A 2C5GA 2ZYAA 1X7YB 3NM5A 4KQKA 3MWEB 3EZXA 1VQ1A 4JP2A 1E2EA 2NXEA 3O0TA 5F3WB 5JRJA 2HQSA 5C8YA 3O7WA 5C8ZA 5K6RA 1W19A 4UDNA 1I0ZA 1ND5A 3KQNA 2FPGB 1QP8A 1UBFA 2ZTVA 1GTSA 3OFND 4MKIA 4CNBA 4Z99A 3TZ6A 1IRXA 2J7WA 3OFNA 4PTYA 4BP1A 2A9JA 5LMUB 1U0LA 1R6TA 2XF2A 4MVXA 2VL7A 4HNQA 4Q3BA 3S7TA 1KTIA 5KMGA 1NHWA 5C0OE 1UBKS 4J9UE 3UV7A 4HMQA 3VZDA 1KQOA 4I6RA 3KRTA 1YA4A 3FHCB 4RDIA 4YAEA 3BA1A 4DOMA 1ILWA 1VL6A 4HS9A 3V7UA 4OAQA 1D2CA 1DNPA 2FVYA 3PLRA 2ECQA 1H0HA 1N6KA 4RAOA 4ECAA 3GT7A 3HUFA 3HWWA 4ENSA 1A8PA 2YXLA 3NOQA 4BV8A 2Q8PA 2DXIA 1T4CA 2AG6A 4JOQA 3BJEA 4U4AA 3SGLA 1LX6A 1LX7A 4XUGB 2UZ3A 4QYTA 3HB0A 2OHXA 1F5NA 1AUPA 2YYYA 1MRZA 1PV1A 2L2QA 4MQFB 1AVTA 3T7EA 1Y1PA 2WPNA 3KDAA 4I4TB 2WNSA 2QB5A 4Z5DA 1DTSA 3RVLA 3VHQA 3ZHBA 3BXEA 2H7CA 2YWBA 3KOOA 3RSGA 2I67A 2CXTA 3MWKA 4W5TA 2IODA 3F7MA 4FN3A 3HGMA 5HSGA 4OGKA 3L79A 1U8CB 2HK9A 3PCXA 2VNIA 1CLUA 1D04A 1T3LA 1S2DA 4MA5A 4PZYA 5AJHA 3SIXA 1NJ1A 5DM0A 5JSZB 1N3YA 5AM2A 1ZM4A 3KZMA 4X7RA 4YARA 1SBQA 3SQLA 3ZVLA 3AI3A 4V39A 1HNWB 4X6UA 4D5EA 4E88A 3FSRA 2F67A 4GX0A 1KYXA 3DFKA 5JD4A 3VR1A 3WNVA 1PR4A 4K6MA 3WQQA 2REQA 1KK2A 2FETA 1MRSA 3MFQA 2NU7B 4PSCA 1AS0A 3KTDA 3L1VA 1K2WA 2ZRCA 3HYTA 1D07A 2N46A 2RHJA 3OEED 4HLCA 3NHFA 4TRJA 4BP3A 4IYRA 2XXAA 3TTUA 3T1QA 4Z54A 1JE0A 3TUZC 4Q24A 1KFBB 1PNOA 2JASA 3RSOA 2AOUA 2NVUB 3EXHA 3KKPA 3BRCA 4P83A 3ZN2A 4BDSA 1YU9A 2AXQA 1HBJA 5LDGA 3DDUA 4O4LA 1M34E 2WYUA 1XF1A 2AFHA 3A06A 4N40A 4Z2AA 1NZFA 2B1GA 2X22A 1O6CA 4FYJA 4BRUA 1F0YA 1SVKA 3OZCA 4E5KA 3WK4A 3EVEA 1IWBB 4ON9A 4EPXA 3AHJA 1PUJA 1ZCZA 4XQGA 1M7HA 3JWJA 5HS4A 5FULA 5I7VA 1D2MA 2Z57A 3BJIC 4ZOLB 5HP4A 2BGTA 2XWSA 1U63A 4U7PB 5L4SA 3Q0IA 4L0MA 5HGXA 2ID4A 1QCZA 3ZUPA 4X66B 4QGGA 2HSJA 2QNRA 4DLUA 1I3NA 3JQAD 4FYHA 3RJTA 1L7VC 4KPFC 3BMCB 3HP1A 2AYYA 3V5NA 4ESOA 3EIFA 5DFAA 1DAHA 2A1IA 3HR7A 4URFA 1XZGA 2D6FA 1M9NA 2GHTA 2E48A 5DW3A 1VHWA 5H70A 4AI6A 3IMEA 1RD4A 4UVIA 4P2BA 4O4HA 2CD9A 3LFHA 3T3HA 4LV8B 1Y82A 1Z4JA 4IWNA 3VTFA 3X1YA 4EDHA 4JZYA 4R5MA 5IABA 2MYPA 2RONA 4HUQB 3W5SA 5ARBA 1JHPA 1WKVA 1JFTA 4EQ6B 5I9LA 2XCJA 3D6NB 4ZQGA 2SECE 3R1FA 1T6NA 3D4LA 4PZ0A 1QCCA 5HXAA 1UPTA 1Q3HA 1UJNA 1SIWA 2Y9PB 1NJ6A 1Y5RA 1U9IA 1YMUA 2QY9A 2VT3A 4GMFA 5L3ZA 4BECA 1O6ZA 1CUEA 3IQXA 3A26A 5BWNA 2GJKA 3IP5A 5FTNA 1QZUA 5CAEA 4LXIA 4FSHA 1IC6A 4JUFA 4YMUA 4JQZA 1SOAA 1L5YA 5GJBA 3C8HA 2UAGA 3CUVA 1VJGA 3ICQB 1CEQA 5AKXA 3MWGA 1CSEE 2VPWA 3HFGA 3WGUA 2MWMA 3PGLA 3W77A 2FX2A 2NYAA 2Q41A 3A2NA 1EFRA 3B6IA 3I8XA 3QOFA 4H7FA 4P7BA 2ZI4A 3ANNA 3MN1A 3IBFA 2J4FA 2UZAA 2XAUA 3D2AA 1S8OA 1PRYA 5JXGA 1Q1BA 2FQXA 1GO2A 2BGLA 3L1JA 4R05A 2H6EA 1CZLA 3CONA 4FCCA 3OZVA 2RC6A 2WICA 4URHA 2ASVA 3QX9A 1Y3FE 3QI2A 3AFGA 3COZA 4E2WA 2IK8A 1B0PA 1KVSA 2V4ZA 5DRYA 3M4ZA 2R44A 2YXEA 5DHAA 4X45A 5PGMA 4LJRA 5BRNA 4BLRA 4KB5A 3TLMA 1R37A 1WY7A 4YJGB 3SQDA 3R5JA 1N78A 1MW8X 2ECKA 2KJQA 3ZI4A 2VYVD 1NF9A 4ENQA 4TZTA 2QTHA 2NO9A 4ZEMA 4XX0B 2VO1A 1HRDA 1RPZA 2FZKA 2Y9MB 3EA5A 4HB0A 3SJUA 2B30A 1LU9A 3DXYA 3VVMA 2R60A 4NMXB 2FQQA 1GNRA 2QG9A 1DBSA 5KHLB 1K63A 4I1YA 3G1TA 2V6IA 1BE0A 1ESDA 2VSQA 3VZCA 1E1LA 1WXDA 2H4XA 4QRIA 2R8YA 1XTZA 4K3UA 3G0HA 3QMWA 1Q3KA 3QFSA 1D9ZA 4OJQA 3EXG2 5FFMA 5G3ZA 5M29A 4P4LA 3D1JA 3CXUA 3N59A 4YT8A 1ZHOA 4D9MA 1ZS9A 5FO0A 5K0TA 3MB5A 1V96A 5E9JA 5JS6A 4FP9A 4LMBA 3SSMA 1X1CA 2GTIA 3KR0A 1DQSA 1CUHA 2IHTA 4NEQA 4UBOA 3JYQA 2VJMB 2WIJA 4ZZ1A 5LBUA 3HBJA 4WFIA 4EGSA 5DK4A 2QBYA 4B3SB 3WLKX 3KHTA 2F17A 1ZA2A 2CFRA 3KDPA 1GPWB 2AUNA 1NLYA 9LDBA 1ZR2A 1PFWA 2WZCA 2FFQA 2WJWA 1YQXA 3PWZA 4DE8A 5ALFA 2DUNA 3TBHA 3V4FA 3AKZA 3SIPA 4EY7A 5GAGi 3I1FA 3UWDA 4DV2B 3O8QA 5E2IA 5TT0A 5F2OA 4DV0B 3TR5A 1C4OA 3K0AB 3KELA 4YV1A 4RTQA 1PJSA 1Z4MA 2HWXA 1M2VA 1T5SA 2Z83A 3HKEB 4B45A 4BB0A 5C51B 4BE4A 1Q0TA 1ITZA 1T5TA 1U2PA 2Z8YM 1HNZB 1A97A 2J3QA 1DAKA 2Y0CA 3I0MA 4FOOA 3H75A 1IAVA 1JBEA 4OH1A 4PIPA 3P2IA 1E1KA 4KN6A 2GD2A 1NXXA 4HS4A 2GEVA 3RFFA 2DWOA 1S7GA 3C1OA 2YN2A 3H5LA 4JGGA 2R5WA 3EVFA 3FDFA 3VBCA 3SYKA 4ZCMA 3CZMA 1BXKA 4QX6A 3WJ1A 1R0YA 4I6UA 2ZULA 4CMHA 5A9RA 5D00A 1F3OA 3RREA 7REQA 1NVVQ 2ZBEA 5KYNA 3DAYA 5B1IA 2OQVA 4DIUA 1PZNA 4RD0A 4RBNA 3U7GA 1VJ1A 3R7SA 1Q0ZA 2F1JA 1D6JA 4F4HA 2F62A 1B41A 1IXSB 1VC2A 2IDMA 2O7SA 2W2KA 4D9JA 8LDHA 4Z4IA 5FV7A 2CFCA 5KTNA 1BVRA 1KYYA 5BN4B 1Z36A 2UYCA 1FTNA 3HB7A 4KN8A 4P54A 4Z1MD 5K7SA 1U1EA 1JILA 1CQJA 2JIOA 4XEHA 5DGCA 4YCNA 4W8GA 4Z59A 2HSDA 2X0IA 2HINA 1AKUA 4HGNA 3PVZA 4Y6PA 5KSWB 1U3UA 4FBGA 4N6NA 1SRQA 4RHXA 2PVSA 2X8BA 3SQMA 3WYEA 5KTPA 3MT0A 4O8CA 4PZAA 3G2LA 1M75A 1RPAA 4KZKA 3ACDA 4IHQA 2C99A 4DLYA 3GD5A 3H2IA 3MMSA 4H7IA 1KI7A 4NATA 3RWOA 3HKCA 4NYJR 3AEYA 3CPSA 1AHNA 1B3RA 1LLCA 3WNCA 4AXBA 3WGJA 2QAGC 5D3MB 3QNMA 2WIGA 4XVCA 4JU9A 4JI7B 4YONB 2XRYA 2CUKA 2EBUA 3GEMA 4YJDA 2YY5A 1RM0A 4X7MA 5IM4A 4FDUA 1Y3DE 2O2HA 4NY1A 3S55A 5AQEA 3TLYA 5KCMA 3WSTA 5KOHA 4AMYA 5ITZA 1RWMA 4RJ2A 4UARA 5SY9A 1D4ZA 1IJBA 1J09A 1S8NA 1WVMA 4M9XA 5LP6A 2BTEA 4MLCA 3M82A 2EZTA 2OCBA 2B3DA 4O4JA 3OPYB 5BV2P 2HDNB 3IXQA 2JJ2D 4F2PA 1Z4LA 4D2IA 4DWJA 4ASUA 2GPYA 4KTTE 2Q1UA 4B35A 2C07A 1ORTA 5JJLA 5LFAA 2QENA 1TT7A 1YS1X 2Y0EA 1MC5A 3IX7A 1JYFA 3RT1A 2V7QD 1OLXA 2XGGA 2YUIA 3D0RA 3L8HA 4Y2PA 5AW7A 2VH1A 5AKJA 2QRHA 3ZY3A 1ZZEA 2H2DA 5DRTA 3B3GA 5D87A 3NW9A 3C3MA 1A1VA 4CEHA 1UK8A 4QPZA 4C0LA 2PA3A 2K5UA 1P29A 1FYVA 3FCXA 1AQ6A 1G5PA 3T3OA 4DZZA 4QQKA 4AT1A 3CIFA 2V8OA 4I36A 3O26A 5ESDA 1ODJA 5TQJA 4OO3A 4DDWA 2CBGA 3W5DA 4DXDA 1ZX1A 2HCJB 1GYPA 1KJ9A 2O0KA 3KYDA 1E6UA 5ITVA 3PNQA 4CGYA 1BAPA 3UUEA 3CT4A 4TROA 1J23A 3IO5A 4DNXA 4WUVA 1IDN1 2PX6A 4P4NA 4EI2A 3EXHC 4F91B 3MMZA 3CVYA 3NS7A 3TOSA 4DJJA 5TQ0A 3KTOA 3LCJA 3VU8A 4BQPA 1BKDR 2X1VA 5LYJA 3RRNA 4DJTA 3DMNA 5EE3A 3DNMA 1RPEL 1TC2A 4NZYA 1WHTB 4ZTUB 5JYCA 3LWZA 3DKKA 1FMCA 4AJPA 1XJCA 2GZ3A 3MW8A 3AR8A 3CSUA 3M6WA 3STTA 2VF5X 4BFWA 5KS2A 3SD7A 1OC2A 3GCGA 1CJMA 4M86A 5E9AA 3TSAA 5C8VA 1EWVA 4MGZR 2IEDA 4YRQA 1QG4A 1BW9B 3ZY5A 1VBMA 1F8FA 1DXOA 2WM2A 3FR8A 5BSUA 3P0EA 5LM3A 1BQ3A 3V8BA 1WHSA 2YFKA 3NV9A 1XRPA 2XRMA 1U2RA 2GASA 1DKMA 1UJ5A 5JC1A 1FX1A 1MIOA 3U4IA 5LBIA 4LQCA 3GJ5A 4IVNA 3V2HA 4H7KA 1T0PA 2V6MA 5KVAA 4MEAA 3VVBA 1TCAA 2VRNA 4QDXA 1VMIA 3IMCA 1N2EA 1IM8A 4BX8A 4CN8A 2UXCB 4IOLA 2JZOA 3G8DA 4RTMA 1J8VA 3Q7RA 3GROA 3ZHMA 1OTXA 1V1MB 2C4UA 4RYLA 1X39A 1YQWA 4M36A 4CQMA 1YS7A 1YZ3A 2OENG 2QIPA 2AR7A 3FGZA 3JR7A 4OXQA 3SP1A 1VFPA 4J75A 5EI5A 4CTNA 5AK6A 5EWMB 3C87A 2ZJ7A 1RAGA 3AVWA 3IUYA 3PTAA 3ZBUA 1F0KA 3O94A 1UADA 2XDQA 2XQFA 3OKFA 2Z09A 3UAXA 3O74A 3TXYA 2ZSIA 1D6MA 5C8DA 3V3TA 4QHYA 2KS6A 3GLHB 1E9AA 2ZTSA 1CQXA 1RPTA 2Q07A 1NW3A 1SUEA 1VLLA 4WZBE 2PJZA 1J07A 1NE7A 1ZIOA 2WM9B 1IZ9A 4FIDA 2FKAA 1QTRA 4ZHQA 4EY5A 4KUHA 1WM1A 2DVMA 3O3MB 2WSSD 3O4JA 2PBZA 1KZGB 1R4NB 4RORA 1OW3B 5F52A 4ZD6A 5K3SA 1QF6A 3WOVA 3UMJA 1JX6A 4O2BA 4QQRA 5JNWA 1TM1E 5L4NA 2W6PA 3PQ8A 1Y5IA 4XLLA 3D0OA 1KETA 5DSXA 1HTTA 3LO5A 3FYAA 3C7AA 3K70D 3AFMA 3B6KA 1ZW6A 4KHPB 4MP3A 4PFSA 5EJ4A 3F6EX 1RC8A 3FBGA 3IEKA 1XG5A 3I04M 3PGJA 4WBSA 4H17A 3OZBA 1GXSB 3O8OB 1XOIA 4KNYA 4ALJA 2LLVA 2PQMA 4QGAA 3HA5A 4LDAA 3LKBA 5EQTA 4YAUA 3B1ZA 4Z5HA 4KUGA 3D1LA 2EJVA 3B5IA 3ELUA 1TVMA 1RAEA 3OOHA 2WG0A 4AJIA 4G0ZA 2L42A 3TQFA 5EC8A 4UU8A 3FF4A 2QMYA 4GQAA 1IU9A 4QU0A 3ZW7A 4YJ3F 5BT8A 2GZDA 2G0NA 3EHDA 5BVHB 1HNNA 2A9VA 2H54A 4V2UA 2ZM5A 3K35A 4ID3A 1L4HA 4DLXA 5K9ZA 3U3XA 3MSCA 4HNHA 4PYKA 5HR5A 4RLSA 3HUEA 2F3SA 1Q21A 3D31A 4G8JA 1XLWA 4CF5A 3L8GA 2UZ0A 3BF8A 1IM5A 1CF9A 1R9MA 1RLIA 3QGMA 3W1EA 2YJ5A 2H5JA 4QOSA 2WSBA 3TL3A 4FU0A 1M72A 5G0WA 5JY1A 2R8RA 1OFGA 4XLTA 1I9GA 2XD9A 4HXGA 2VJDA 2OHIA 1X15A 1ZD3A 4IGIA 4WBXC 5IYZF 2NO6A 3DL4A 1UT8A 4PU8A 4IO0A 2PPVA 4W7IA 1NVWQ 1PNQA 4JKIA 3TSWA 5JSZA 1SJ9A 3TLBA 2H17A 3NANA 2FJPA 2GN1A 1FJ2A 4MHSA 4P22A 1VA4A 4CIBA 4EH1A 4MVJD 2IS4A 2NZVG 1ZCFA 3GJZA 1ADRA 1V37A 3EE6A 1DC5A 4PX3A 4Q4JA 2ZB3A 2H57A 2YYZA 3H9JA 4YMTA 3OE5A 4OHMA 2MJLA 3MYRA 4LXQA 5CIWA 3NBYC 3P94A 1R69A 5KTSA 3NTXA 3IPRA 1GFIA 4LMPA 3DOFA 1ZMXA 3KJNA 1TPYA 2HSWA 3ZE7A 4KN5A 1EINA 1PF7E 2BGIA 5KX5F 4LTDA 3RUPA 1MIHA 2BHLA 2XI4A 2YJ4A 4RF4A 5I7AA 1B26A 4A8JC 3RVMA 1PQYA 2A30A 4EG1A 3DBHA 1BXGB 3WQRA 3DB1A 5JHGB 4IIJF 5C4MA 4TL7A 1S2IA 1NN0A 3VKWA 3RHFA 5JUWA 4S12A 2GCOA 1TM3E 4Y9DA 2LW7A 4A6XA 2VKTA 1PL7A 3V9AA 2IEIA 4YMLA 4LYFA 4CCWA 5GINE 5HOQA 2OZLA 5A5DA 2CWWA 2PXQA 3K6KA 1PJ8A 4CUKA 4FOPA 2O2JA 1DDIA 1ZN2A 3DONA 3K2BA 2H5EA 2VQSA 4XYGA 2GEFA 2VHZA 4LK3A 3ZDXB 3K0CA 1N0VC 3C3EA 2WUSR 1R6DA 1SURA 2Z3WA 1RE1A 3D8BA 3OKCA 4I5IA 4M46A 4Q00A 4TTRA 5AM3A 3RUEA 3OWHA 4EO4A 2HF7A 4J1NA 1HQKA 2R87A 2XSZA 1YFKA 1Y48E 3DQQA 4IIJB 1OAAA 1P5FA 4TTAA 4WKCA 5DV9A 5IBQA 4DLPA 1XZQA 4PLTA 2D4AA 5DX0A 4NI5A 2C97A 3OOEA 2QGFA 4UNQA 4OQLA 1DEAA 3I5AA 4IX9A 3RU3A 3GEGA 4CFSA 1YFLA 1G21A 1KYVA 3QPAA 3W04A 3IR7A 3TPCA 4QG7A 3CC8A 4Q7LA 5A9SA 1T3SA 4Q2JA 2DB3A 4KVZA 5EJ2A 1JP7A 2Q3BA 1QGAA 3GA5A 1CQZA 4UCXA 2G5CA 1ZK2A 1WUIS 3BCHA 3OAAA 2ZSKA 3R5XA 2XXBA 5CNJA 1FYEA 4BFSA 2GETA 4BS9A 2C00A 4MRMA 5K0NA 2AN4A 3LCVB 4W5RA 4BVHA 1Z0FA 4LSZA 4BBPA 2ENWA 5JMOA 3EW9A 3QOYA 1XXHB 1B6GA 4IDCA 4YUZA 3KR2A 4UMVA 1NU8A 4DV1B 3VR2A 3ZUGA 2AC7A 5FX2A 4E5NA 3PE6A 1W59A 4K05A 2PXKA 2H5LA 3QFFA 4MV6A 2RHRA 2P3QA 2NVWA 1LJUA 2Z9DA 2HLPA 4V1CA 4QLAA 4G4SO 1GM5A 1I3MA 4LJ6A 4MYRA 3W8EA 1QGYA 1YKGA 3I6YA 2E87A 3DH0A 3ZI0A 2V7EA 4MIKA 4U7WA 3G1WA 3S2GA 5IK2D 2JVKA 3TNYA 3MGCA 3TBFA 5B7GA 1DKRA 3S28A 2EEPA 1BD4A 3DBOB 4PRYA 4FDTA 1O9HA 1O77A 2BKLA 2P4SA 4OB4A 2HBYA 3CUTA 5CLQA 1KZHA 1LFDB 2ZIUB 1ZDMA 2H4JA 2UZ1A 3A36A 4H1UA 1KAOA 4LZPA 4Y30A 1H2HA 2B20A 3THOA 5A5FA 4BGIA 1H0SA 5B64A 3MEJA 5JXJA 3DKRA 4H3VA 2PSHA 3C24A 3KHSA 3QVUA 4BNDA 1ZRSA 4ES6A 3ICWA 5CD9A 3PKZA 2F43B 4JJEA 1T5DX 4UFNA 3ILVA 2GN4A 4OL9A 5C3MA 4N47A 1OZHA 3RJMA 2H2AA 1PTJA 3GWGA 1H9BA 4ARZB 1J5PA 2QTVA 3L01A 2FSSA 4B8YA 2C4MA 5K05A 4PYOA 1OIXA 1Q74A 5AJVB 1KNXA 4IZOA 4OHFA 1BX3A 3AP1A 2QROA 4K46A 3W6PA 2UVQA 4TGLA 2OZEA 3ZU2A 1XQWA 4G0OA 3AM4A 3ZIAD 1NNI1 4Q7JB 3AJEA 3N2KB 4PF1A 1AUXA 1SCNE 2EKPA 1Z63A 2CV2A 3DBLA 1CZRA 1HF0A 3KPYA 2ZRFA 3GP3A 4S0XA 4WUTA 3ZU5A 3KQHA 1TMKA 2HQBA 3L92A 1U90A 5H82A 2CNDA 2GMWA 2YVLA 2LGJA 3C3JA 2GPBA 4KDFA 3II6X 4Q15A 1LBQA 4CM8B 1KDVA 1W36B 1GCUA 3KKLA 5TGDA 1X2LA 3RTCA 2UVPB 1W0JD 3AINA 3QKWA 3PPYA 1LC0A 2XTMA 3ZDEA 4NOMA 2GJSA 1H8ED 3VOTA 4AKIA 2PZLA 1L7AA 3R5FA 2K6GA 1AQUA 4H3KB 4Q4CA 1Q20A 3H1FA 3ZXUB 5A2QA 3AI7A 3G9XA 4IUYA 4D0SA 1NR5A 3TELA 2AZMA 2A1UA 3N6RA 3PX2A 5KNBH 4BNVA 2D1SA 1SB8A 3ZXSA 2PJDA 1M6HA 4Z53A 2ZXUA 1LCIA 1ZRMA 4DV3B 3PJGA 5FOXA 1BSVA 1JFLA 1QB7A 4FCVA 4DMFA 3P32A 4DM3A 3KALA 1CP2A 3OWXA 2FI1A 2OLEA 3RKRA 1WBDA 4FC6A 3LW7A 4G56A 1G2QA 3RARA 1EFHA 3O2QB 4DA0A 4EIWA 3LWNA 3DEKA 1E6LA 4FD3A 3ZHVA 1JW9B 1XMIA 3CZAA 4ZEXA 3C1AA 5DNEA 4B4WA 4EGCB 1NFRA 5FV4A 5FTMA 3NIDB 1W2GA 2FR8C 1CUAA 5DM1A 2Q3EA 2M2IA 3IFSA 4WESB 4XM1A 4O2AA 2PX4A 2V4MA 1IC8A 5LU9A 5C9ZA 5GIOE 2JS7A 4G5HA 4OU4A 4Z0HO 3HJGA 1OXMA 3P97A 3WISA 2VWPA 3AY6A 3PCRB 4NH0A 3FW1A 5E8JA 4QQNA 2BISA 1BDHA 1Y63A 1J97A 2PGXA 1NBEA 2PXVA 2P2DA 4KXWA 1NTRA 3RIHA 1SBZA 1XVUA 3HY6A 4HG2A 4EYKA 1RZRA 4F5ZA 1TW3A 3DWIA 3O84A 1HM5A 5EP3A 3LGXA 3CF0A 4ZYWA 4ZDIA 2AGVA 3LT1A 3RG8A 4H16A 3ZVNA 3A6KA 3D54D 3H86A 1JIQA 3L2OB 4TWRA 3RGGA 3U7EB 1D5CA 3WBJA 4B4KA 2ZYIA 2GHIA 2IEZA 3BD9A 5EHGA 4UATA 1VCIA 4IGAA 2X4GA 3DTTA 1S2MA 4EJSC 4TL9A 1C3OB 3A4LA 3VTKA 4Q1FA 2P62A 3H2YA 4AL4A 1UXDA 2CBZA 5BXYA 3RYCA 3EN0A 4MW5A 4JS0A 2O2XA 4D98A 4EL5A 3I0NA 4RHFA 3OX1A 1N92A 3IPXA 3PG5A 5IXSA 4V03A 5KVVA 3TMYA 2BHRA 3C16C 1ZAYA 1IPFA 2O2YA 2TSYB 2V4UA 1OBFO 1I4LD 1B7GO 2C3MA 5CJPA 3F90A 5DVZA 4YN3A 1B8NA 2C7PA 1YK1A 2O3SA 3IVAA 1EEXB 3HVIA 1EIZA 5EXXA 5TY0A 4AYWA 4KMSA 2PXLA 1FSFA 3D2LA 3JVVA 1L3BA 3PI7A 1JAZA 1OD6A 2B9EA 1Y9QA 2C1ZA 3DA8A 4YDQA 1JECA 1EXMA 4L57A 5F7OA 4DR6B 4DA9A 1Y3HA 3WIEA 3TZKA 4J3NA 3WV4A 4MIEA 3MJHA 2PYDA 5I8ZA 4EW2A 4X4BA 2PU5A 4NKRA 4JI3B 3TW6A 2REOA 5ELXA 1IHYA 1W2WB 2XCQA 3EZGA 1CUXA 3FRHA 3IUNA 3QV1A 5HKBA 5K0ZA 3EULA 2ZIXB 4OKNA 1UQUA 5GGXA 2AYXA 5HIAA 3K70B 3PGVA 1TJ5A 3WP0A 1QORA 3U4HA 2ZS7A 2AQIA 3LPMA 3KSBC 3IP8A 3T15A 1TEXA 2GQ0A 5DDIP 3WL5A 3WWDA 4YCCA 4GPTA 3VU9A 2ZBPA 2CUZA 4DYVA 5C1PA 2P0AA 5ES3A 3JQRA 4OK3A 5MN5A 1Q91A 3KLBA 4IP0A 1Z0AA 3I64A 5DTJA 2ORVA 3QVGB 1H1LA 2DTDA 1G9SA 3R2JA 5B1SA 4HNVA 2ZT8A 1CQPA 1W47A 3EXFB 4ND1A 4Q3OA 4PO1A 1QRDA 1ZUNA 2Q3FA 2EOAA 3Q8MA 2W6JA 1WAMA 3AKEA 4RHEA 5F3DA 3A3PA 2FF5A 2IHVA 2C31A 3B6ZA 1CEXA 4OGLA 1L7OA 2PX3A 2NQ8A 2B1JA 2YINC 2X0FA 3TF5A 1Q0SA 4NHOA 4AO7A 3GF4A 3WZLA 2PNFA 2XVXA 3UH1A 5DM70 4PLFA 4V38A 3QOXA 2FRXA 2QD1A 4UE2A 3LHDA 2HC9A 1VE3A 2O0HA 5J9FA 4OIMA 3S2FA 3BFPA 4HWRA 3MJFA 4LRXA 1K8ZB 1UBGA 1ADGA 3WOHA 5C32A 2A4KA 3IKLA 3HNPA 4HDNB 1NNUA 4I6EA 4OUDA 4ZQCB 2OBFA 1PSZA 1N8SA 2DY0A 3GNTA 3GZNB 4RQBA 1MB2A 3I3OA 4IKOA 2HBQA 4AJJA 3D3JA 4RZ2A 4LFAB 3Q5DA 3KOXA 2W6JD 5JS7A 3CEHA 2DFDA 1IQUA 4JQYA 2NZWA 2JNWA 3GEBA 3VPHA 4COKA 5JAPA 5ULLA 5IJ9B 2H18A 5CDHA 1Z2OX 3L43A 3N86A 3A9SA 2YYAA 4ALLA 1XCMA 3O3NB 3Q4GA 4CYMA 2CJYA 2I3DA 3ZY2A 5DBHX 3ZE1B 4XSVA 3Q6NA 3G5TA 1V8FA 3M49A 1S8AA 1VG0B 4KWHA 2Y1KA 3I1IA 4RVUA 3TFQA 5IAKA 3R5HA 1P1HA 1GG2A 3QUBA 4PE5B 4IVPA 3UZUA 2C5SA 4E70A 1V3QE 5BMVF 1ZM3A 2JK0A 4PPYA 4QFCA 4CCSA 1P73A 3UK0A 4AJ9A 3RUCA 1LJLA 1ORDA 5ALDA 1W6RA 3DAOA 1U3FA 1N6HA 3I9FA 1DPGA 1GUFA 3DVSX 2YW2A 4GGMX 3TW0A 1RRGA 2JL1A 4MRVA 3WGHA 2JIQA 3AEKB 5JVDF 4FMBB 1VBKA 3OBIA 4FNGA 4LA4A 3CZ5A 5HZHA 3T3DA 1P2DA 1SCUA 1KEVA 3OX4A 2GEJA 1QYRA 4A1OA 4BMNA 1SBIA 2VZ9A 2FTKE 1Q7CA 1TDJA 2RKOA 3Q7IA 4KQXA 4ZXPA 3JQQA 3ODPA 1BN7A 5FRDA 3SIRA 3T06B 1O94A 4Q9HA 4GFDA 3STYA 4BQNA 1Z6PA 4ZO7A 4DTCA 3B9BA 1KYIA 4HH1A 1SU7A 3NEPX 7MHTA 3GA0A 3H9UA 3QTBA 2DHRA 2HK6A 5IEBA 3TD6A 3O4HA 5EVCA 1U4OA 1Y6JA 2PSFA 3A1TA 2X5KO 1ODLA 4LX8A 1NV8A 4MQBA 3PVCA 3D7SA 5A0TA 4EGAA 2X1LA 1FX0A 2JVJA 1B4DA 3G2IA 3MCVA 4L8FA 3VHXA 1DXHA 2WU0A 3BGIA 3VZBA 3WIDA 1ZUGA 4TQUS 1QMGA 3AY3A 2RG7A 3BXZA 1CUZA 4BLVA 3SJCA 2IQ5A 5HF9A 2OAGA 4Y2TA 1N2OA 1P3Y1 2IA5A 4L02A 1X80B 1ZVMA 3L0BA 4GRAA 4MDHA 5I5GA 2CC2A 4IWRA 3IHLA 2H31A 2FDCA 1TTTA 3O3OB 2IGBA 2PNJA 3EXFA 4NTZA 4KE9A 5I7RA 3PXEA 4CM6A 2NU8A 4OB6A 4RGYA 2AWOA 4G23A 1JU4A 3DCIA 2VDNB 2F8SA 2JLWA 3HXQA 4LDJA 1NBMA 1E3EA 4PZZA 4AYXA 2O7NA 1KDOA 4YYEA 1D4OA 4LRUA 1L5RA 2Y27A 4HAWA 1XTKA 5EMHA 5FI1B 4P8RA 3M6VA 1V3UA 2JAXA 5FOUA 3SAJA 1CY6A 2O8EB 2Q6IA 3F5FA 2G9UA 4K81B 4UMEA 1JIJA 2I4TA 3BCUA 2BKXA 2AXZA 4H6PA 3VZPA 4AZWA 5AD1A 1WXIA 3ETEA 2JJ1A 1VIVA 2WJ3A 2NU8B 3ETNA 1U7HA 1GR1A 1FMTA 3L7KA 3WS7A 4D57A 2O5CA 2J3JA 4BQQA 4Y1GA 2JRCA 4QEDA 2ZVJA 5G0UA 2VDKB 4Q37A 4D4JA 4XCQA 3H4TA 5AXAA 2PS0A 3UUGA 3ENKA 3GC6A 3VFDA 4RIFA 4O4IA 3CECA 1T0HB 4UBIA 2CSFA 4HRYA 4BLSA 1RAFA 1OLUB 1QQTA 3IQIX 3OM1A 5I9BA 4QDTA 3NGXA 4G4JA 4UBLA 2HM7A 1WBJB 4LEIA 4YCJA 1C4XA 5ALZA 2IU0A 4BL5A 4CLDA 4XWWA 3BQ9A 3KPVA 3UOAB 1BFDA 1X1BA 1YQGA 3KSZO 3BE8A 4TS3A 5EYPA 2JGMA 1Y8QA 3DVRX 2ECFA 4DLSA 1DXQA 2AFRA 3E9MA 3V4VB 3L8CA 1QHEA 2H1VA 1WXWA 3EODA 5DYWA 3IKTA 2VJCA 3D1VA 3HL4A 4QELA 1TOAA 4CG0A 1NQUA 2RHWA 2J0QA 2FQ1A 1G8SA 3GYGA 1LPSA 4RCYA 3EGDB 4JVLA 4I9HA 4DR4B 4O1IA 1SXJA 2R9VA 3VAAA 1DB3A 1KH3A 2OGSA 5BSTA 5TPWB 4AO6A 1M1YB 5LXTB 1DIOB 3F74A 4EVRA 4BFZA 5PNTA 1SCUB 2Q3JA 2ZREA 4TS4A 2ZIAA 1BEZA 3CR3C 3VHRA 5LSAA 2P6OA 1FZQA 5ITWA 1B0UA 3ROGA 1XRNA 1TGVA 3L1KA 2IVGA 1DQYA 4KL8S 3ELYA 4X24A 1KKLA 4H27A 1B0NA 4J1QA 3KWLA 4WNCA 4FW9A 4BVBA 1XC7A 5MGBA 4LOJA 1LY1A 3LRPA 1Z0SA 1ECPA 3ZVRA 5B3JC 5EUMA 3KT0A 1PGQA 2CE7A 1X7HA 2OV6A 2W6QA 4GVPA 5HMLA 2DHDA 4N1AA 4WKPA 3TD2A 2WQ6A 4XYMA 1B73A 1C3VA 3GVCA 3FHTA 1FEZA 3CNOA 1N2CB 3PQ5A 4S2EA 2OYCA 4UUNA 3RSFA 4NNPA 4EMTA 3RS7A 3NBMA 3M4JA 1U28C 1ZK0A 1I30A 1JU9A 2VZLA 3QMPA 4PGMA 4BAUA 3H2KA 3VH4A 3I12A 1OPXA 1ISFA 2Z58A 1I4EB 3D6MA 4FB5A 4B17A 3GJTA 2Q0QA 4IAOA 5DNUA 5L95A 5AM1A 1OZ0A 1QG2A 2GA8A 1SWWA 2AJDA 2JA2A 4MO2A 4BCDA 5KTOA 4OUDB 4V0QA 2Y77A 4P58A 1QGOA 1EGHA 3U9LA 3QU7A 2PH7A 1XWRA 2IKSA 3U4DA 5JHHB 3GBVA 3VRHA 3AC0A 3KLNA 2WYWA 2PFSA 3LYLA 4BNFA 4X1IB 5IBCA 2OCLA 2N1BA 1QQ5A 4ZAFA 4XOIA 1GG5A 1NF8A 3A04A 5KOJA 1YR6A 3R9XB 1ACLA 1SELA 1K3TA 1V16B 2B6HA 3M1LA 4PINA 4LNAA 4M0MA 2LV8A 1YHNA 4XIYA 3CF4A 3T9AA 4OQQA 2D4HA 2FN9A 1JKJB 4J0DA 3IP6A 4D1YA 4GKBA 3NJ8A 1G42A 4QE3A 4YMVA 1ZI8A 2MOKA 1D8AA 2C0PA 1JEYB 1G9XA 2IYEA 3NU1A 2CHQA 1CB0A 1YUBA 2FSHA 4GE0A 4KSCA 4XRRA 3QWHA 2R6AA 1W4AA 3D5EA 4ZZ0A 3AEQB 1WCYA 4FR2A 5JH7A 1PEKE 2NTYC 3DLTA 3C4VA 3DYBA 4GZLA 3QVGA 5IJ0A 2RIPA 4CQLB 4O5AA 1TYDE 1NASA 1KOLA 2PCLA 3NJ4A 4HLUA 4XD7A 5JO9A 4DJEC 3K2QA 1UJBA 3UJNA 1DOAA 3ZY6A 3AH8A 5AVUA 5JTUA 3IDFA 2BBSA 1TMOA 3GRKA 5JE8A 1TA9A 5A4AA 2WVJA 3MS2A 3SZGA 2EWTA 1JHXA 3BN3A 1KI3A 4CL8A 2NZXA 4PHCA 5EZ6B 2WMDA 3FLAA 2RAFA 4I1SA 2ZIXA 3CNBA 3A6FA 5L3SA 2GK4A 5HRUA 3I83A 4O08A 3LI2A 1PYDA 2QHXA 1V7QA 2OUIA 3H9EO 2JLRA 2G17A 3G0BA 1IPHA 3E5MA 2COEA 2SCUA 4ZCSA 2AW6A 2ZAYA 4K9RA 5T41A 4X44A 3B7PA 1CRLA 1KEUA 2J41A 3MCZA 2HZ7A 3K2EA 4KAAA 1AZWA 4OXKA 1LSOA 4D9FA 5TEVA 3FH0A 4OJMX 4JI2B 2FMKA 4FE3A 4WEOA 2Y3IA 3MG9A 2O3JA 1OILA 1FW6A 3IAM6 3JQGA 1J7KA 3N1UA 2VRCA 5HKAA 4G5FA 2GXQA 1DCFA 2WF7A 1DBVO 2BMJA 3CRZA 4G36A 4ND6A 4DLZA 2OXIA 4MJ7A 2J5BA 1JWAB 2Z2JA 3MBKA 1Z4NA 3GLVA 3W9YA 1CIJA 4RU1A 3COPA 1OZFA 2G1AA 2P2ZA 2VF4X 1W8DA 2IPNA 2VAWA 2Y0DA 3GZJA 4Z9AA 3WLRA 3VR5D 2QSJA 2RGUA 5AI5A 5JEDA 5COAA 1KOFA 1L8LA 3NH9A 3HACA 4JX8A 1QFSA 5TEWA 3OO1A 5CTJA 4LRWA 1FMLA 3K6SA 2XEDA 1QRAA 3CUWA 2I2AA 3DDSA 4BWYA 5DX8A 1EAMA 1HDGO 3MM4A 2Q4EA 5LMCA 3KDSE 1XRRA 4WNIA 3BIJA 4M0FA 1K6EA 5F1YA 3GLFA 4WKBA 4DE5A 5B12A 1KJJA 2CYBA 3B38A 1CIPA 1RTTA 4D45A 5BYBA 4Z4QA 2FJUA 1GGNA 2ZBFA 5DI3A 4U0KA 3PXAA 2GDJA 5CDGA 5FYDA 4F5YA 3FF1A 3PDUA 1XAJA 4H2DA 5L3RA 3TIGA 3DMTA 3QPDA 3I2YX 2JFXA 5DYIA 3LP8A 4BRZA 1MQSA 3M3HA 3HTXA 1G8KA 2KWIA 2WNIA 5AW2A 4Z86A 4GDFA 2GZHA 4ZK6A 1KO5A 2RGGA 1SCBA 2J9GA 2UV8A 4Q3KA 4CIAA 3ZDCA 4MUBA 1ZG3A 3O1LA 4RTRA 5CR9A 2KQUA 4MYCA 1PZFA 4IA8A 3UF0A 2LYKA 1Z6TA 1MA3A 3B13B 4L5IA 1UOPA 4QC2A 1V4NA 1KMIY 2OCKA 1Z25A 2Z43A 4K1LA 4EZBA 3HVKA 2YZMA 2ZWAA 3FPBA 2I6QA 4OXNA 5C81A 3J7AC 2BZSA 3AY7A 2EHJA 4M6WB 1PZEA 2VBFA 1L7PA 4WADA 4BTEA 2I3AA 4C2UA 1QM5A 2X9VA 1QF9A 3RB8A 5TMEA 1BA2A 1VDZA 1MTZA 4LMAA 1K75A 4B47A 1YZGA 3GLKA 4JBLA 3CNQS 4AJ2A 1C8LA 1F3LA 4FVTA 3PRHA 3H5VA 1E3WA 1ZESA 3OA2A 3RRYA 3T94A 4DZRA 1GGVA 3O4IA 4JP5A 1JDNA 3DJYA 3S81A 4O5OA 5BWOA 2VJQA 1MR3F 3P9QA 3QA3E 2RE8A 1T1RA 4OBXA 4L0QA 1V0JA 3PXCX 5AKYA 2C9CA 3BTOA 1NT4A 4G8BA 2GPJA 2YZ2A 2DQSA 4R9SA 1TJYA 4LC0A 3TQSA 1I6MA 1Q95A 4RTJA 1Q0RA 3OZGA 4GM1A 5LDHA 1OT3A 1JYSA 2RK4A 1XEAA 4GDMA 2IXEA 4Q4HB 3WB0A 4C5BA 2OV2A 7ABPA 4ENRA 4AKSA 3CW2A 1S02A 2XVMA 4FT2A 4I4NA 4KQJA 2PUBA 1XP5A 2R6R1 4CKWA 3ZDDA 4KTVE 4GIBA 2PPXA 3WRYA 5IAEA 2J4DA 3L7YA 1C30B 5J4VA 1HUQA 1EP1B 1G20E 1YZKA 3NAQA 2KZ8A 3IB3A 1FTGA 2VKQA 4XYBA 1WSAA 2DUJA 3RI3A 4MVYA 1DIBA 3HPRA 2ZIZA 2OHOA 1Z6XA 2AV6A 2XF8A 3NHAA 4QOGA 5SY4A 3BFJA 3A7EA 3NT4A 3LBAA 2B8WA 4L4RA 2R6GA 5FR2A 4M1ZA 4PPNA 2G5TA 2VWQA 3D6HA 4RGBA 3A11A 4EA6A 5SZJA 1WXXA 2OM2A 3RYFA 1A2OA 3QLTA 3Q3HA 2UZ1B 5KYGA 1AD2A 1K97A 5BVHA 1YZFA 1X86B 4QODA 4A6PA 2XTZA 1L3CA 3ISJA 3QA9A 1ODIA 5FA6A 5T4BA 1SWVA 3QM1A 2C88A 4DE9A 2WMNB 1SOUA 4CFZA 4RTLA 2H0AA 2C54A 2YCLA 4RE6A 3OEEA 5BQPA 5CX1A 3K96A 4QUGA 2DYKA 2J87A 3SYLA 1I2ZA 3WMXA 1H2EA 1XAIA 3LCRA 4TKVB 2Y1EA 3KXIA 3PHLA 4E46A 4YV7A 3VISA 1PG0A 1Z0IA 3FHJA 3TW4A 5I9MA 2XOKD 4ALIA 3WNBA 1IY1A 3PT9A 2I6XA 1YSEA 1FXUA 3SEAA 3VVLA 1TYEB 1GDDA 1GXSA 2O2IA 4KO3S 1NP3A 2NO0A 2VC2B 2WDPA 2X0JA 3HYSA 3JASB 4DEVA 5JS8A 1ILEA 1IHXA 3LD9A 5FJIA 2IUOA 3TQHA 4FQ5A 3GZCA 1F06A 1O5OA 13PKA 2ICTA 1U3VA 1PKEA 2PZFA 2Z3VA 3K9NA 4U02A 3OCVA 3MBOA 4WGFA 1DWUA 1N5IA 2PKWA 4PHGA 7GPBA 4I55F 3PUZA 3IP9A 1GPKA 5KYTA 4CGZA 4PQRA 3EQ6A 5K8LA 4L50A 1I1HA 2NP6A 521PA 3REOA 1DC3A 4B6GA 5CNKA 1XKXA 2YHIB 3CZQA 4RFVA 3ZDYB 2ZIEA 5JYEA 3UJCA 1X6VA 3I28A 1NXVA 1G21B 1ZQ9A 1DO0A 1KGDA 3C7KA 2P1RA 3MUEA 4XVRA 3KQYA 2VP4A 1B8OA 3SDBA 4HFJA 1D0IA 2FPPA 4LE1A 5JG7A 1CXZA 1V41E 1XFAA 3ZV3A 4QFBA 4ZO9A 1Q19A 2ZWPA 2QN6A 3R7FA 3H2GA 3T0GA 2XUJA 3F3KA 3QU5A 3DFIA 3P19A 4BLOA 2DH5A 2Z95A 3EJ6A 2Y66A 1NVXQ 1T15A 1DV1A 3THWA 1R88A 4UNNA 3U3MA 1DBQA 4OK5A 4JP8A 4DXAA 3M34A 3LL4A 2I99A 3MAAC 4HYQA 1I01A 2ARKA 3X3HA 4J3JA 4U5XA 3ZVMA 1Y6RA 2QTWB 2AKEA 3AF5A 2QR5A 2OZLB 4NPCA 5K45A 3KZOA 4G84A 3VU3A 2WMYA 5HG0A 1SVOA 1D2EA 6CHYA 3VNQA 5B1DA 2QY6A 3BM5A 3S99A 1T34A 4BVLA 1KP3A 1FVFA 1L1RA 2C5EA 4Q19A 3LBHA 1DUVG 1KYTA 1MIOB 1NULA 4C4OA 2HV9A 1YS6A 2G88A 2Y1FA 1XKTA 4FGLA 5L9AA 2QTVB 5DCUA 3FMPB 2CLKB 1NUUA 2Q4RA 1TJ3A 2JPDA 3FVRA 1SEPA 1ZH6A 4S24A 2JFBA 5IKOA 3UT5A 1G8GA 2DR3A 2B4QA 6YASA 5K20A 1LFAA 4QBHA 3FJYA 3CH4B 3REQB 1WP9A 4LHEA 4PQEA 2CW5A 5CVTA 2A88A 2B36A 2BZ0A 3DDWA 3WHKA 1C3JA 4OP1A 3G85A 1XRLA 5JCZA 3AHFA 4MI9A 4DR2B 1CC1S 2J7PD 2Q2WA 2HU5A 5IVIA 2EFJA 1E3DA 2CGEA 3DL0A 2OUKA 3OAAD 4ID9A 5E4TA 4JJ6A 1JQDA 2EBHX 4LS3A 2C0QA 1Q0HA 2O2DA 2V5VA 4ZOAA 5LXTA 2C7OA 4XRGA 3AI2A 1U80A 2FEWB 3TDKA 1V35A 3TQTA 3BB3A 2HA6A 3RQIA 3FPHA 3PC2A 4ZI7B 4C4TA 3JQEA 1O54A 4KGDA 4YMWA 3RC1A 1L5KA 3UN1A 4OQNA 3JAWB 1UWLA 3HXLA 3DZ8A 5BUQA 1OXTA 3HEAA 4AROA 3R3XA 4HQLA 1W5FA 1ZD4A 4TT3A 5LA6F 4FFVA 4I5EA 2BSXA 2WU1A 3AILA 1CLEA 1VG8A 3JD0A 3VPGA 3SFTA 1N2SA 1TEVA 4R1LA 1E1YA 5LLSA 4TXHA 1O6FA 1F6DA 3L4BA 1ECBA 3JWIA 3O1JC 2XMPA 4ZT4A 5FOQA 1X77A 1PJQA 3ANTA 4OOFA 4YNBA 4DZTA 4ZKEA 4DV7B 5J5VA 1E99A 1GPJA 1OQAA 2CB9A 2VT2A 2VXOA 2EKQA 2FMFA 4IJKA 1ZCJA 3RAFC 4K86A 2WWHA 3QUTA 3H0EA 5KX5B 3ITDA 1VKNA 3VO2A 4YH1A 5IWCA 3HQ4O 1VMKA 1GFZA 4EKIA 2JAPA 1RQ7A 3F8TA 3ZCSA 2C2OA 2XNKA 5CB8A 1B76A 2EFHB 3VPBA 3ZHCA 2VK8A 4DUYB 5GZ3A 4RK0A 2UUBB 2P9TA 1R5NA 5ALYA 1KTVA 2Y1OA 3L0OA 4DNQA 4IIJA 1GZ5A 1RIFA 2HIAA 2PS9A 2GOYA 1K5DA 2ACVA 2BKEA 2DY1A 3BH6A 4R8SA 5F33A 4Z9BA 3FTEA 1J70A 3NDIA 3ONFA 1NWCA 4TLDA 2I7DA 1NNEA 2WWRA 4C76A 2EXXA 3SF8A 1XNJA 2HA2A 4BLWA 3DZBA 1MPXA 2NV6A 3R4VA 1LV7A 5EEHA 2M6LA 1WQ1R 2GRMA 2Y68A 3MINA 4FMCF 2QPOA 4JLJA 1EFLA 1IHDA 4YRAA 1YTUA 4UW9A 1QH1B 3RNLA 1XTPA 3GGGA 4R2JA 4WOJA 4U9UA 2C2YA 1AK2A 5FNVF 3S7ZA 4F11A 3W5AA 5IC5A 2PMEA 4IJMA 1EDDA 2Q4TA 3EZ7A 1BHQ1 1CF2O 3BL6A 3O4FA 2PO7A 1EDEA 3OMLA 5FWAA 4A4DA 1K08A 1RU3A 2O2ZA 4IDGA 4JLVA 4RWZA 4O02B 4U2BA 4OHVA 5FUWA 3NASA 4KFSA 4B8ZA 1DKNA 2JD0A 2OWEA 4M9UA 2B1QA 2DWUA 4G63A 4B2IA 1JJAA 1QLJA 2QD5A 1RWQA 4WERA 1QVAA 1EAYA 1P72A 1X42A 2P68A 4RNDB 1O4WA 3EXAA 4K9PA 1XN1A 5IPFA 3AOEC 4NV0A 4M2LA 1YS2X 2IL1A 3GDHA 2RDMA 4LQLA 1QC5A 4JI6B 1BE1A 1X3SA 2A9QA 3KKZA 1E7MA 3I9KA 4NBKA 5D1NA 4CMJA 1W75A 5DOVA 4BLUA 1SU4A 3U7FB 2AG8A 4XEUA 5H68A 2OLKA 1L4EA 2CXQA 3IBTA 3DAGA 2J5RA 1F60A 1JXOA 4OI1A 4RKEA 3DG9A 3VOBA 1L7DA 2WW8A 3DE0X 2Z6QA 2FMUA 1X1SA 2ADMA 2WIKA 2ZRGA 1I9CA 3QMVA 4GVLA 5ECYA 5TS2A 3ZR4B 2XXJA 3O8BA 1GU0A 2EHDA 2Y05A 4RVSA 3AWDA 2PAFA 2YCBA 5K3DA 3WKDA 5LQCA 3ILYA 2Q6KA 3MRXA 3STWA 4P4UA 5AVZA 3KETA 1ZZCA 2BDTA 4RYDA 4OX9B 1MJNA 2C04A 2VSNA 3AEKA 3JPWA 5CXUA 1XD2A 4ZK2A 4MVCA 2G09A 1ZSNA 1H2XA 1WHSB 2IEYA 2NYUA 1BFKA 3D3EA 3N39C 3WL7A 4EVQA 1BDIA 3HYNA 3LFPA 3OTHA 4P5DA 2J0SA 1LCDA 1EK6A 4RULA 1L1EA 3QNUA 1HYHA 4ND8B 3RVPA 4DT1B 3HJHA 5ICSA 2XB8A 4L95C 5K8UA 4M7PA 4I1PA 4X6LA 3FDXA 4CMGA 4DV5B 3KTAA 4WN9A 3Q3VA 3BBLA 4LK2A 1OV6A 4P80A 4WA7A 3P0HA 2VDQB 2CWDA 3BIWA 4W7HA 3I9MA 4MYHA 3VDRA 1XNRB 1WHTA 4HI0E 3TGWA 3PS9A 4BMCA 1PSWA 2IUYA 2O3TA 2V3CC 2XOXA 4BFYA 4EA9A 2R11A 1ZVKA 4JEMA 2ZAMA 1XLTA 2PPLA 1PP4A 5FYQA 1IEXA 4P0PB 5BYJA 1L5HB 1O87A 2H51A 3WLFA 5I3ZA 4NNJA 2Q1SA 1IEWA 4KLRA 1G4AE 5ESRA 1SZCA 1XTUA 1U5AA 1BH2A 1YRHA 2VDRB 4LXHA 2RIRA 2ON6A 3GZNA 4Q9NA 4UULA 5TX7A 4YIKA 3INRA 5BVGB 1I7SB 1Z4QA 3IQDB 3DOCA 3RRMA 4ZAWA 3A37A 1WG8A 2VHUA 2B4RO 3I72A 4OLFA 1U0FA 1PJAA 1V26A 2PH3A 3ADDA 5H9WA 3TL6A 2LNMA 3JR3A 4QVIA 3OCXA 4OK6A 5CDSA 1LDYA 4TOIA 2R1UA 5HM6A 1G8PA 1YA8A 2YY7A 1HWYA 4BC1A 4AF7A 4PU3C 4HRXA 1CUFA 2UYYA 3AYZB 4R9UC 2CB0A 1P4GA 1QDEA 1RW4A 1QB8A 1E1QD 4JLBA 1IEQA 4AY5A 1BMDA 2X77A 3GG2A 1CUUA 1Y3AA 3PC8C 1OGYA 4DQUA 4JGIA 4O1MA 4B3HA 3SCFA 3OP4A 4EHBA 3GVXA 2RB4A 5FUVA 1HURA 3G23A 1Q2XA 1YL6A 3K9GA 3L8ZA 1WXEA 3E81A 4EFNA 2BBOA 1H1LB 1CY7A 2QL5A 3H65A 3HN2A 2BHTA 4MB6A 3RABA 2XGJA 3L0YA 4PRLA 4YP1A 4AWAA 3EIEA 4F1WA 2CXHA 5D3MA 1L4YA 2X5NA 5I48A 4M8LA 2FPKA 3DMGA 4YJ2F 3B2QA 3U13A 2JLAA 1L7RA 1RMYA 2RGEA 4BO7A 3PDCA 2D2XA 2BFBB 1LTHR 3IALA 3P9IA 4TMKA 4UZSA 4BNZA 3GLUA 1O8BA 4KKXB 4C7KA 2PN1A 1V8PA 1PBTA 2WSSA 3CT6A 3NXSA 2Q50A 4IJVA 4OH7A 3RVNA 3UGKA 3S2ZA 2ZZNA 1TLTA 2A78A 2RAUA 4ITUA 4MCTA 1PUIA 4KMRA 1IL0A 3OBBA 5CVCA 1GAEO 1RKXA 2OMKA 3CWZA 1E9EA 2GM3A 2ZR8A 4EQ6A 5B1EA 2PXPA 2X15A 2O4AA 2PKXA 1KP2A 4ONEA 3B70A 2YWHA 3IKJA 4PSKA 4BPRA 3PDIA 3HJAA 3E4CA 2X0KA 4FHEA 4Q9DA 4B71A 5K0JA 2JJ1D 4LISA 4NV3A 4BNIA 3DMDA 3ADOA 2W6IA 3DOEA 4J0GA 3SHWA 4PRZA 2QIOA 2JF0A 3BZWA 3MD9A 2DFVA 3LJKA 4HMOA 3LUJA 3FE2A 1NERA 5EMMA 2PKQO 1O97C 5IP5A 3SN6A 1UDBA 3RTBA 3WLSA 3BS3A 2BH2A 4GM0A 1K9VF 4AWBA 4KWCA 8ADHA 2CNWA 1GPLA 2R2AA 4GQIA 2IIQA 3WNZA 4LDNA 4KXXA 3TQOA 1MC8A 5EJMA 2VTBA 3K9LA 1S2OA 2PT9A 1X2EA 4EKNB 5B6JA 1VTKA 1M2VB 2NO4A 4WKOA 3WL8A 5EPUA 3ZLUA 1VPLA 4QG3A 3H8VA 1XRJA 3VYWA 4YJFB 5CB4F 1V8ZA 5DP2A 1C2YA 1LWNA 4YR9A 4K8OA 1H8HD 3CF4G 5JSYA 4BFVA 4D3ZA 2AXPA 2BJWA 1BGXT 1BDMA 2FSVC 1J4AA 2OLJA 3GPDG 1NYQA 1DHTA 3OZ7A 1ZI9A 2NZ8A 1SUCA 3QKRB 3MJDA 2AN3A 3RBVA 3SDZA 2AMYA 1HEUA 3BQNB 4R98A 4YRIA 4CTJA 3FPKA 4MHTA 4U7GA 2FB9A 4JN6B 1IN6A 1HKUA 1TK9A 3N8IA 4U2DA 5AVKA 5CITA 4PLHA 1UJ2A 2QNBA 2PL9A 3MEQA 3AF4A 3DHWC 3QIAA 4JB8A 2PS3A 4OHWA 1E9DA 4OV6B 4MO9A 5HQ3B 1JG7A 4C7MA 2AD5A 3HJBA 1GQYA 1IXKA 1RI5A 4G1EB 2D3TA 3BMQB 2FR1A 1OX6A 3KKMA 4KBYA 1K1EA 2F6RA 1UM9A 1ZOPA 1Z83A 2FWBA 3FSGA 4GR9A 4O2AB 3UK7A 1F9EA 1XZPA 1FK8A 3VH2A 3AHEA 3GEEA 4OEHA 1T43A 1BYIA 3ZHOA 4QOIA 3C48A 2C58A 2J0VA 4M38A 3M2TA 5JAIA 4O4JB 4C4XA 4MVWA 3NKVA 4E31A 2Q1WA 3ENNA 2TRSB 2I2XB 1UH5A 1KDYA 3PENA 2JC3A 1O96A 1WXGA 4G0YA 1J21A 1OASA 3KPJA 5KOHB 2ZT7A 1HEIA 1F6WA 2CVFA 4UNIA 1BJRE 4L1KA 3ILSA 2JIPA 3AI1A 3JX9A 4G86A 4JSYA 2HNAA 5B7QA 4BKMA 1C0LA 1NXWA 1O2DA 2ZSBA 4KXMA 3A9RA 3VH1A 5C5IA 2X58A 1TCBA 3M1AA 5CA1F 5L45A 3GN2A 3D3KA 2YL2A 1H2AS 2O2EA 3HKCB 5FPQA 3IDZA 1ZR4A 1GTJ1 2ZBUA 2IU7A 3R1IA 4A23A 2EAUA 3T3PB 4W5WA 1QV7A 3JSXA 1LCCA 1TAGA 4TV9B 5JQGA 5BNWA 3DFZA 4FLMA 4GMGA 4CR7A 1JG3A 3IOYA 3JRXA 3NNNA 3W8NA 3RRFA 3L77A 3GCDA 1YI0A 4WOBA 5IKMA 1QU2A 2XT6A 2HN9A 2JBAB 5C8XA 2UVPA 3NC1C 5AVYA 1S2GA 2YBDA 1M8FA 3KXAA 2BDUA 2HXYA 1D0VA 3IV7A 3DO8A 4J0CA 4I8IA 3TOXA 3MJVA 2J9YB 2BEUA 3KZ3A 1HT2E 1MB9A 1XELA 2AI3A 3GZDC 5AQ1A 3DPIA 4NE9A 2G28A 2WKSA 4RH3A 4DXHA 4Z51A 1QVWA 1JSZA 1OKKD 2XSZD 2HSEA 3JWEA 4BO8A 1PJCA 1Z28A 2VN8A 3G59A 1RP1A 3H05A 3LQKA 4FZVA 2B34A 4UAJA 5F5NA 4CDGA 4B74A 2UUPA 2LYPA 2EZUA 2HADA 2OAP1 1II8B 2JKVA 3DOIA 4J1SA 4Q01A 2V3WA 5CAEB 4PW0A 3FOEC 4J16A 4UBMA 1YE3A 5K0GA 1VKZA 3EZFA 4PM4A 2J67A 2R1TB 2VUUA 3MWEA 4QULA 5DPMA 5E7IA 3MMNA 1TU4A 1TF2A 3H2SA 3NBXX 4X1YB 3LLUA 2FUG6 2H1LA 2OFOA 3EC1A 1TJPB 1RKVA 3AF2A 4M1TA 1A82A 1JAIA 4XGKA 5CP8A 5TB5A 3ENWA 1ZN7A 2JDIA 2Y6VA 2I4RA 2F43A 1K06A 3D7NA 2X0DA 4YCAA 2G6TA 1T36A 4H60A 4HUQA 4BNDB 3WWOA 4CODB 3V2GA 4DBZA 1E3IA 1JVBA 1MVLA 1I13A 3D3WB 3R3JA 4Q4LA 5D85A 5JOQA 2ZRPA 5JAMA 1APBA 3B3AA 3BDAA 3ER9A 4NZ9A 1MENA 4WWHA 2O4UX 4R84A 1G64A 3WDMA 4R1QA 4MZXA 4R7ZA 2DWQA 3IYLW 1TO6A 3OIUA 3PXDA 3QSYA 1Z5ZA 1L7BA 2GK6A 4EFLA 5HCIA 1K8RA 1MQ9A 1XQ1A 2XIJA 1XWFA 3GJRA 3EAFA 1WMBA 5CYOA 3VVCA 4BTVA 4X4EA 1JBKA 2VDJA 3ZHIA 2Q9AA 3MPUA 1EE9A 1A8UA 3OIYA 3WRVA 2AF3C 2W71A 2KEIA 4R8VA 3KJGA 4U63A 1Z4PX 4JQDA 2PZGA 3B1JA 3TS1A 3BG5A 2D1RA 4EY6A 3P4XA 2M6SA 2D0IA 2QPLA 1HZZA 5D51S 4DC0A 5I5EA 1VYVA 4RE5A 5DX1A 2IBMA 3QY9A 4L8YA 1EK0A 1CR2A 3C8UA 3E61A 4X85A 4LRYA 1LGYA 1TMGE 5FFNA 4YV0A 1DC6A 5E1MA 1PG5A 5CIYA 2DUUA 3AEUA 4MITA 4MR8A 1CDZA 2E85A 5AJTA 3QKSA 3VSAA 1GCAA 2G4VA 1QBKC 1WEKA 2UZIR 1BNCA 4BHTA 3OP1A 2BHNA 5ARDA 3RC9A 4WL0A 3BGSA 2NPIA 3R6WA 5A9SB 3VR5A 1JKFA 1H0RA 2AOUB 3VJRA 1JPUA 1KYWA 1J2JA 1UJ4A 4P38A 1VG1A 3CE6A 2FH5B 3FHOA 3KLPX 3CLSC 3GMIA 4YJ3A 3RV3A 1KEEA 2FW9A 1YWGO 4ZPXA 4C5CA 1E0AA 2R751 2FX3A 2NU7A 1V3VA 1BKYA 3DL2A 2WTNA 4INAA 4J7AA 3N7AA 3DHNA 1NF3A 5KQLA 5HJ5A 4JSRA 3C70A 4GKKB 4NE2A 1A9XA 1KEPA 1YBHA 2V0NA 4LPKA 4E11A 4KRYA 5D6OA 4M55A 2CNNA 4IFBA 2H1OA 5FOSA 3U1VA 2HT1A 4PEVA 4G07A 2CT8A 1GWNA 1GCOA 2YMQA 3AVQA 2E5FA 3BFKA 4WW0A 3PR2B 5CDUA 3KQKA 1W46A 4GWGA 4KGVA 4NFSA 4BB9A 4QHSA 2LRHA 3VOAA 1MT0A 3T7CA 1Z3CA 2Q2OA 1LPAB 1QS0B 4TS9A 1SXGA 4XLZA 4YAOA 2IYXA 4FYVA 2NXCA 1JA0A 1NN5A 5EIFA 1NW4A 5LC1A 3SYRA 1QGDA 2XA9A 2VDVE 2ZWOA 4I4TA 4MUJA 4AY6A 3K92A 4PNEA 1F4VA 2PRZA 3FM9A 4IEEA 1KF0A 1C9NA 3E70C 4R40A 5FNVB 1BIFA 3OEYA 4CKZA 3GDGA 3FOZA 1VPTA 2ZYVX 4KMOA 2CYCA 1WEHA 3BYZA 4WACA 3IUMA 1E7QA 1U11A 3DVAA 1M74A 3P26A 3LECA 2JANA 2QP4A 3FBTA 3IEXA 8ATCA 4MVJF 1SHZA 2ZM6B 3JQCA 3ID6C 4MEJA 5CT6A 2BPOA 1N9GA 5KYYB 2OXRA 2PUGA 3I5MA 4G97A 2FZEA 2HO4A 4IJQA 3HYLA 2P67A 3MMXA 5DN6A 3W7BA 4BFLA 4E08A 4CL0A 1D5WA 1FC0A 2WVGA 1ZXLA 3ZE2B 1EGMB 2PUAA 4JL5A 4WCVA 2SNIE 3PFKA 1PFVA 2AMFA 4IOKA 4ZI5A 1JJ7A 1GZSA 2FPGA 4DJAA 3JY6A 1UKCA 2F3QA 5ICFA 4WKGA 4XR9A 4WN3A 2OD7A 1FJHA 5K3BA 3UMFA 4US2R 3EPRA 1T6BY 3VPSA 2HHJA 4MV5A 1EWRA 1RWXA 1E79D 2B5VA 3HKBA 1WD7A 1EDBA 4DM4A 3D4BA 4BQEA 1CUWA 2R1VA 1KEKA 1X2BA 4IQFA 1MF7A 4J4TA 2P35A 1PEDA 1DX6A 1W85A 3M89A 1G4UR 4KCGA 1RSZA 3AX6A 1LLUA 1Y5NA 3PL1A 5J1TB 2QMQA 2RCNA 5AW1A 3A1CA 4AG3A 2JGFA 1XZIA 2Z98A 4K6FA 1TRHA 5F98A 2OFYA 4NZPA 5IYZA 3A3OA 2BEWB 3KEOA 3V1KA 1G5RA 1JDZA 3UXYA 3I4FA 3U4AA 2AFHE 1ZHHA 4RPLA 1AXEA 2B8NA 1KP9A 3KVVA 4Y2HA 4C88A 2B2XA 4DUGA 5LYJF 2XGSA 1M2OA 4DLVA 3DSRA 5I7SA 4UOEA 4Q3EA 4CMBA 3S2YA 3WY9A 1R0XA 2WZDA 4EG0A 1JB9A 2Z8XA 3NIFB 3V34A 3ZIUA 1Z5WA 3TX6A 3WHPA 5CB4A 2OD2A 3DP7A 4HZIA 3HDTA 4JLMA 4QRDA 3DVLA 1YVPA 4GUDA 3GRZA 4BXOB 2YIDA 3D7RA 3UFXB 4BO1A 2OZKA 2J45A 2C57A 1TAHA 2IH2A 4XM2A 3KQVA 2PKQP 4YWHA 1C1XA 1RHUA 2JFFA 4HXYA 3VO8A 1HX7A 3DFFA 2ONYA 3DBVO 5LA6B 2ERXA 4A8JB 5IVHA 3LKDA 3LLVA 3S0JA 4KMMA 4QEKA 1DRUA 3NZEA 3TTXA 1T9ZA 1S89A 3D8NA 4K28A 4XQCA 1FFGA 3M9LA 4B33A 2C03A 4U7JA 1P6QA 3IQGX 4G0NA 1HYEA 4GLFA 4GZ3A 4C4RA 1S4MA 2JHCA 3LKZA 4YBRA 2Y2VA 4D3XA 4I6TA 4FD2A 2LTAA 3NI2A 1UFKA 1TADA 2L0XA 2OP1A 4R1SA 2D00A 5T5QA 5KTMA 5IAAA 4GF5A 2HRCA 1ZHFA 4DMCA 1FS5A 1ZGZA 1WLSA 2FOIA 1QCDA 4S05A 2DG2A 1AV7A 1AM4D 4REMA 5DCWA 5EWJA 2WPDD 4RSMA 2Q6OA 4XB2A 3RUHA 3DC7A 4CM7A 3RSQA 3GRPA 2JGLA 2ZJBA 2Y0PA 4HTFA 4DG8A 3OPNA 4ZZIA 5IWAB 5CA0B 4KP7A 4PQFA 1D6SA 4FWBA 5IM4F 1EX6A 1AOXA 1HOTA 2QX7A 4MWZA 3QBDA 4N8EA 2XBLA 4DF3A 4GRIA 1N6NA 4JLOA 4BZQA 1SK8A 1MDFA 2I22A 3Q0TA 5LIRA 3A2LA 2IYRA 3OTIA 1WB9A 3O0DA 3E9NA 5TVGA 5JWRA 2ENUA 1Y7TA 4MGIR 2PTGA 1JHYA 3IURA 1WDTA 3L4EA 4IJ6A 2GBCA 5ILGA 1RJGA 2V96A 4FMCB 4A8PA 3U9TA 1KBZA 1NRWA 1TZBA 3A9WA 1EP2B 1AQYA 3U2QA 4D79A