2PUOB

Crystal srtucture of the nem modified ferredoxin:thioredoxin reductase
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
73
structure length
73
Chain Sequence
MNVGDRVRVTSSVVVYHHPEHKKTAFDLQGMEGEVAAVLTEWQGRPISANLPVLVKFEQRFKAHFRPDEVTLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-thioredoxin reductase, catalytic chain
publication title Structural snapshots along the reaction pathway of ferredoxin-thioredoxin reductase.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Electron transport
total genus 11
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02941 FeThRed_A Ferredoxin thioredoxin reductase variable alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2puoB00
4RKUE 2PU9B 3VYGA 2ZPEB 3X20B 4ZGDB 3A8LB 4L6V5 1UGRB 3QXEB 4ZGJB 3QYHB 3X28B 4Y28E 2DD4A 4OB1B 2AHJB 1GXIE 2PVDB 2ZPFB 4OB2B 3WVEB 1UGQB 4OB3B 2PVOB 4XK8E 1V29B 2CYZB 1AHJB 1QP3A 2DD5A 2ZZDA 2ZPHB 3WVDB 3QYGB 2WSFE 3LW5E 3HHTB 2CZ1B 1PSFA 1UGSB 1DJ7B 1JB0E 4OB0B 2CZ6B 2DXCA 5L8RE 3QZ5B 2QDYB 2PVGB 3QZ9B 2CZ0B 2WSEE 2CZ7B 3X25B 1PSEA 1QP2A 3X26B 2PUKB 2ZCFB 2PUOB 2ZPIB 2DPPB 3X24B 2D0QB 3A8OB 2ZPBB 2WSCE 3A8HB 4FM4B 1UGPB 2ZPGB 3A8MB 2O01E 3A8GB 4ZGEB 4KT0E 3VYHB 1IREB 2DXBA
chains in the Genus database with same CATH superfamily
2JN0A 3JB9D 4XU0A 1JXOA 4OVAA 3V8JA 4C92C 1I4K1 3FEOA 2K6DA 1IRXA 4PJOD 4C92F 3OS1A 3JCMW 2A0FB 1OX9A 4E6RA 3MKDA 4F7UE 4ZGJB 1QKXA 1GBQA 4JS5A 2K3BA 3JCMg 1SHFA 1S1NA 4L5GA 4OMMA 2MK5A 2RM4A 1G3SA 1TUDA 1RAGB 2OTLQ 1K8AU 1UEBA 3MP1A 1M8VA 2IPOB 1W4SA 4FSXA 4E7IA 2SRCA 3MEUA 3M55A 1QKWA 1D1CA 4M7DC 5FRMA 2HBWA 3OYHA 3V8LA 1BK2A 2JOYA 1PRMC 4M7DF 2DBMA 1KQ2A 2CREA 1AZGB 3CBPA 1VQMQ 2QA4Q 3TREA 1WJQA 1T3SA 1FMKA 1LJOA 2RF0A 4R0KA 3WXMB 1HD3A 2XU8A 1TXQA 1VYUA 1SG5A 1QCFA 4J6XA 4LDVA 3QO3A 3CQTA 1GRIA 4M78E 5A0DA 3JB9G 2DL8A 1S72T 4M75B 3H0FA 2V8KA 5J39A 1Q86C 3CCLA 4C92D 2OTLT 1VQ4A 3NGPA 2E6ZA 3CMEA 4KGVB 3EG1A 2DRKA 3MP8A 5GAOm 4QKUA 1LCKA 2ZPBB 5CKDA 2E64A 3G4SA 2A08A 3M59A 1ARKA 1B34B 1V76A 4FM4B 2EBPA 2DJQA 4KUDK 1ZBXA 2PQWA 1N9RA 1OV3A 2QA4T 1OI1A 3VYHB 1BI2A 3QSUA 5FU7C 2CP3A 1D3BA 1ZUUA 3PIOA 4IIMA 2R5MA 2G6FX 1Y71A 2CP5A 3SWNB 1D1AA 2LDMA 3M5AA 5GAN7 2OTJA 3JB9I 5CR2A 2YXYA 2EWNA 1NEGA 4FYXB 1ZSZC 4XU3A 4M7AC 3PE0A 2X4XA 4PLIA 2AHJB 4M78C 1YJ9T 2L3SA 3JCMc 4M7AF 2Z0WA 3VRYA 4E7KA 2DEUA 4QQ6A 2QQBA 2J6KA 3VS2A 5KYUB 2EQKA 1QMCA 2F2XA 1K73C 2OI3A 2L89A 2EAYA 3RNJA 3H8ZA 3M0UA 2DL5A 1UDLA 3TQ7P 4C92G 2ZPHB 2COWA 1SPKA 4P5NA 3OB9A 6AT1B 3JCMe 2CDTA 4JRPA 2EIFA 1H8KA 4Z02A 2CZ1B 3JCMf 3OS5A 4Z89A 4FYVB 2YRVA 5I22A 2B86A 3GPLA 2KRNA 4IUQA 2PVGB 1YNZA 2DFUA 2LX7A 3TSWA 2QDLA 2COZA 1G5VA 3JSCA 3LYIA 2XDPA 2CT4A 1YCSB 1LPLA 1I1JA 4B9XA 1WX6A 5EC7A 1KHCA 4R56A 5FROA 2DYBA 1Z9QA 2RNAA 5IHNA 2MPXC 4J7FA 1W6XA 1S72A 2DRMA 2HMAA 1KC8R 1HYOA 3OYCA 3G6ET 1P92A 3MEVA 2LMJA 1KQSA 3L1AA 1SHGA 1X6BA 2A37A 4M78D 2OTLA 3CXCP 2IVWA 5CKBA 2DJZA 3URGA 2QTVA 2M51A 1GFDA 1KJWA 3A98A 4ZGDB 1ZX6A 1HXDA 4RCBA 4F7UG 4FIBA 2IIMA 5I2MA 2FZGB 1VQMA 2QA4A 1QVFS 1RADB 3M0TA 1G3TA 1PWTA 1WHHA 2FB7A 4C0ZA 3DB4A 1MHNA 4OMLA 2HQHA 1VA7A 2J06A 2A28A 1MMGA 4RTXA 2Y90A 2QEXT 3P8DA 4EMKB 1ZBJA 1G3YA 3RMQA 1BCOA 3V7RA 3PTAA 5CKHA 1UG1A 2MCNA 2JT4A 4BE0A 3FRNA 2O4XA 3VRZA 1EIFA 1TTHB 1QVGS 2X4WA 2CT3A 1J3TA 2RHIA 3EAEA 2FRYA 5M9OA 4A4EA 2JMCA 3LW5E 2LQKA 3UPUA 3HHTB 2LT4A 5KYXA 4J9GA 2E70A 3GBQA 3C94A 3M54A 4M7AG 1ZA1B 4M78G 4C5EA 1WDXA 2RHXA 4RTYA 1OZ3A 4PJOA 1NBEB 2CP2A 2OAUA 2QAZA 5ECAA 2GFAA 3M0RA 2OAWA 3QDFA 1I5OB 1YBYA 1NM7A 3S3OA 3EGXB 1K8AC 2L2PA 1PC0A 2J6FA 2RK2A 4OMNA 3A8HB 1M90R 2LX9A 1GBRA 3OSSC 4PJJA 1GCQA 2H3JA 2VVKA 2KR3A 5GANf 1M5Q1 4HCZA 4PNOA 3JAME 3CCUQ 1JO8A 1X6GA 2DZCA 4HCKA 3C95A 2F2VA 3RDVA 3G6EA 1WXTA 1UTIA 3HKSA 1KC8U 3OYFA 3QPHA 1FWZA 2KEAA 5KCOA 2DD4A 3EG0A 4DEXA 2YWWA 1JQQA 1WYXA 4JRKA 3M0PA 1K0XA 2LNVA 1UJYA 3M0SA 4IUUA 2HQXA 1WIEA 2EGAA 5IHKA 1YJWQ 1Q82U 5J3BA 5A0GA 5I2SA 3WVEB 3JCMV 1NEBA 4C5HA 3JCMb 1YP5A 4M77E 1Y96A 3AHUA 1O9SA 2QGGA 2CYZB 4X9CA 4E7SA 1RAEB 3OW2S 1VQNT 5AT1B 1KK7A 2QEXA 1VQ5T 1MNDA 4HA8A 1U8RA 2BZ8A 2DETA 1Q7YR 2CP0A 2RO0A 3MPUB 2DL3A 1VQ9T 3CC4Q 1RABB 3CCUT 1GCPA 1WJSA 2R57A 3E9FA 2GQVA 3VUBA 4AG1C 2EW3A 2K5LA 2A3LA 3H41A 4PLLA 5D7UA 5C0MA 2KGTA 1D0ZA 3M56A 1GFCA 3RESA 4RG2A 2RH2A 2CP7A 3G71Q 1YJWT 1E6HA 4BY6B 2FZKB 1WA7A 4C8QB 2RN8A 4E47A 4NS5A 4CC3A 4PFZA 2I2LA 2QQ9A 4ZGEB 2D8JA 4JZ3A 2RQVA 1VIFA 4KGZB 4KGXB 2ROLA 4JLGA 4OMQA 2XDDA 4L6V5 4PFPA 1PHTA 4LDYA 1VQ8Q 4R55A 3CC4T 1M90U 2VC8A 3C4SA 3EG9A 4DA4A 4FYWB 1YITQ 2NUTB 4OF1A 1X43A 2EYZA 1OU9A 2DIQA 2CS7A 2RMOA 1R77A 2V1QA 3JCMh 1AD5A 1U1TA 2JXBA 3CCQQ 3EGDA 3VKIA 2MI6A 3G71T 4OB3B 3CC2Q 3RKWA 4PJLA 2EQUA 3N5BB 1VQOQ 2KQWA 2XD0A 3MJXA 4A4HA 1BIAA 2DIGA 1GL5A 3AT1B 4WTOB 1KQ1A 4RTTA 3PGGA 3JB9F 4PJOC 2HD0A 2K3XA 4Z88A 3INZA 1M2VB 4PJOF 2K2MA 2VXEA 3CC7Q 2F5TX 2DVJA 3OYJA 3G7ZA 1WZOA 1VQ8T 4M77D 3CPFA 2KYBA 1YITT 2F2WA 5GAN3 3CPWS 1VUBA 1VQ9A 3M0QA 2MIOA 3CCUA 2OX7A 3M57A 2JMAA 1WXUA 1Q7YU 2YHTA 1VQ4T 2P84A 2YDLA 4J9HA 1GCQC 5GJWB 3LWIA 5KYYB 4LE9A 1NG2A 1ZHIA 3CMAT 2HSEB 1Q81R 4C0DB 2LNHB 1VQKT 3A1PA 1I0CA 2JM9A 1TUGB 4F16A 3CCMQ 2A36A 2B8AA 1YJWA 4C0FA 3V8KA 2YSQA 2AKLA 2X35A 2LTOA 2HEQA 1D1BA 3JCMX 5CKFA 4CI0C 2KXDA 4A63B 4A4KA 4NL3A 3VJPA 4UC4A 3QUIA 2X51A 4XTXA 1GXIE 3D7SB 3DKMA 1M3AA 3EHRA 1M9SA 2L3RA 1H3HA 4MZMA 1PRLC 2CP6A 1KSWA 4CC7A 4PJNA 3CC4A 2E3HA 7AT1B 3JCMd 2GBQA 4KBMB 3OYIA 5GAN4 4BI8B 4JJNK 1QVPA 2JNGA 3OYGA 5HCKA 1PKTA 2W10A 3MO8A 4F14A 3CEYA 3CD6Q 1EX4A 1TG0A 2VV5A 5CIUA 3S3MA 3G71A 2D6FA 3I55Q 1QCOA 3RMSA 4JZ4A 1ZUKA 2GF7A 5IXFA 2ROTA 2CH4A 3RKYA 4LUDA 1H92A 1M27C 1NLPC 2CZ7B 3NPFA 3F70A 3FC3A 2LT1A 1KC8C 5CO7A 3ZFJA 1N5ZA 1SKUB 1WNLA 3X24B 1WHLA 5FW9A 1VQ8A 3GIBA 1CKBA 2HQEA 1YITA 2MAMA 2EPDA 1BI3A 4HVWA 1UHFA 1M1GA 3A8MB 3FB9A 1KQSS 1Q82C 1XOVA 3PVQA 1HSQA 2DXCA 1TOVA 1IREB 4F7UF 4PJOG 3PMTA 1AT1B 4RKUE 2PU9B 3PFSA 2ED1A 1N8RR 2RI5A 4X1VA 3CCQA 4LDUA 2BE7D 1CSKA 4RTUA 1QWEA 3CBOA 2HDAA 2YLBA 3CMAA 1SF9A 4QVZA 3ME9A 1T3LA 2RD1A 1VQKA 1C6VX 1Q81U 1WGSA 1U06A 1JJ2S 2KRSA 4OB1B 1YFNA 1VQMT 1BCMA 2E4HA 3P8BB 1UJ0A 2L5QA 3FJ5A 4KULA 1WI7A 2O31A 3CCEQ 4OB2B 3FIFA 4RMOA 3CC7A 5IAYA 2VGMA 2IG0A 1JU5C 4XK8E 4C92B 3E2UA 1QP3A 1ZQ1A 5LJ5g 1SSFA 1MUZA 1QW1A 5LJ5j 2KDSA 1W2BS 1E6GA 1VOMA 4M78F 1G2BA 1PSFA 1V1CA 4QQDA 4ANJA 3QZ9B 3M53A 2LCLA 1IZ6A 2O2OA 8ATCB 1I81A 4DBFA 4M7DB 3TSZA 1Y0MA 4ME7A 1WQWA 2RJEA 1VQLQ 2D8HA 1I8FA 3BY7A 3R6NA 4IUVA 5GAMg 3QIIA 4J9DA 1M90C 5GAMj 2DTIA 2XK0A 4AFQC 5I11A 1YI2Q 3CCET 2ATCB 2BIVA 1ACMB 1M1KR 2QG9B 2WSCE 3NTKA 5GANg 1M30A 4J9CA 1UGPB 3J81E 5GANj 1OZ2A 1U1SA 3CXCA 2AIRB 3HRTA 4OP0A 1UHCA 3H0IA 1T0JA 3QJYA 5GMKj 1MMNA 2JUFA 5IN1A 4F7UB 3E9GA 3NMZC 4IIOA 1RI9A 2DA9A 5KYWB 2QGFB 1PD0A 4MDWA 4Y28E 1I5LA 4N0AA 2P0PA 1EZZB 1M4ZA 3QWXX 4BI4A 4BDYA 1FX7A 3CD6A 1Z9ZA 2LQWA 2MMPA 2PVDB 1VQLT 2KE9A 1N8RU 3REAB 3MHXA 2EVRA 4M77A 1KD1R 5IHIA 2DMOA 2RHUA 5FU7B 1YI2T 4LUEA 3GLXA 2X4JA 3EFOA 1RLQC 3VS3A 1Q7YC 4A4FA 4AFZC 2DL4A 2WSFE 4X34A 4JPBW 4N4GA 1ZSZB 4NOYA 4M7AB 1D0YA 2K79A 4BDZA 2KK4A 4E7LA 2RQWA 1K0SA 4M78B 1Q86R 1NJIR 1WXBA 1RAAB 1SRLA 2V26A 2CZ0B 4MZTA 1PKSA 1YIJQ 5FWBA 2LJ3A 5FU6C 1OOTA 2FO0A 4C8QE 2M0OA 2PTKA 2EFIA 3PNWC 3L2WA 4BUGA 3HSBA 4E7HA 1MGQA 4GY5A 1R8OB 1X01A 5LJ5e 1NE8A 1LOJA 2D0QB 1IGUA 2DBKA 2KY9A 5LJ5f 2C0OA 1QLYA 4IKFA 5D6XA 3LWHA 2VWFA 2GCXA 1VQ6Q 2DTHA 4XTUA 1H3ZA 3A8GB 4J7IA 4DOWA 4FW1A 4J9BA 3T9NA 4QW2A 1F1BB 4HT9A 3CCEA 2QQRA 4O6JA 4Y91A 2FHDA 3QBYA 4FYYB 5GAMe 2NUPB 1M1KU 2JTMA 2R5AA 2RJCA 3QYHB 4CC2A 2HSPA 5GAMf 1XNIA 4GLKA 4E7JA 1MV3A 3ZL7C 2KSSA 2M9UA 2ESWA 3NFCA 5GANe 3L2UA 1YIJT 1IB8A 1UECA 2V8JA 5LJ3g 3O8VA 5J26A 5GAN2 5LJ3j 2ZGWA 2J05A 4N4HA 5GMKe 1VQ7Q 2JW4A 2CGHA 1UGQB 1X75C 4HKEA 2E3IA 2RA2A 3VS4A 4Y92A 1TSFA 2MOXA 4JJDA 1QWFA 4M75A 3CCJQ 2EYXA 2ZZDA 1VQLA 5CQXA 5CQYA 1VYTA 4FSSA 4DBQA 4LDWA 1FMVA 3I9QA 3M58A 2RQUA 2M02A 3BE3A 1W1FA 1YI2A 1KD1U 3QZ5B 2QDYB 2ENMA 1K1ZA 1B34A 1NPRA 3PVLA 2BTTA 2O88A 2SEMA 2EYYA 1PSEA 4XTYA 1BB9A 2NWMA 5EG2A 3VS7A 1PG5B 3L2RA 2VASA 4Z8AA 1K76A 3JCMQ 1Q81C 2E65A 1QQJA 4ZNXA 1NJIU 3BW1A 3SWNA 3ER0A 2GGRA 2EGCA 1OPKA 3HFNA 1MNEA 1VQ7T 1RUWA 2XI9A 4AFSC 4KH1B 1AWJA 2CSIA 5DLQE 4ZTJA 1PCXA 4KH0B 3CCJT 2KT8A 4C8QD 2PNIA 4MDXA 2LJ0A 3VS5A 1BU1A 5KYUA 4N0AC 4JS4A 1YHQQ 2CKKA 1UGRB 4Q5WA 3QXEB 2JS2A 4A4GA 1QVFP 4M7DA 2NYSA 2W0ZA 1YCYA 4M77C 2HZYA 2DZ9A 3EFSA 1R0BG 4M77F 3QDRB 3ZEHA 3BFMA 3VU3C 4B6MA 4RG8A 1D3BB 3OS2A 5IT9E 1UE9A 3NHNA 3EH1A 4ATOA 3TCJA 1QCNA 2LC4A 5FRNA 5GAN8 4OMFB 5KH6A 1YJNQ 4XTVA 1QVGP 1BKBA 1YIJA 5GAOr 3EFRA 2DM1A 1N9SA 3HRSA 2DO3A 8AT1B 1M1FA 5KYNA 1KFZA 4J8OA 4XTZA 4M4ZA 1B07A 5HK0A 1NYGA 2F69A 3V7CA 1KIKA 1K9MR 2LP5A 5LJ3e 5KYWA 2DXUA 2V1RA 1N27A 5LJ3f 2LVMA 1Y57A 2DE0X 2H3EB 4C8QG 2G3RA 4X9DA 9ATCB 1QP2A 1XQHA 5GAOp 4HT8A 3L2ZA 4M75E 3CMEQ 2CUDA 1KHIA 2X4YA 5CCAA 2FPDA 1CKAA 4XU2A 3OMCA 4EIKA 1JBMA 3P8HA 1WHMA 1YJNT 2YRDA 1N8RC 3RERA 2DERA 2RI2A 3OYLA 2P4TA 1PNJA 4EPCA 2RQRA 1OPLA 1ZA2B 5KCHA 2ZPEB 1VQPQ 4J83A 4EMKA 2LZ6B 3EG3A 1VQ7A 1RL2A 4AFUC 1C0MA 5CKEA 4BD3A 1XTDA 1D09B 3V7SA 3CCQT 3CCJA 3CC2T 2LRQA 2YLCA 3JCMJ 1OX8A 4C92E 4NL2A 1VQOT 2C06A 2YUPA 3DLLA 4RTVA 2K5FA 5GMKl 3UA6A 4M75C 4RUGA 2F5KA 2FL7A 2VYTA 4FL6A 2E10A 2P0QA 1V29B 2H8HA 1N6AA 2KRMA 4LN2A 3OW2P 3CC7T 2QQAA 4JJBA 2FYKA 3OYBA 1LVKA 1IO6A 1K9AA 3DB3A 4M7DE 4ZTFA 3QG1A 5IH2A 2MYSA 1DJ7B 4BI3A 2RK1A 1VQPT 3EGXA 1RAHB 3BDLA 5LJ5h 2NUZA 4KUIA 2FPEA 4M77G 3OSVA 3OBWA 2AKKA 2O4XB 2WSEE 3CBMA 3CCSQ 1WJRA 4AT1B 1I07A 3SWNC 1M1KC 5LL6S 1HJDA 2ZCFB 2FRWA 2Y4YA 1X27A 3JCMP 1TH7A 4KRTA 5CK9A 3LGFA 1YHQA 5KYXB 3HRUA 3CCMT 1PM3A 1K9MU 4ZN1A 2L8DA 3QJ6A 1WFWA 2I0NA 1S72Q 2XG8D 4BB7A 4IUPA 2J6OA 4DBHA 5GAMh 1X2KA 3CCVQ 3GF5A 3NTIA 3HP9A 3OY9A 2DK3A 4PJOB 3META 3G1JA 3SD4A 2EKOA 3CXCS 1MMAA 2HAXA 4JRIA 2KT1A 5GANh 3OYEA 4M75D 2XHCA 3SDZA 3EH2A 3GNGA 3X20B 3I56Q 2X3WD 3JV3A 1YJNA 2K9GA 4EMGA 1WHKA 1X6OA 4WCIA 5GMKh 1JEGA 3FLGA 1M2OA 3A5ZB 2DNUA 2CH4W 3KXTA 3OYAA 4D8DA 3CCRQ 1KD1C 3CCST 3EGUA 1H641 1NPPA 3MEWA 2QYZA 3DLMA 1ABQA 3SHWA 3H9NA 3CD6T 5FLXE 4B9WA 4IUTA 2XKOC 3I35A 3CC2A 4M7AE 2PVOB 3I55T 1YJ9Q 1SRMA 1VQOA 2DXTA 4XTWA 4GBQA 4CC4B 3CCVT 1BI0A 1XJWB 3CPWA 2AK5A 1NJIC 1JXMA 4FCYA 1YN8A 4HXJA 2GQIA 4RCCA 3HL8A 3SEMA 5A2QE 4ZN3A 2M16A 2EQJA 3I56T 4ELYC 2CUBA 2DAQA 1U5SA 1AWXA 2JTEA 2P4RA 4ORZA 1NLOC 4C8QA 2P0KA 5LJ5d 1Y96B 4J9FA 3QKJA 1E7OA 2DLPA 3CPWP 2AZVA 1ZUYA 4M75G 1M3CA 3VS0A 2NLUA 3CCRT 2ZPIB 3QHSA 5CVIA 1VQPA 2HKNA 4M7DD 3I5RA 1RAIB 1YWPA 3A8OB 5GAOq 1G3WA 1OEBA 1C1AA 1ZSGA 1M3BA 5GMKi 5GAOn 3HTRA 2NUTA 1OQKA 5GAMd 4EMKC 4PJMA 2JJ9A 3LH0A 3TVTA 3PT9A 1RAFB 2AT1B 2L3PA 3CCMA 1TUCA 2WACA 5GMKm 2QK0A 4LNPA 1M8MA 5FWCA 5GANd 3L2VA 1JRIA 4PFOA 1IHVA 3G6EQ 2XMFA 3GOXA 2QASA 4RTZA 2RJDA 1OYXA 4J6WA 4D8KA 1VYVA 5C6SA 3FDRA 4J9EA 2EJFA 2K7AA 4GLMA 4A54A 4DQ2A 3OYYA 2E5KA 1OU8A 5IXBA 3OMGA 1M2VA 5LJ3h 2BUDA 3EG9B 3UA7A 3CCSA 4XQ3A 2E12A 2AZSA 4M7DG 2K57A 4DOVA 2QEXQ 1TWBA 3M9QA 2CSQA 2KROA 3R6OA 3OYNA 3L2QA 3JRZA 3IQLA 4HVVA 3M4GA 2CZ6B 3I55A 3LGLA 3EGDB 3OYMA 5KYYA 1YWOA 2K4YA 1X2QA 3CCVA 1BI1A 4LD9K 4M7AD 2M0YA 4BACA 1K4US 3X25B 2YUNA 2GFUA 3EG2A 3L42A 3EHQA 2LCSA 2PUKB 2DTOA 3RIRA 2HBPA 3S3NA 5I21A 4L59A 3I56A 2Y4XA 1WHJA 3UATA 1Q82R 4C0GA 4N4IA 1RI0A 4J9IA 2DYIA 4BE1A 3PMIA 2GTJA 2BE9B 2HKQB 1JJ2A 1KQSP 3CCRA 1IXDA 4F17A 3LH5A 4KT0E 2JTFA 3U23A 4D6WA 2KMTA 3JB9J 2VUBA 3I5SA 2R58A 5GJVB 4E7ZA 2X3XD 3E19A 2JZ2A 4LD6A 2D1XA 3THKA 1YJ9A 2K5IA 4HCBA 1JJ2P 3GP8A 1ABOA 3GNFB 1ZLMA 2GTOA 2HNIA 1W2BA 2KNBB 5HKCA 1R0CB 2EJ9A 2V8IA 2YUOA 2KXCA 4A53A 4JRQA 2EKHA 1BBZA 4MMLA 3E1SA 4C5IA 2KBTA 2RHZA 3RUXA 4C5GA 4QVDA 3QWYA 3M4YA 3LLRA 2LQ8A 5LJ3d 3OYKA 4OGCA 3J7AF 1K9MC 1K73R 3PIPA 1W2BP 4BY6C 2QQSA 2KI7A 2EQMA 2LCCA 4C8QC 2ED0A 2COYA 2KAFA 1UGSB 1FMWA 4C8QF 1AWWA 1AVZC 2BZYA 5GAN5 4WF2A 5CAIA 3OA6A 3OBYA 2E6NA 1VQNQ 1X69A 1UFFA 1VQ5Q 2HL3A 3TEEA 3X26B 3MCAB 4FW2A 1VQ6T 4MMKA 1UGVA 1HK9A 2VGNA 1AOJA 1WHGA 1VQ9Q 2DPPB 1G8XA 4HVUA 3JB9H 1A0NB 2EQIA 2RJFA 4EDUA 4II1A 2K3YA 4LXCA 1VIEA 5D6YA 3UF4A 2DXBA 5KE3A 1OULA 4OGEA 1AEYA 1TU0B 3VYGA 3OQ5A 5FU6B 3A8LB 1Q86U 4OMOA 3RR6A 5GAN6 3H0HA 4FT2A 1Q95G 1QVFA 3UDCA 3X28B 1WPYA 2EJGA 4JUVA 4C92A 2X9HA 3UT1A 1EFNA 3ULRB 1FYNA 5A0LA 1RLPC 3LX7A 2D0NA 1T0HA 5DM7R 3KUFA 1NYFA 2PZ1A 4QQGA 2O9VA 2K2VA 2MWPA 2GNCA 3KBGA 2ECZA 2D9TA 1B7TA 3HPWA 1QVGA 3MP6A 5L23A 1G83A 2OJ2A 2KVQG 1AHJB 2DD5A 3REBB 3WVDB 1LNXA 3QYGB 1NZ9A 2M1HA 2BKDN 3C12A 4AG2C 4JDSA 5AYFA 1O75A 2DKGA 2L3QA 2RB6A 4C0DC 1JB0E 1SSHA 5L8RE 1MMDA 1BIBA 2DL7A 2DX1A 4PKCC 2MWOA 2FZCB 3SFMA 3OYDA 2J7IA 4QVCA 4DBRA 3C0CA 3O5ZA 3HFOA 1K73U 2YRCA 1Y7XA 2L0AA 1AWOA 4AMCA 2PUOB 4PJOE 2YT6A 3NTHA 4F7UA 4EMHA 5DLOA 4LDXA 2FEIA 1UB4A 3OS0A 4PK4A 4TVRA 2QXFA 2FPFA 4RTWA 4XAXB 1YHQT 3RKXA 2HCKA 2E41A 2RPNA 4JJCA 2C0TA 3S6WA 4QT7A 1VQ6A 2ZPGB 2KYMA 3MEAA 2O01E 1K8AR 2E1HA 2BZXA 3UWNA 1B3QA 3CCLQ 1VQ4Q 2LJ1A 3TU4K 3VS1A 4JLIA 2C0IA 5GAOl 2JS0A 2RQTA 4HCCA 3CMAQ 3ZBDA 4E2FB 3G4SQ 1VQKQ 3VV0A 2EGEA 4FT4A 2VKNA 4ELZC 2EYWA 5DY9A 2JM8A 1WLPB 1Y07A 4J6YA 4ESRA 4MZPA 2ZPFB 1ZSZA 5HY6A 4M7AA 1RACB 4M78A 4V2SA 4YTLA 2HL5C 1TS9A 2DILA 4FU6A 1IGQA 2OTJQ 2XIDA 4K11A 1VQNA 5HK3A 1U3OA 4VUBA 1FXXA 3Q1JA 5D6WA 1VQ5A 3OW2A 2A7YA 4OMPA 2VB6A 2QI2A 2EYQA 2ABLA 2E5QA 2O9SA 2MF2A 3CCLT 5KE2A 2XDBA 4OB0B 4M77B 2FG0A 3CMET 1SEMA 4XU1A 2DEQA 4M75F 3H6ZA 2DF6A 4F04B 1BYMA 3VS6A 3EFOB 4PL6A 3G4ST 1MV0B 2XICA 4O5VA 3VUZA 4CRIA 2QTXA 3BDUA 2VXFA 2ZAEA 2LQNA 3ASKA 2FVUA 1D0XA 1W70A 2F1LA 2JVVA 2NUPA 4DEYA 4BE2A 1IHWA 1UUEA 2RHYA 3RBBB 1KG1A 2DVEA 3FJPA 3SB2A 1AZEA 2YUQA 2OTJT 1WQ7A 2RI3A 4IURA 4J5YA 1PD1A 3KFVA 3J80E
chains in the Genus database with same CATH topology
2JN0A 4DOWA 1VIFA 3T9NA 3JB9D 4XU0A 4QW2A 3CCMA 4OVAA 3V8JA 4HT9A 4C92C 4JLGA 3CCEA 1I4K1 3FEOA 2QQRA 2WACA 5GMKm 4O6JA 4PJOD 4Y91A 4C92F 5GANd 2XDDA 2FHDA 3QBYA 3OS1A 3L2VA 3JCMW 4L6V5 5GAMe 1M1KU 1JRIA 2JTMA 2R5AA 2RJCA 4F7UE 4ZGJB 4LDYA 4R55A 3CC4T 4JS5A 3QYHB 2VC8A 3C4SA 5GAMf 1M90U 1XNIA 3GOXA 4GLKA 3JCMg 4DA4A 4E7JA 4L5GA 2KSSA 2M9UA 2RM4A 1G3SA 4OF1A 2RJDA 3NFCA 1OYXA 1UEBA 3MP1A 4J6WA 5GANe 3L2UA 1YIJT 1K8AU 1M8VA 2V8JA 5C6SA 5LJ3g 1W4SA 3FDRA 4FSXA 3O8VA 4E7IA 2DIQA 2EJFA 2CS7A 5J26A 5GAN2 4A54A 5LJ3j 4DQ2A 3OYYA 3JCMh 3MEUA 3M55A 2ZGWA 4N4HA 5GMKe 1U1TA 4M7DC 5FRMA 3OYHA 3OMGA 3V8LA 3VKIA 2JOYA 2MI6A 2CGHA 1UGQB 1X75C 4OB3B 3G71T 3RKWA 4HKEA 1KQ2A 4M7DF 2RA2A 5LJ3h 2BUDA 2EQUA 3CCSA 3CBPA 3N5BB 4XQ3A 3TREA 2E12A 2KQWA 4M75A 1WJQA 1LJOA 2ZZDA 2XD0A 1VQLA 4A4HA 1BIAA 5CQXA 4M7DG 2K57A 5CQYA 2DIGA 4DOVA 3WXMB 3M9QA 4LDWA 1KQ1A 2XU8A 3M58A 3R6OA 3OYNA 3L2QA 3JRZA 3PGGA 3JB9F 4PJOC 2HD0A 1YI2A 1KD1U 4J6XA 2K3XA 2CZ6B 3M4GA 4LDVA 3I55A 3LGLA 3QO3A 3QZ5B 3INZA 2QDYB 3OYMA 4PJOF 2VXEA 2K4YA 2F5TX 3CCVA 1BI1A 1B34A 1NPRA 3OYJA 4LD9K 4M78E 4M7AD 4BACA 3G7ZA 1VQ8T 5A0DA 3JB9G 4M77D 3X25B 1S72T 4M75B 2GFUA 3CPFA 1PSEA 3L42A 4XTYA 1YITT 2V8KA 2PUKB 5J39A 5GAN3 1Q86C 3CPWS 3CCLA 2DTOA 3RIRA 5EG2A 4C92D 2OTLT 1VUBA 2HBPA 3L2RA 3S3NA 1VQ4A 1VQ9A 2E6ZA 3CMEA 5I21A 3CCUA 4L59A 3JCMQ 3I56A 3M57A 2Y4XA 1Q7YU 1Q81C 2E65A 4C0GA 2YHTA 3MP8A 5GAOm 1VQ4T 4N4IA 1NJIU 3BW1A 3SWNA 3ER0A 1RI0A 2ZPBB 3HFNA 3LWIA 5CKDA 2E64A 3G4SA 3M59A 4BE1A 1VQ7T 1B34B 2XI9A 3PMIA 4FM4B 1ZHIA 4KUDK 1JJ2A 1ZBXA 2PQWA 3CMAT 1N9RA 4C0DB 3CCRA 5DLQE 4ZTJA 2QA4T 1VQKT 1OI1A 4KT0E 3VYHB 2JTFA 3CCJT 4C8QD 1BI2A 4D6WA 3QSUA 4MDXA 5FU7C 2KMTA 2B8AA 1YJWA 1D3BA 3V8KA 4C0FA 3JB9J 2VUBA 3PIOA 4N0AC 4JS4A 2R58A 2R5MA 2X35A 2CKKA 3CC7A 2LTOA 1Y71A 1UGRB 3E19A 4Q5WA 2JZ2A 3SWNB 2LDMA 3QXEB 3JCMX 3M5AA 5CKFA 4LD6A 4A4GA 4CI0C 5GAN7 3JB9I 2OTJA 1YJ9A 5CR2A 2K5IA 4HCBA 2EWNA 3GP8A 4XU3A 4A4KA 4NL3A 4M7DA 4M7AC 3GNFB 1YCYA 4UC4A 2X4XA 3VJPA 4PLIA 2AHJB 2HNIA 4M78C 4M77C 3QUIA 5HKCA 1YJ9T 2EJ9A 2DZ9A 4XTXA 3JCMc 3DKMA 3EFSA 4M7AF 1GXIE 2V8IA 4M77F 4E7KA 1M9SA 2L3RA 3QDRB 3ZEHA 4A53A 4QQ6A 3BFMA 4JRQA 3VU3C 4MZMA 2QQBA 1D3BB 4RG8A 3OS2A 5IT9E 4MMLA 3E1SA 3CC4A 4C5IA 4ATOA 2EQKA 3TCJA 2LC4A 3JCMd 2RHZA 1K73C 5FRNA 5GAN8 4OMFB 3RUXA 5KH6A 4C5GA 4QVDA 4XTVA 4KBMB 3OYIA 2L89A 2EAYA 3M4YA 3LLRA 5GAN4 4BI8B 3H8ZA 2LQ8A 1BKBA 4JJNK 1YIJA 1QVPA 2JNGA 3OYGA 5LJ3d 5GAOr 4C92G 3EFRA 3OYKA 4OGCA 3J7AF 3MO8A 1K9MC 2ZPHB 3PIPA 3CEYA 1N9SA 4BY6C 2QQSA 3HRSA 2DO3A 2EQMA 3OB9A 4P5NA 1M1FA 2LCCA 3JCMe 4J8OA 2VV5A 4C8QC 5CIUA 4XTZA 4JRPA 2EIFA 4Z02A 2CZ1B 3JCMf 3OS5A 2KAFA 3G71A 1UGSB 4C8QF 2F69A 5HK0A 3S3MA 2D6FA 3V7CA 2YRVA 5LJ3e 3GPLA 3RMSA 2DXUA 5GAN5 4IUQA 2PVGB 2GF7A 1N27A 4WF2A 5CAIA 5LJ3f 2LVMA 3OA6A 3OBYA 2E6NA 3RKYA 4C8QG 2CZ7B 2G3RA 4X9DA 5GAOp 1QP2A 1XQHA 3F70A 3TEEA 4HT8A 3X26B 3FC3A 3L2ZA 1G5VA 3MCAB 2LT1A 1VQ6T 3JSCA 3LYIA 4MMKA 2XDPA 1HK9A 2VGNA 4M75E 1KC8C 2DPPB 5CO7A 3ZFJA 4B9XA 1KHIA 1WNLA 3JB9H 1KHCA 2X4YA 3X24B 5CCAA 4R56A 5FROA 4XU2A 3OMCA 1VQ8A 1JBMA 4J7FA 3GIBA 1S72A 2RJFA 3P8HA 2HQEA 4J5YA 1YITA 2MAMA 4EDUA 1YJNT 3OYCA 3G6ET 1BI3A 4II1A 1P92A 3MEVA 1N8RC 1KQSA 3L1AA 1M1GA 2K3YA 1VIEA 3A8MB 4M78D 5D6YA 2OTLA 2RI2A 3FB9A 1KQSS 1Q82C 1XOVA 2DXCA 3OYLA 2P4TA 1IREB 2DXBA 4F7UF 5KE3A 2IVWA 4PJOG 4EPCA 4OGEA 5CKBA 2DJZA 3PMTA 3URGA 4RKUE 2PU9B 5KCHA 3VYGA 3PFSA 3OQ5A 2ZPEB 4J83A 5FU6B 4EMKA 2RI5A 4ZGDB 3A8LB 1HXDA 3CCQA 1VQ7A 1RL2A 4LDUA 4RCBA 4FIBA 4F7UG 1Q86U 3CBOA 5GAN6 5CKEA 2YLBA 4BD3A 5I2MA 3CMAA 4QVZA 4FT2A 3ME9A 1XTDA 3UDCA 1QVFA 3X28B 1WPYA 2EJGA 4JUVA 3V7SA 2RD1A 4C92A 3CCQT 2QA4A 1VQMA 1VQKA 1QVFS 3CCJA 3UT1A 3CC2T 2LRQA 2YLCA 3JCMJ 1Q81U 1G3TA 1WGSA 4C92E 1JJ2S 4OB1B 4NL2A 2FB7A 4C0ZA 1VQMT 3DB4A 1VQOT 2C06A 1MHNA 3DLLA 5A0LA 3LX7A 3P8BB 2L5QA 4KULA 5DM7R 2K5FA 2Y90A 5GMKl 2QEXT 3P8DA 4OB2B 4EMKB 4M75C 3KUFA 1G3YA 3RMQA 3V7RA 3PTAA 2F5KA 5CKHA 4QQGA 3FIFA 2FL7A 2K2VA 2MWPA 2VYTA 5IAYA 2VGMA 4RMOA 2IG0A 3KBGA 2D9TA 4XK8E 4BE0A 4FL6A 3FRNA 2E10A 2P0QA 3HPWA 4C92B 1V29B 2O4XA 1QVGA 3MP6A 1EIFA 1N6AA 1QVGS 2X4WA 3CC7T 2QQAA 2KVQG 1AHJB 1QP3A 2DD5A 1ZQ1A 2RHIA 2FYKA 3EAEA 5LJ5g 3OYBA 3WVDB 1LNXA 3QYGB 5M9OA 4A4EA 1SSFA 1NZ9A 1QW1A 5LJ5j 2M1HA 3DB3A 2KDSA 1W2BS 3LW5E 2BKDN 4M7DE 2LQKA 4M78F 4ZTFA 3QG1A 3UPUA 3HHTB 3C12A 2LT4A 4JDSA 5AYFA 1O75A 2DKGA 1PSFA 3RERA 1DJ7B 2RB6A 4C0DC 1JB0E 4BI3A 2E70A 2RK1A 1VQPT 4QQDA 3BDLA 5L8RE 3C94A 3M54A 5LJ5h 4M7AG 1BIBA 4KUIA 4M77G 3OSVA 3OBWA 3M53A 3QZ9B 4M78G 4PKCC 4C5EA 2RHXA 2MWOA 2LCLA 1IZ6A 2O4XB 2WSEE 3SFMA 3OYDA 3CBMA 1OZ3A 4QVCA 1I81A 4PJOA 4M7DB 3HFOA 1K73U 1WJRA 1Y7XA 4ME7A 1WQWA 2OAUA 3SWNC 2RJEA 1M1KC 5LL6S 2ZCFB 1I8FA 3BY7A 2PUOB 4IUVA 5GAMg 4PJOE 3QIIA 2GFAA 2Y4YA 3NTHA 1M90C 5GAMj 2DTIA 3JCMP 1TH7A 4F7UA 5CK9A 3LGFA 4EMHA 1YHQA 1YBYA 2XK0A 3HRUA 5DLOA 3CCMT 1K9MU 4LDXA 4ZN1A 1UB4A 3S3OA 3CCET 2L8DA 3OS0A 2BIVA 3QJ6A 2QXFA 4TVRA 1K8AC 4XAXB 2RK2A 2WSCE 1YHQT 2XG8D 3NTKA 3A8HB 4IUPA 4BB7A 5GANg 3RKXA 5GAMh 2E41A 2LX9A 1UGPB 3J81E 3GF5A 1OZ2A 5GANj 3NTIA 3HP9A 3S6WA 1VQ6A 2ZPGB 2DK3A 3OY9A 3MEAA 4PJOB 2O01E 1U1SA 3OSSC 3META 3CXCA 2H3JA 2E1HA 3HRTA 4OP0A 3SD4A 2EKOA 3CXCS 3UWNA 5GANf 1M5Q1 3QJYA 5GMKj 2HAXA 4HCZA 4JRIA 2JUFA 5IN1A 5GANh 3OYEA 4PNOA 3TU4K 4F7UB 3E9GA 4M75D 3JAME 2XHCA 3SDZA 3GNGA 3X20B 2DZCA 4JLIA 3C95A 5GAOl 4HCCA 1YJNA 4EMGA 3G6EA 1X6OA 4MDWA 5GMKh 3HKSA 3ZBDA 1KC8U 3FLGA 3OYFA 3A5ZB 3QPHA 3VV0A 1FWZA 4Y28E 1I5LA 4N0AA 4FT4A 5KCOA 2P0PA 2DD4A 1M4ZA 3KXTA 3OYAA 4ELZC 4BI4A 1KD1C 5DY9A 3CCST 4BDYA 1FX7A 1Y07A 1H641 3CD6A 1NPPA 2MMPA 4JRKA 3MEWA 2PVDB 3DLMA 2LNVA 4J6YA 1VQLT 4MZPA 2ZPFB 4IUUA 2HQXA 1N8RU 5HY6A 4M7AA 3CD6T 1Q82U 3MHXA 4M77A 4M78A 5J3BA 5FLXE 4YTLA 3WVEB 3JCMV 4B9WA 5A0GA 5I2SA 4V2SA 4IUTA 2XKOC 3CC2A 4M7AE 2PVOB 4C5HA 2RHUA 5FU7B 3JCMb 4FU6A 1YI2T 4M77E 2XIDA 3I55T 1Y96A 3GLXA 5HK3A 1VQNA 4VUBA 2X4JA 1FXXA 3AHUA 3Q1JA 5D6WA 1VQOA 2DXTA 1VQ5A 4XTWA 1O9SA 3OW2A 1Q7YC 3CCVT 2CYZB 1BI0A 4X9CA 3CPWA 4A4FA 3OW2S 2A7YA 1VQNT 1NJIC 2QEXA 2WSFE 2QI2A 1VQ5T 4X34A 2EYQA 4RCCA 2E5QA 4HA8A 2MF2A 4N4GA 1W2BA 3CCLT 4NOYA 5KE2A 1U8RA 4M7AB 4BDZA 2XDBA 2KK4A 2RO0A 3HL8A 5A2QE 4E7LA 1VQ9T 4ZN3A 4OB0B 4M77B 4M78B 3CMET 2M16A 3CCUT 2EQJA 4XU1A 3I56T 4ELYC 2DAQA 1WJSA 2DEQA 4M75F 3H6ZA 4C8QA 2R57A 2P0KA 2GQVA 3E9FA 3VUBA 5LJ5d 1Y96B 2CZ0B 1BYMA 4MZTA 2K5LA 5FU6C 2A3LA 4PL6A 3QKJA 3G4ST 4C8QE 4PLLA 2M0OA 2XICA 5C0MA 2EFIA 3PNWC 4O5VA 3VUZA 3L2WA 4BUGA 4CRIA 4M75G 2QTXA 3BDUA 2VXFA 3M56A 3HSBA 2NLUA 3CCRT 2ZPIB 3QHSA 4E7HA 5CVIA 3RESA 1VQPA 1MGQA 3ASKA 4GY5A 1R8OB 1X01A 2FVUA 4M7DD 4RG2A 2RH2A 1NE8A 1LOJA 5LJ5e 2D0QB 3A8OB 5GAOq 2KY9A 2JVVA 1YJWT 1G3WA 4BY6B 5LJ5f 4BE2A 2RHYA 4IKFA 1KG1A 2DVEA 4C8QB 5GMKi 5GAOn 3FJPA 5D6XA 3SB2A 4E47A 3LWHA 4NS5A 2GCXA 5GAMd 2DTHA 1WQ7A 4XTUA 4EMKC 2OTJT 1H3ZA 3A8GB 2RI3A 4J7IA 2I2LA 3LH0A 2QQ9A 4IURA 4ZGEB 3PT9A 3J80E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RKU E;  2PU9 B;  3VYG A;  2ZPE B;  3X20 B;  4ZGD B;  3A8L B;  4L6V 5;  1UGR B;  3QXE B;  4ZGJ B;  3QYH B;  3X28 B;  4Y28 E;  2DD4 A;  4OB1 B;  2AHJ B;  1GXI E;  2PVD B;  2ZPF B;  4OB2 B;  3WVE B;  1UGQ B;  4OB3 B;  2PVO B;  4XK8 E;  1V29 B;  2CYZ B;  1AHJ B;  1QP3 A;  2DD5 A;  2ZZD A;  2ZPH B;  3WVD B;  3QYG B;  2WSF E;  3LW5 E;  3HHT B;  2CZ1 B;  1PSF A;  1UGS B;  1DJ7 B;  1JB0 E;  4OB0 B;  2CZ6 B;  2DXC A;  5L8R E;  3QZ5 B;  2QDY B;  2PVG B;  3QZ9 B;  2CZ0 B;  2WSE E;  2CZ7 B;  3X25 B;  1PSE A;  1QP2 A;  3X26 B;  2PUK B;  2ZCF B;  2PUO B;  2ZPI B;  2DPP B;  3X24 B;  2D0Q B;  3A8O B;  2ZPB B;  2WSC E;  3A8H B;  4FM4 B;  1UGP B;  2ZPG B;  3A8M B;  2O01 E;  3A8G B;  4ZGE B;  4KT0 E;  3VYH B;  1IRE B;  2DXB A; 
#chains in the Genus database with same CATH topology
 2JN0 A;  3JB9 D;  4XU0 A;  1JXO A;  4OVA A;  3V8J A;  4C92 C;  1I4K 1;  3FEO A;  2K6D A;  1IRX A;  4PJO D;  4C92 F;  3OS1 A;  3JCM W;  2A0F B;  1OX9 A;  4E6R A;  3MKD A;  4F7U E;  4ZGJ B;  1QKX A;  1GBQ A;  4JS5 A;  2K3B A;  3JCM g;  1SHF A;  1S1N A;  4L5G A;  4OMM A;  2MK5 A;  2RM4 A;  1G3S A;  1TUD A;  1RAG B;  2OTL Q;  1K8A U;  1UEB A;  3MP1 A;  1M8V A;  2IPO B;  1W4S A;  4FSX A;  4E7I A;  2SRC A;  3MEU A;  3M55 A;  1QKW A;  1D1C A;  4M7D C;  5FRM A;  2HBW A;  3OYH A;  3V8L A;  1BK2 A;  2JOY A;  1PRM C;  4M7D F;  2DBM A;  1KQ2 A;  2CRE A;  1AZG B;  3CBP A;  1VQM Q;  2QA4 Q;  3TRE A;  1WJQ A;  1T3S A;  1FMK A;  1LJO A;  2RF0 A;  4R0K A;  3WXM B;  1HD3 A;  2XU8 A;  1TXQ A;  1VYU A;  1SG5 A;  1QCF A;  4J6X A;  4LDV A;  3QO3 A;  3CQT A;  1GRI A;  4M78 E;  5A0D A;  3JB9 G;  2DL8 A;  1S72 T;  4M75 B;  3H0F A;  2V8K A;  5J39 A;  1Q86 C;  3CCL A;  4C92 D;  2OTL T;  1VQ4 A;  3NGP A;  2E6Z A;  3CME A;  4KGV B;  3EG1 A;  2DRK A;  3MP8 A;  5GAO m;  4QKU A;  1LCK A;  2ZPB B;  5CKD A;  2E64 A;  3G4S A;  2A08 A;  3M59 A;  1ARK A;  1B34 B;  1V76 A;  4FM4 B;  2EBP A;  2DJQ A;  4KUD K;  1ZBX A;  2PQW A;  1N9R A;  1OV3 A;  2QA4 T;  1OI1 A;  3VYH B;  1BI2 A;  3QSU A;  5FU7 C;  2CP3 A;  1D3B A;  1ZUU A;  3PIO A;  4IIM A;  2R5M A;  2G6F X;  1Y71 A;  2CP5 A;  3SWN B;  1D1A A;  2LDM A;  3M5A A;  5GAN 7;  2OTJ A;  3JB9 I;  5CR2 A;  2YXY A;  2EWN A;  1NEG A;  4FYX B;  1ZSZ C;  4XU3 A;  4M7A C;  3PE0 A;  2X4X A;  4PLI A;  2AHJ B;  4M78 C;  1YJ9 T;  2L3S A;  3JCM c;  4M7A F;  2Z0W A;  3VRY A;  4E7K A;  2DEU A;  4QQ6 A;  2QQB A;  2J6K A;  3VS2 A;  5KYU B;  2EQK A;  1QMC A;  2F2X A;  1K73 C;  2OI3 A;  2L89 A;  2EAY A;  3RNJ A;  3H8Z A;  3M0U A;  2DL5 A;  1UDL A;  3TQ7 P;  4C92 G;  2ZPH B;  2COW A;  1SPK A;  4P5N A;  3OB9 A;  6AT1 B;  3JCM e;  2CDT A;  4JRP A;  2EIF A;  1H8K A;  4Z02 A;  2CZ1 B;  3JCM f;  3OS5 A;  4Z89 A;  4FYV B;  2YRV A;  5I22 A;  2B86 A;  3GPL A;  2KRN A;  4IUQ A;  2PVG B;  1YNZ A;  2DFU A;  2LX7 A;  3TSW A;  2QDL A;  2COZ A;  1G5V A;  3JSC A;  3LYI A;  2XDP A;  2CT4 A;  1YCS B;  1LPL A;  1I1J A;  4B9X A;  1WX6 A;  5EC7 A;  1KHC A;  4R56 A;  5FRO A;  2DYB A;  1Z9Q A;  2RNA A;  5IHN A;  2MPX C;  4J7F A;  1W6X A;  1S72 A;  2DRM A;  2HMA A;  1KC8 R;  1HYO A;  3OYC A;  3G6E T;  1P92 A;  3MEV A;  2LMJ A;  1KQS A;  3L1A A;  1SHG A;  1X6B A;  2A37 A;  4M78 D;  2OTL A;  3CXC P;  2IVW A;  5CKB A;  2DJZ A;  3URG A;  2QTV A;  2M51 A;  1GFD A;  1KJW A;  3A98 A;  4ZGD B;  1ZX6 A;  1HXD A;  4RCB A;  4F7U G;  4FIB A;  2IIM A;  5I2M A;  2FZG B;  1VQM A;  2QA4 A;  1QVF S;  1RAD B;  3M0T A;  1G3T A;  1PWT A;  1WHH A;  2FB7 A;  4C0Z A;  3DB4 A;  1MHN A;  4OML A;  2HQH A;  1VA7 A;  2J06 A;  2A28 A;  1MMG A;  4RTX A;  2Y90 A;  2QEX T;  3P8D A;  4EMK B;  1ZBJ A;  1G3Y A;  3RMQ A;  1BCO A;  3V7R A;  3PTA A;  5CKH A;  1UG1 A;  2MCN A;  2JT4 A;  4BE0 A;  3FRN A;  2O4X A;  3VRZ A;  1EIF A;  1TTH B;  1QVG S;  2X4W A;  2CT3 A;  1J3T A;  2RHI A;  3EAE A;  2FRY A;  5M9O A;  4A4E A;  2JMC A;  3LW5 E;  2LQK A;  3UPU A;  3HHT B;  2LT4 A;  5KYX A;  4J9G A;  2E70 A;  3GBQ A;  3C94 A;  3M54 A;  4M7A G;  1ZA1 B;  4M78 G;  4C5E A;  1WDX A;  2RHX A;  4RTY A;  1OZ3 A;  4PJO A;  1NBE B;  2CP2 A;  2OAU A;  2QAZ A;  5ECA A;  2GFA A;  3M0R A;  2OAW A;  3QDF A;  1I5O B;  1YBY A;  1NM7 A;  3S3O A;  3EGX B;  1K8A C;  2L2P A;  1PC0 A;  2J6F A;  2RK2 A;  4OMN A;  3A8H B;  1M90 R;  2LX9 A;  1GBR A;  3OSS C;  4PJJ A;  1GCQ A;  2H3J A;  2VVK A;  2KR3 A;  5GAN f;  1M5Q 1;  4HCZ A;  4PNO A;  3JAM E;  3CCU Q;  1JO8 A;  1X6G A;  2DZC A;  4HCK A;  3C95 A;  2F2V A;  3RDV A;  3G6E A;  1WXT A;  1UTI A;  3HKS A;  1KC8 U;  3OYF A;  3QPH A;  1FWZ A;  2KEA A;  5KCO A;  2DD4 A;  3EG0 A;  4DEX A;  2YWW A;  1JQQ A;  1WYX A;  4JRK A;  3M0P A;  1K0X A;  2LNV A;  1UJY A;  3M0S A;  4IUU A;  2HQX A;  1WIE A;  2EGA A;  5IHK A;  1YJW Q;  1Q82 U;  5J3B A;  5A0G A;  5I2S A;  3WVE B;  3JCM V;  1NEB A;  4C5H A;  3JCM b;  1YP5 A;  4M77 E;  1Y96 A;  3AHU A;  1O9S A;  2QGG A;  2CYZ B;  4X9C A;  4E7S A;  1RAE B;  3OW2 S;  1VQN T;  5AT1 B;  1KK7 A;  2QEX A;  1VQ5 T;  1MND A;  4HA8 A;  1U8R A;  2BZ8 A;  2DET A;  1Q7Y R;  2CP0 A;  2RO0 A;  3MPU B;  2DL3 A;  1VQ9 T;  3CC4 Q;  1RAB B;  3CCU T;  1GCP A;  1WJS A;  2R57 A;  3E9F A;  2GQV A;  3VUB A;  4AG1 C;  2EW3 A;  2K5L A;  2A3L A;  3H41 A;  4PLL A;  5D7U A;  5C0M A;  2KGT A;  1D0Z A;  3M56 A;  1GFC A;  3RES A;  4RG2 A;  2RH2 A;  2CP7 A;  3G71 Q;  1YJW T;  1E6H A;  4BY6 B;  2FZK B;  1WA7 A;  4C8Q B;  2RN8 A;  4E47 A;  4NS5 A;  4CC3 A;  4PFZ A;  2I2L A;  2QQ9 A;  4ZGE B;  2D8J A;  4JZ3 A;  2RQV A;  1VIF A;  4KGZ B;  4KGX B;  2ROL A;  4JLG A;  4OMQ A;  2XDD A;  4L6V 5;  4PFP A;  1PHT A;  4LDY A;  1VQ8 Q;  4R55 A;  3CC4 T;  1M90 U;  2VC8 A;  3C4S A;  3EG9 A;  4DA4 A;  4FYW B;  1YIT Q;  2NUT B;  4OF1 A;  1X43 A;  2EYZ A;  1OU9 A;  2DIQ A;  2CS7 A;  2RMO A;  1R77 A;  2V1Q A;  3JCM h;  1AD5 A;  1U1T A;  2JXB A;  3CCQ Q;  3EGD A;  3VKI A;  2MI6 A;  3G71 T;  4OB3 B;  3CC2 Q;  3RKW A;  4PJL A;  2EQU A;  3N5B B;  1VQO Q;  2KQW A;  2XD0 A;  3MJX A;  4A4H A;  1BIA A;  2DIG A;  1GL5 A;  3AT1 B;  4WTO B;  1KQ1 A;  4RTT A;  3PGG A;  3JB9 F;  4PJO C;  2HD0 A;  2K3X A;  4Z88 A;  3INZ A;  1M2V B;  4PJO F;  2K2M A;  2VXE A;  3CC7 Q;  2F5T X;  2DVJ A;  3OYJ A;  3G7Z A;  1WZO A;  1VQ8 T;  4M77 D;  3CPF A;  2KYB A;  1YIT T;  2F2W A;  5GAN 3;  3CPW S;  1VUB A;  1VQ9 A;  3M0Q A;  2MIO A;  3CCU A;  2OX7 A;  3M57 A;  2JMA A;  1WXU A;  1Q7Y U;  2YHT A;  1VQ4 T;  2P84 A;  2YDL A;  4J9H A;  1GCQ C;  5GJW B;  3LWI A;  5KYY B;  4LE9 A;  1NG2 A;  1ZHI A;  3CMA T;  2HSE B;  1Q81 R;  4C0D B;  2LNH B;  1VQK T;  3A1P A;  1I0C A;  2JM9 A;  1TUG B;  4F16 A;  3CCM Q;  2A36 A;  2B8A A;  1YJW A;  4C0F A;  3V8K A;  2YSQ A;  2AKL A;  2X35 A;  2LTO A;  2HEQ A;  1D1B A;  3JCM X;  5CKF A;  4CI0 C;  2KXD A;  4A63 B;  4A4K A;  4NL3 A;  3VJP A;  4UC4 A;  3QUI A;  2X51 A;  4XTX A;  1GXI E;  3D7S B;  3DKM A;  1M3A A;  3EHR A;  1M9S A;  2L3R A;  1H3H A;  4MZM A;  1PRL C;  2CP6 A;  1KSW A;  4CC7 A;  4PJN A;  3CC4 A;  2E3H A;  7AT1 B;  3JCM d;  2GBQ A;  4KBM B;  3OYI A;  5GAN 4;  4BI8 B;  4JJN K;  1QVP A;  2JNG A;  3OYG A;  5HCK A;  1PKT A;  2W10 A;  3MO8 A;  4F14 A;  3CEY A;  3CD6 Q;  1EX4 A;  1TG0 A;  2VV5 A;  5CIU A;  3S3M A;  3G71 A;  2D6F A;  3I55 Q;  1QCO A;  3RMS A;  4JZ4 A;  1ZUK A;  2GF7 A;  5IXF A;  2ROT A;  2CH4 A;  3RKY A;  4LUD A;  1H92 A;  1M27 C;  1NLP C;  2CZ7 B;  3NPF A;  3F70 A;  3FC3 A;  2LT1 A;  1KC8 C;  5CO7 A;  3ZFJ A;  1N5Z A;  1SKU B;  1WNL A;  3X24 B;  1WHL A;  5FW9 A;  1VQ8 A;  3GIB A;  1CKB A;  2HQE A;  1YIT A;  2MAM A;  2EPD A;  1BI3 A;  4HVW A;  1UHF A;  1M1G A;  3A8M B;  3FB9 A;  1KQS S;  1Q82 C;  1XOV A;  3PVQ A;  1HSQ A;  2DXC A;  1TOV A;  1IRE B;  4F7U F;  4PJO G;  3PMT A;  1AT1 B;  4RKU E;  2PU9 B;  3PFS A;  2ED1 A;  1N8R R;  2RI5 A;  4X1V A;  3CCQ A;  4LDU A;  2BE7 D;  1CSK A;  4RTU A;  1QWE A;  3CBO A;  2HDA A;  2YLB A;  3CMA A;  1SF9 A;  4QVZ A;  3ME9 A;  1T3L A;  2RD1 A;  1VQK A;  1C6V X;  1Q81 U;  1WGS A;  1U06 A;  1JJ2 S;  2KRS A;  4OB1 B;  1YFN A;  1VQM T;  1BCM A;  2E4H A;  3P8B B;  1UJ0 A;  2L5Q A;  3FJ5 A;  4KUL A;  1WI7 A;  2O31 A;  3CCE Q;  4OB2 B;  3FIF A;  4RMO A;  3CC7 A;  5IAY A;  2VGM A;  2IG0 A;  1JU5 C;  4XK8 E;  4C92 B;  3E2U A;  1QP3 A;  1ZQ1 A;  5LJ5 g;  1SSF A;  1MUZ A;  1QW1 A;  5LJ5 j;  2KDS A;  1W2B S;  1E6G A;  1VOM A;  4M78 F;  1G2B A;  1PSF A;  1V1C A;  4QQD A;  4ANJ A;  3QZ9 B;  3M53 A;  2LCL A;  1IZ6 A;  2O2O A;  8ATC B;  1I81 A;  4DBF A;  4M7D B;  3TSZ A;  1Y0M A;  4ME7 A;  1WQW A;  2RJE A;  1VQL Q;  2D8H A;  1I8F A;  3BY7 A;  3R6N A;  4IUV A;  5GAM g;  3QII A;  4J9D A;  1M90 C;  5GAM j;  2DTI A;  2XK0 A;  4AFQ C;  5I11 A;  1YI2 Q;  3CCE T;  2ATC B;  2BIV A;  1ACM B;  1M1K R;  2QG9 B;  2WSC E;  3NTK A;  5GAN g;  1M30 A;  4J9C A;  1UGP B;  3J81 E;  5GAN j;  1OZ2 A;  1U1S A;  3CXC A;  2AIR B;  3HRT A;  4OP0 A;  1UHC A;  3H0I A;  1T0J A;  3QJY A;  5GMK j;  1MMN A;  2JUF A;  5IN1 A;  4F7U B;  3E9G A;  3NMZ C;  4IIO A;  1RI9 A;  2DA9 A;  5KYW B;  2QGF B;  1PD0 A;  4MDW A;  4Y28 E;  1I5L A;  4N0A A;  2P0P A;  1EZZ B;  1M4Z A;  3QWX X;  4BI4 A;  4BDY A;  1FX7 A;  3CD6 A;  1Z9Z A;  2LQW A;  2MMP A;  2PVD B;  1VQL T;  2KE9 A;  1N8R U;  3REA B;  3MHX A;  2EVR A;  4M77 A;  1KD1 R;  5IHI A;  2DMO A;  2RHU A;  5FU7 B;  1YI2 T;  4LUE A;  3GLX A;  2X4J A;  3EFO A;  1RLQ C;  3VS3 A;  1Q7Y C;  4A4F A;  4AFZ C;  2DL4 A;  2WSF E;  4X34 A;  4JPB W;  4N4G A;  1ZSZ B;  4NOY A;  4M7A B;  1D0Y A;  2K79 A;  4BDZ A;  2KK4 A;  4E7L A;  2RQW A;  1K0S A;  4M78 B;  1Q86 R;  1NJI R;  1WXB A;  1RAA B;  1SRL A;  2V26 A;  2CZ0 B;  4MZT A;  1PKS A;  1YIJ Q;  5FWB A;  2LJ3 A;  5FU6 C;  1OOT A;  2FO0 A;  4C8Q E;  2M0O A;  2PTK A;  2EFI A;  3PNW C;  3L2W A;  4BUG A;  3HSB A;  4E7H A;  1MGQ A;  4GY5 A;  1R8O B;  1X01 A;  5LJ5 e;  1NE8 A;  1LOJ A;  2D0Q B;  1IGU A;  2DBK A;  2KY9 A;  5LJ5 f;  2C0O A;  1QLY A;  4IKF A;  5D6X A;  3LWH A;  2VWF A;  2GCX A;  1VQ6 Q;  2DTH A;  4XTU A;  1H3Z A;  3A8G B;  4J7I A;  4DOW A;  4FW1 A;  4J9B A;  3T9N A;  4QW2 A;  1F1B B;  4HT9 A;  3CCE A;  2QQR A;  4O6J A;  4Y91 A;  2FHD A;  3QBY A;  4FYY B;  5GAM e;  2NUP B;  1M1K U;  2JTM A;  2R5A A;  2RJC A;  3QYH B;  4CC2 A;  2HSP A;  5GAM f;  1XNI A;  4GLK A;  4E7J A;  1MV3 A;  3ZL7 C;  2KSS A;  2M9U A;  2ESW A;  3NFC A;  5GAN e;  3L2U A;  1YIJ T;  1IB8 A;  1UEC A;  2V8J A;  5LJ3 g;  3O8V A;  5J26 A;  5GAN 2;  5LJ3 j;  2ZGW A;  2J05 A;  4N4H A;  5GMK e;  1VQ7 Q;  2JW4 A;  2CGH A;  1UGQ B;  1X75 C;  4HKE A;  2E3I A;  2RA2 A;  3VS4 A;  4Y92 A;  1TSF A;  2MOX A;  4JJD A;  1QWF A;  4M75 A;  3CCJ Q;  2EYX A;  2ZZD A;  1VQL A;  5CQX A;  5CQY A;  1VYT A;  4FSS A;  4DBQ A;  4LDW A;  1FMV A;  3I9Q A;  3M58 A;  2RQU A;  2M02 A;  3BE3 A;  1W1F A;  1YI2 A;  1KD1 U;  3QZ5 B;  2QDY B;  2ENM A;  1K1Z A;  1B34 A;  1NPR A;  3PVL A;  2BTT A;  2O88 A;  2SEM A;  2EYY A;  1PSE A;  4XTY A;  1BB9 A;  2NWM A;  5EG2 A;  3VS7 A;  1PG5 B;  3L2R A;  2VAS A;  4Z8A A;  1K76 A;  3JCM Q;  1Q81 C;  2E65 A;  1QQJ A;  4ZNX A;  1NJI U;  3BW1 A;  3SWN A;  3ER0 A;  2GGR A;  2EGC A;  1OPK A;  3HFN A;  1MNE A;  1VQ7 T;  1RUW A;  2XI9 A;  4AFS C;  4KH1 B;  1AWJ A;  2CSI A;  5DLQ E;  4ZTJ A;  1PCX A;  4KH0 B;  3CCJ T;  2KT8 A;  4C8Q D;  2PNI A;  4MDX A;  2LJ0 A;  3VS5 A;  1BU1 A;  5KYU A;  4N0A C;  4JS4 A;  1YHQ Q;  2CKK A;  1UGR B;  4Q5W A;  3QXE B;  2JS2 A;  4A4G A;  1QVF P;  4M7D A;  2NYS A;  2W0Z A;  1YCY A;  4M77 C;  2HZY A;  2DZ9 A;  3EFS A;  1R0B G;  4M77 F;  3QDR B;  3ZEH A;  3BFM A;  3VU3 C;  4B6M A;  4RG8 A;  1D3B B;  3OS2 A;  5IT9 E;  1UE9 A;  3NHN A;  3EH1 A;  4ATO A;  3TCJ A;  1QCN A;  2LC4 A;  5FRN A;  5GAN 8;  4OMF B;  5KH6 A;  1YJN Q;  4XTV A;  1QVG P;  1BKB A;  1YIJ A;  5GAO r;  3EFR A;  2DM1 A;  1N9S A;  3HRS A;  2DO3 A;  8AT1 B;  1M1F A;  5KYN A;  1KFZ A;  4J8O A;  4XTZ A;  4M4Z A;  1B07 A;  5HK0 A;  1NYG A;  2F69 A;  3V7C A;  1KIK A;  1K9M R;  2LP5 A;  5LJ3 e;  5KYW A;  2DXU A;  2V1R A;  1N27 A;  5LJ3 f;  2LVM A;  1Y57 A;  2DE0 X;  2H3E B;  4C8Q G;  2G3R A;  4X9D A;  9ATC B;  1QP2 A;  1XQH A;  5GAO p;  4HT8 A;  3L2Z A;  4M75 E;  3CME Q;  2CUD A;  1KHI A;  2X4Y A;  5CCA A;  2FPD A;  1CKA A;  4XU2 A;  3OMC A;  4EIK A;  1JBM A;  3P8H A;  1WHM A;  1YJN T;  2YRD A;  1N8R C;  3RER A;  2DER A;  2RI2 A;  3OYL A;  2P4T A;  1PNJ A;  4EPC A;  2RQR A;  1OPL A;  1ZA2 B;  5KCH A;  2ZPE B;  1VQP Q;  4J83 A;  4EMK A;  2LZ6 B;  3EG3 A;  1VQ7 A;  1RL2 A;  4AFU C;  1C0M A;  5CKE A;  4BD3 A;  1XTD A;  1D09 B;  3V7S A;  3CCQ T;  3CCJ A;  3CC2 T;  2LRQ A;  2YLC A;  3JCM J;  1OX8 A;  4C92 E;  4NL2 A;  1VQO T;  2C06 A;  2YUP A;  3DLL A;  4RTV A;  2K5F A;  5GMK l;  3UA6 A;  4M75 C;  4RUG A;  2F5K A;  2FL7 A;  2VYT A;  4FL6 A;  2E10 A;  2P0Q A;  1V29 B;  2H8H A;  1N6A A;  2KRM A;  4LN2 A;  3OW2 P;  3CC7 T;  2QQA A;  4JJB A;  2FYK A;  3OYB A;  1LVK A;  1IO6 A;  1K9A A;  3DB3 A;  4M7D E;  4ZTF A;  3QG1 A;  5IH2 A;  2MYS A;  1DJ7 B;  4BI3 A;  2RK1 A;  1VQP T;  3EGX A;  1RAH B;  3BDL A;  5LJ5 h;  2NUZ A;  4KUI A;  2FPE A;  4M77 G;  3OSV A;  3OBW A;  2AKK A;  2O4X B;  2WSE E;  3CBM A;  3CCS Q;  1WJR A;  4AT1 B;  1I07 A;  3SWN C;  1M1K C;  5LL6 S;  1HJD A;  2ZCF B;  2FRW A;  2Y4Y A;  1X27 A;  3JCM P;  1TH7 A;  4KRT A;  5CK9 A;  3LGF A;  1YHQ A;  5KYX B;  3HRU A;  3CCM T;  1PM3 A;  1K9M U;  4ZN1 A;  2L8D A;  3QJ6 A;  1WFW A;  2I0N A;  1S72 Q;  2XG8 D;  4BB7 A;  4IUP A;  2J6O A;  4DBH A;  5GAM h;  1X2K A;  3CCV Q;  3GF5 A;  3NTI A;  3HP9 A;  3OY9 A;  2DK3 A;  4PJO B;  3MET A;  3G1J A;  3SD4 A;  2EKO A;  3CXC S;  1MMA A;  2HAX A;  4JRI A;  2KT1 A;  5GAN h;  3OYE A;  4M75 D;  2XHC A;  3SDZ A;  3EH2 A;  3GNG A;  3X20 B;  3I56 Q;  2X3W D;  3JV3 A;  1YJN A;  2K9G A;  4EMG A;  1WHK A;  1X6O A;  4WCI A;  5GMK h;  1JEG A;  3FLG A;  1M2O A;  3A5Z B;  2DNU A;  2CH4 W;  3KXT A;  3OYA A;  4D8D A;  3CCR Q;  1KD1 C;  3CCS T;  3EGU A;  1H64 1;  1NPP A;  3MEW A;  2QYZ A;  3DLM A;  1ABQ A;  3SHW A;  3H9N A;  3CD6 T;  5FLX E;  4B9W A;  4IUT A;  2XKO C;  3I35 A;  3CC2 A;  4M7A E;  2PVO B;  3I55 T;  1YJ9 Q;  1SRM A;  1VQO A;  2DXT A;  4XTW A;  4GBQ A;  4CC4 B;  3CCV T;  1BI0 A;  1XJW B;  3CPW A;  2AK5 A;  1NJI C;  1JXM A;  4FCY A;  1YN8 A;  4HXJ A;  2GQI A;  4RCC A;  3HL8 A;  3SEM A;  5A2Q E;  4ZN3 A;  2M16 A;  2EQJ A;  3I56 T;  4ELY C;  2CUB A;  2DAQ A;  1U5S A;  1AWX A;  2JTE A;  2P4R A;  4ORZ A;  1NLO C;  4C8Q A;  2P0K A;  5LJ5 d;  1Y96 B;  4J9F A;  3QKJ A;  1E7O A;  2DLP A;  3CPW P;  2AZV A;  1ZUY A;  4M75 G;  1M3C A;  3VS0 A;  2NLU A;  3CCR T;  2ZPI B;  3QHS A;  5CVI A;  1VQP A;  2HKN A;  4M7D D;  3I5R A;  1RAI B;  1YWP A;  3A8O B;  5GAO q;  1G3W A;  1OEB A;  1C1A A;  1ZSG A;  1M3B A;  5GMK i;  5GAO n;  3HTR A;  2NUT A;  1OQK A;  5GAM d;  4EMK C;  4PJM A;  2JJ9 A;  3LH0 A;  3TVT A;  3PT9 A;  1RAF B;  2AT1 B;  2L3P A;  3CCM A;  1TUC A;  2WAC A;  5GMK m;  2QK0 A;  4LNP A;  1M8M A;  5FWC A;  5GAN d;  3L2V A;  1JRI A;  4PFO A;  1IHV A;  3G6E Q;  2XMF A;  3GOX A;  2QAS A;  4RTZ A;  2RJD A;  1OYX A;  4J6W A;  4D8K A;  1VYV A;  5C6S A;  3FDR A;  4J9E A;  2EJF A;  2K7A A;  4GLM A;  4A54 A;  4DQ2 A;  3OYY A;  2E5K A;  1OU8 A;  5IXB A;  3OMG A;  1M2V A;  5LJ3 h;  2BUD A;  3EG9 B;  3UA7 A;  3CCS A;  4XQ3 A;  2E12 A;  2AZS A;  4M7D G;  2K57 A;  4DOV A;  2QEX Q;  1TWB A;  3M9Q A;  2CSQ A;  2KRO A;  3R6O A;  3OYN A;  3L2Q A;  3JRZ A;  3IQL A;  4HVV A;  3M4G A;  2CZ6 B;  3I55 A;  3LGL A;  3EGD B;  3OYM A;  5KYY A;  1YWO A;  2K4Y A;  1X2Q A;  3CCV A;  1BI1 A;  4LD9 K;  4M7A D;  2M0Y A;  4BAC A;  1K4U S;  3X25 B;  2YUN A;  2GFU A;  3EG2 A;  3L42 A;  3EHQ A;  2LCS A;  2PUK B;  2DTO A;  3RIR A;  2HBP A;  3S3N A;  5I21 A;  4L59 A;  3I56 A;  2Y4X A;  1WHJ A;  3UAT A;  1Q82 R;  4C0G A;  4N4I A;  1RI0 A;  4J9I A;  2DYI A;  4BE1 A;  3PMI A;  2GTJ A;  2BE9 B;  2HKQ B;  1JJ2 A;  1KQS P;  3CCR A;  1IXD A;  4F17 A;  3LH5 A;  4KT0 E;  2JTF A;  3U23 A;  4D6W A;  2KMT A;  3JB9 J;  2VUB A;  3I5S A;  2R58 A;  5GJV B;  4E7Z A;  2X3X D;  3E19 A;  2JZ2 A;  4LD6 A;  2D1X A;  3THK A;  1YJ9 A;  2K5I A;  4HCB A;  1JJ2 P;  3GP8 A;  1ABO A;  3GNF B;  1ZLM A;  2GTO A;  2HNI A;  1W2B A;  2KNB B;  5HKC A;  1R0C B;  2EJ9 A;  2V8I A;  2YUO A;  2KXC A;  4A53 A;  4JRQ A;  2EKH A;  1BBZ A;  4MML A;  3E1S A;  4C5I A;  2KBT A;  2RHZ A;  3RUX A;  4C5G A;  4QVD A;  3QWY A;  3M4Y A;  3LLR A;  2LQ8 A;  5LJ3 d;  3OYK A;  4OGC A;  3J7A F;  1K9M C;  1K73 R;  3PIP A;  1W2B P;  4BY6 C;  2QQS A;  2KI7 A;  2EQM A;  2LCC A;  4C8Q C;  2ED0 A;  2COY A;  2KAF A;  1UGS B;  1FMW A;  4C8Q F;  1AWW A;  1AVZ C;  2BZY A;  5GAN 5;  4WF2 A;  5CAI A;  3OA6 A;  3OBY A;  2E6N A;  1VQN Q;  1X69 A;  1UFF A;  1VQ5 Q;  2HL3 A;  3TEE A;  3X26 B;  3MCA B;  4FW2 A;  1VQ6 T;  4MMK A;  1UGV A;  1HK9 A;  2VGN A;  1AOJ A;  1WHG A;  1VQ9 Q;  2DPP B;  1G8X A;  4HVU A;  3JB9 H;  1A0N B;  2EQI A;  2RJF A;  4EDU A;  4II1 A;  2K3Y A;  4LXC A;  1VIE A;  5D6Y A;  3UF4 A;  2DXB A;  5KE3 A;  1OUL A;  4OGE A;  1AEY A;  1TU0 B;  3VYG A;  3OQ5 A;  5FU6 B;  3A8L B;  1Q86 U;  4OMO A;  3RR6 A;  5GAN 6;  3H0H A;  4FT2 A;  1Q95 G;  1QVF A;  3UDC A;  3X28 B;  1WPY A;  2EJG A;  4JUV A;  4C92 A;  2X9H A;  3UT1 A;  1EFN A;  3ULR B;  1FYN A;  5A0L A;  1RLP C;  3LX7 A;  2D0N A;  1T0H A;  5DM7 R;  3KUF A;  1NYF A;  2PZ1 A;  4QQG A;  2O9V A;  2K2V A;  2MWP A;  2GNC A;  3KBG A;  2ECZ A;  2D9T A;  1B7T A;  3HPW A;  1QVG A;  3MP6 A;  5L23 A;  1G83 A;  2OJ2 A;  2KVQ G;  1AHJ B;  2DD5 A;  3REB B;  3WVD B;  1LNX A;  3QYG B;  1NZ9 A;  2M1H A;  2BKD N;  3C12 A;  4AG2 C;  4JDS A;  5AYF A;  1O75 A;  2DKG A;  2L3Q A;  2RB6 A;  4C0D C;  1JB0 E;  1SSH A;  5L8R E;  1MMD A;  1BIB A;  2DL7 A;  2DX1 A;  4PKC C;  2MWO A;  2FZC B;  3SFM A;  3OYD A;  2J7I A;  4QVC A;  4DBR A;  3C0C A;  3O5Z A;  3HFO A;  1K73 U;  2YRC A;  1Y7X A;  2L0A A;  1AWO A;  4AMC A;  2PUO B;  4PJO E;  2YT6 A;  3NTH A;  4F7U A;  4EMH A;  5DLO A;  4LDX A;  2FEI A;  1UB4 A;  3OS0 A;  4PK4 A;  4TVR A;  2QXF A;  2FPF A;  4RTW A;  4XAX B;  1YHQ T;  3RKX A;  2HCK A;  2E41 A;  2RPN A;  4JJC A;  2C0T A;  3S6W A;  4QT7 A;  1VQ6 A;  2ZPG B;  2KYM A;  3MEA A;  2O01 E;  1K8A R;  2E1H A;  2BZX A;  3UWN A;  1B3Q A;  3CCL Q;  1VQ4 Q;  2LJ1 A;  3TU4 K;  3VS1 A;  4JLI A;  2C0I A;  5GAO l;  2JS0 A;  2RQT A;  4HCC A;  3CMA Q;  3ZBD A;  4E2F B;  3G4S Q;  1VQK Q;  3VV0 A;  2EGE A;  4FT4 A;  2VKN A;  4ELZ C;  2EYW A;  5DY9 A;  2JM8 A;  1WLP B;  1Y07 A;  4J6Y A;  4ESR A;  4MZP A;  2ZPF B;  1ZSZ A;  5HY6 A;  4M7A A;  1RAC B;  4M78 A;  4V2S A;  4YTL A;  2HL5 C;  1TS9 A;  2DIL A;  4FU6 A;  1IGQ A;  2OTJ Q;  2XID A;  4K11 A;  1VQN A;  5HK3 A;  1U3O A;  4VUB A;  1FXX A;  3Q1J A;  5D6W A;  1VQ5 A;  3OW2 A;  2A7Y A;  4OMP A;  2VB6 A;  2QI2 A;  2EYQ A;  2ABL A;  2E5Q A;  2O9S A;  2MF2 A;  3CCL T;  5KE2 A;  2XDB A;  4OB0 B;  4M77 B;  2FG0 A;  3CME T;  1SEM A;  4XU1 A;  2DEQ A;  4M75 F;  3H6Z A;  2DF6 A;  4F04 B;  1BYM A;  3VS6 A;  3EFO B;  4PL6 A;  3G4S T;  1MV0 B;  2XIC A;  4O5V A;  3VUZ A;  4CRI A;  2QTX A;  3BDU A;  2VXF A;  2ZAE A;  2LQN A;  3ASK A;  2FVU A;  1D0X A;  1W70 A;  2F1L A;  2JVV A;  2NUP A;  4DEY A;  4BE2 A;  1IHW A;  1UUE A;  2RHY A;  3RBB B;  1KG1 A;  2DVE A;  3FJP A;  3SB2 A;  1AZE A;  2YUQ A;  2OTJ T;  1WQ7 A;  2RI3 A;  4IUR A;  4J5Y A;  1PD1 A;  3KFV A;  3J80 E; 
#chains in the Genus database with same CATH homology
 2JN0 A;  4DOW A;  1VIF A;  3T9N A;  3JB9 D;  4XU0 A;  4QW2 A;  3CCM A;  4OVA A;  3V8J A;  4HT9 A;  4C92 C;  4JLG A;  3CCE A;  1I4K 1;  3FEO A;  2QQR A;  2WAC A;  5GMK m;  4O6J A;  4PJO D;  4Y91 A;  4C92 F;  5GAN d;  2XDD A;  2FHD A;  3QBY A;  3OS1 A;  3L2V A;  3JCM W;  4L6V 5;  5GAM e;  1M1K U;  1JRI A;  2JTM A;  2R5A A;  2RJC A;  4F7U E;  4ZGJ B;  4LDY A;  4R55 A;  3CC4 T;  4JS5 A;  3QYH B;  2VC8 A;  3C4S A;  5GAM f;  1M90 U;  1XNI A;  3GOX A;  4GLK A;  3JCM g;  4DA4 A;  4E7J A;  4L5G A;  2KSS A;  2M9U A;  2RM4 A;  1G3S A;  4OF1 A;  2RJD A;  3NFC A;  1OYX A;  1UEB A;  3MP1 A;  4J6W A;  5GAN e;  3L2U A;  1YIJ T;  1K8A U;  1M8V A;  2V8J A;  5C6S A;  5LJ3 g;  1W4S A;  3FDR A;  4FSX A;  3O8V A;  4E7I A;  2DIQ A;  2EJF A;  2CS7 A;  5J26 A;  5GAN 2;  4A54 A;  5LJ3 j;  4DQ2 A;  3OYY A;  3JCM h;  3MEU A;  3M55 A;  2ZGW A;  4N4H A;  5GMK e;  1U1T A;  4M7D C;  5FRM A;  3OYH A;  3OMG A;  3V8L A;  3VKI A;  2JOY A;  2MI6 A;  2CGH A;  1UGQ B;  1X75 C;  4OB3 B;  3G71 T;  3RKW A;  4HKE A;  1KQ2 A;  4M7D F;  2RA2 A;  5LJ3 h;  2BUD A;  2EQU A;  3CCS A;  3CBP A;  3N5B B;  4XQ3 A;  3TRE A;  2E12 A;  2KQW A;  4M75 A;  1WJQ A;  1LJO A;  2ZZD A;  2XD0 A;  1VQL A;  4A4H A;  1BIA A;  5CQX A;  4M7D G;  2K57 A;  5CQY A;  2DIG A;  4DOV A;  3WXM B;  3M9Q A;  4LDW A;  1KQ1 A;  2XU8 A;  3M58 A;  3R6O A;  3OYN A;  3L2Q A;  3JRZ A;  3PGG A;  3JB9 F;  4PJO C;  2HD0 A;  1YI2 A;  1KD1 U;  4J6X A;  2K3X A;  2CZ6 B;  3M4G A;  4LDV A;  3I55 A;  3LGL A;  3QO3 A;  3QZ5 B;  3INZ A;  2QDY B;  3OYM A;  4PJO F;  2VXE A;  2K4Y A;  2F5T X;  3CCV A;  1BI1 A;  1B34 A;  1NPR A;  3OYJ A;  4LD9 K;  4M78 E;  4M7A D;  4BAC A;  3G7Z A;  1VQ8 T;  5A0D A;  3JB9 G;  4M77 D;  3X25 B;  1S72 T;  4M75 B;  2GFU A;  3CPF A;  1PSE A;  3L42 A;  4XTY A;  1YIT T;  2V8K A;  2PUK B;  5J39 A;  5GAN 3;  1Q86 C;  3CPW S;  3CCL A;  2DTO A;  3RIR A;  5EG2 A;  4C92 D;  2OTL T;  1VUB A;  2HBP A;  3L2R A;  3S3N A;  1VQ4 A;  1VQ9 A;  2E6Z A;  3CME A;  5I21 A;  3CCU A;  4L59 A;  3JCM Q;  3I56 A;  3M57 A;  2Y4X A;  1Q7Y U;  1Q81 C;  2E65 A;  4C0G A;  2YHT A;  3MP8 A;  5GAO m;  1VQ4 T;  4N4I A;  1NJI U;  3BW1 A;  3SWN A;  3ER0 A;  1RI0 A;  2ZPB B;  3HFN A;  3LWI A;  5CKD A;  2E64 A;  3G4S A;  3M59 A;  4BE1 A;  1VQ7 T;  1B34 B;  2XI9 A;  3PMI A;  4FM4 B;  1ZHI A;  4KUD K;  1JJ2 A;  1ZBX A;  2PQW A;  3CMA T;  1N9R A;  4C0D B;  3CCR A;  5DLQ E;  4ZTJ A;  2QA4 T;  1VQK T;  1OI1 A;  4KT0 E;  3VYH B;  2JTF A;  3CCJ T;  4C8Q D;  1BI2 A;  4D6W A;  3QSU A;  4MDX A;  5FU7 C;  2KMT A;  2B8A A;  1YJW A;  1D3B A;  3V8K A;  4C0F A;  3JB9 J;  2VUB A;  3PIO A;  4N0A C;  4JS4 A;  2R58 A;  2R5M A;  2X35 A;  2CKK A;  3CC7 A;  2LTO A;  1Y71 A;  1UGR B;  3E19 A;  4Q5W A;  2JZ2 A;  3SWN B;  2LDM A;  3QXE B;  3JCM X;  3M5A A;  5CKF A;  4LD6 A;  4A4G A;  4CI0 C;  5GAN 7;  3JB9 I;  2OTJ A;  1YJ9 A;  5CR2 A;  2K5I A;  4HCB A;  2EWN A;  3GP8 A;  4XU3 A;  4A4K A;  4NL3 A;  4M7D A;  4M7A C;  3GNF B;  1YCY A;  4UC4 A;  2X4X A;  3VJP A;  4PLI A;  2AHJ B;  2HNI A;  4M78 C;  4M77 C;  3QUI A;  5HKC A;  1YJ9 T;  2EJ9 A;  2DZ9 A;  4XTX A;  3JCM c;  3DKM A;  3EFS A;  4M7A F;  1GXI E;  2V8I A;  4M77 F;  4E7K A;  1M9S A;  2L3R A;  3QDR B;  3ZEH A;  4A53 A;  4QQ6 A;  3BFM A;  4JRQ A;  3VU3 C;  4MZM A;  2QQB A;  1D3B B;  4RG8 A;  3OS2 A;  5IT9 E;  4MML A;  3E1S A;  3CC4 A;  4C5I A;  4ATO A;  2EQK A;  3TCJ A;  2LC4 A;  3JCM d;  2RHZ A;  1K73 C;  5FRN A;  5GAN 8;  4OMF B;  3RUX A;  5KH6 A;  4C5G A;  4QVD A;  4XTV A;  4KBM B;  3OYI A;  2L89 A;  2EAY A;  3M4Y A;  3LLR A;  5GAN 4;  4BI8 B;  3H8Z A;  2LQ8 A;  1BKB A;  4JJN K;  1YIJ A;  1QVP A;  2JNG A;  3OYG A;  5LJ3 d;  5GAO r;  4C92 G;  3EFR A;  3OYK A;  4OGC A;  3J7A F;  3MO8 A;  1K9M C;  2ZPH B;  3PIP A;  3CEY A;  1N9S A;  4BY6 C;  2QQS A;  3HRS A;  2DO3 A;  2EQM A;  3OB9 A;  4P5N A;  1M1F A;  2LCC A;  3JCM e;  4J8O A;  2VV5 A;  4C8Q C;  5CIU A;  4XTZ A;  4JRP A;  2EIF A;  4Z02 A;  2CZ1 B;  3JCM f;  3OS5 A;  2KAF A;  3G71 A;  1UGS B;  4C8Q F;  2F69 A;  5HK0 A;  3S3M A;  2D6F A;  3V7C A;  2YRV A;  5LJ3 e;  3GPL A;  3RMS A;  2DXU A;  5GAN 5;  4IUQ A;  2PVG B;  2GF7 A;  1N27 A;  4WF2 A;  5CAI A;  5LJ3 f;  2LVM A;  3OA6 A;  3OBY A;  2E6N A;  3RKY A;  4C8Q G;  2CZ7 B;  2G3R A;  4X9D A;  5GAO p;  1QP2 A;  1XQH A;  3F70 A;  3TEE A;  4HT8 A;  3X26 B;  3FC3 A;  3L2Z A;  1G5V A;  3MCA B;  2LT1 A;  1VQ6 T;  3JSC A;  3LYI A;  4MMK A;  2XDP A;  1HK9 A;  2VGN A;  4M75 E;  1KC8 C;  2DPP B;  5CO7 A;  3ZFJ A;  4B9X A;  1KHI A;  1WNL A;  3JB9 H;  1KHC A;  2X4Y A;  3X24 B;  5CCA A;  4R56 A;  5FRO A;  4XU2 A;  3OMC A;  1VQ8 A;  1JBM A;  4J7F A;  3GIB A;  1S72 A;  2RJF A;  3P8H A;  2HQE A;  4J5Y A;  1YIT A;  2MAM A;  4EDU A;  1YJN T;  3OYC A;  3G6E T;  1BI3 A;  4II1 A;  1P92 A;  3MEV A;  1N8R C;  1KQS A;  3L1A A;  1M1G A;  2K3Y A;  1VIE A;  3A8M B;  4M78 D;  5D6Y A;  2OTL A;  2RI2 A;  3FB9 A;  1KQS S;  1Q82 C;  1XOV A;  2DXC A;  3OYL A;  2P4T A;  1IRE B;  2DXB A;  4F7U F;  5KE3 A;  2IVW A;  4PJO G;  4EPC A;  4OGE A;  5CKB A;  2DJZ A;  3PMT A;  3URG A;  4RKU E;  2PU9 B;  5KCH A;  3VYG A;  3PFS A;  3OQ5 A;  2ZPE B;  4J83 A;  5FU6 B;  4EMK A;  2RI5 A;  4ZGD B;  3A8L B;  1HXD A;  3CCQ A;  1VQ7 A;  1RL2 A;  4LDU A;  4RCB A;  4FIB A;  4F7U G;  1Q86 U;  3CBO A;  5GAN 6;  5CKE A;  2YLB A;  4BD3 A;  5I2M A;  3CMA A;  4QVZ A;  4FT2 A;  3ME9 A;  1XTD A;  3UDC A;  1QVF A;  3X28 B;  1WPY A;  2EJG A;  4JUV A;  3V7S A;  2RD1 A;  4C92 A;  3CCQ T;  2QA4 A;  1VQM A;  1VQK A;  1QVF S;  3CCJ A;  3UT1 A;  3CC2 T;  2LRQ A;  2YLC A;  3JCM J;  1Q81 U;  1G3T A;  1WGS A;  4C92 E;  1JJ2 S;  4OB1 B;  4NL2 A;  2FB7 A;  4C0Z A;  1VQM T;  3DB4 A;  1VQO T;  2C06 A;  1MHN A;  3DLL A;  5A0L A;  3LX7 A;  3P8B B;  2L5Q A;  4KUL A;  5DM7 R;  2K5F A;  2Y90 A;  5GMK l;  2QEX T;  3P8D A;  4OB2 B;  4EMK B;  4M75 C;  3KUF A;  1G3Y A;  3RMQ A;  3V7R A;  3PTA A;  2F5K A;  5CKH A;  4QQG A;  3FIF A;  2FL7 A;  2K2V A;  2MWP A;  2VYT A;  5IAY A;  2VGM A;  4RMO A;  2IG0 A;  3KBG A;  2D9T A;  4XK8 E;  4BE0 A;  4FL6 A;  3FRN A;  2E10 A;  2P0Q A;  3HPW A;  4C92 B;  1V29 B;  2O4X A;  1QVG A;  3MP6 A;  1EIF A;  1N6A A;  1QVG S;  2X4W A;  3CC7 T;  2QQA A;  2KVQ G;  1AHJ B;  1QP3 A;  2DD5 A;  1ZQ1 A;  2RHI A;  2FYK A;  3EAE A;  5LJ5 g;  3OYB A;  3WVD B;  1LNX A;  3QYG B;  5M9O A;  4A4E A;  1SSF A;  1NZ9 A;  1QW1 A;  5LJ5 j;  2M1H A;  3DB3 A;  2KDS A;  1W2B S;  3LW5 E;  2BKD N;  4M7D E;  2LQK A;  4M78 F;  4ZTF A;  3QG1 A;  3UPU A;  3HHT B;  3C12 A;  2LT4 A;  4JDS A;  5AYF A;  1O75 A;  2DKG A;  1PSF A;  3RER A;  1DJ7 B;  2RB6 A;  4C0D C;  1JB0 E;  4BI3 A;  2E70 A;  2RK1 A;  1VQP T;  4QQD A;  3BDL A;  5L8R E;  3C94 A;  3M54 A;  5LJ5 h;  4M7A G;  1BIB A;  4KUI A;  4M77 G;  3OSV A;  3OBW A;  3M53 A;  3QZ9 B;  4M78 G;  4PKC C;  4C5E A;  2RHX A;  2MWO A;  2LCL A;  1IZ6 A;  2O4X B;  2WSE E;  3SFM A;  3OYD A;  3CBM A;  1OZ3 A;  4QVC A;  1I81 A;  4PJO A;  4M7D B;  3HFO A;  1K73 U;  1WJR A;  1Y7X A;  4ME7 A;  1WQW A;  2OAU A;  3SWN C;  2RJE A;  1M1K C;  5LL6 S;  2ZCF B;  1I8F A;  3BY7 A;  2PUO B;  4IUV A;  5GAM g;  4PJO E;  3QII A;  2GFA A;  2Y4Y A;  3NTH A;  1M90 C;  5GAM j;  2DTI A;  3JCM P;  1TH7 A;  4F7U A;  5CK9 A;  3LGF A;  4EMH A;  1YHQ A;  1YBY A;  2XK0 A;  3HRU A;  5DLO A;  3CCM T;  1K9M U;  4LDX A;  4ZN1 A;  1UB4 A;  3S3O A;  3CCE T;  2L8D A;  3OS0 A;  2BIV A;  3QJ6 A;  2QXF A;  4TVR A;  1K8A C;  4XAX B;  2RK2 A;  2WSC E;  1YHQ T;  2XG8 D;  3NTK A;  3A8H B;  4IUP A;  4BB7 A;  5GAN g;  3RKX A;  5GAM h;  2E41 A;  2LX9 A;  1UGP B;  3J81 E;  3GF5 A;  1OZ2 A;  5GAN j;  3NTI A;  3HP9 A;  3S6W A;  1VQ6 A;  2ZPG B;  2DK3 A;  3OY9 A;  3MEA A;  4PJO B;  2O01 E;  1U1S A;  3OSS C;  3MET A;  3CXC A;  2H3J A;  2E1H A;  3HRT A;  4OP0 A;  3SD4 A;  2EKO A;  3CXC S;  3UWN A;  5GAN f;  1M5Q 1;  3QJY A;  5GMK j;  2HAX A;  4HCZ A;  4JRI A;  2JUF A;  5IN1 A;  5GAN h;  3OYE A;  4PNO A;  3TU4 K;  4F7U B;  3E9G A;  4M75 D;  3JAM E;  2XHC A;  3SDZ A;  3GNG A;  3X20 B;  2DZC A;  4JLI A;  3C95 A;  5GAO l;  4HCC A;  1YJN A;  4EMG A;  3G6E A;  1X6O A;  4MDW A;  5GMK h;  3HKS A;  3ZBD A;  1KC8 U;  3FLG A;  3OYF A;  3A5Z B;  3QPH A;  3VV0 A;  1FWZ A;  4Y28 E;  1I5L A;  4N0A A;  4FT4 A;  5KCO A;  2P0P A;  2DD4 A;  1M4Z A;  3KXT A;  3OYA A;  4ELZ C;  4BI4 A;  1KD1 C;  5DY9 A;  3CCS T;  4BDY A;  1FX7 A;  1Y07 A;  1H64 1;  3CD6 A;  1NPP A;  2MMP A;  4JRK A;  3MEW A;  2PVD B;  3DLM A;  2LNV A;  4J6Y A;  1VQL T;  4MZP A;  2ZPF B;  4IUU A;  2HQX A;  1N8R U;  5HY6 A;  4M7A A;  3CD6 T;  1Q82 U;  3MHX A;  4M77 A;  4M78 A;  5J3B A;  5FLX E;  4YTL A;  3WVE B;  3JCM V;  4B9W A;  5A0G A;  5I2S A;  4V2S A;  4IUT A;  2XKO C;  3CC2 A;  4M7A E;  2PVO B;  4C5H A;  2RHU A;  5FU7 B;  3JCM b;  4FU6 A;  1YI2 T;  4M77 E;  2XID A;  3I55 T;  1Y96 A;  3GLX A;  5HK3 A;  1VQN A;  4VUB A;  2X4J A;  1FXX A;  3AHU A;  3Q1J A;  5D6W A;  1VQO A;  2DXT A;  1VQ5 A;  4XTW A;  1O9S A;  3OW2 A;  1Q7Y C;  3CCV T;  2CYZ B;  1BI0 A;  4X9C A;  3CPW A;  4A4F A;  3OW2 S;  2A7Y A;  1VQN T;  1NJI C;  2QEX A;  2WSF E;  2QI2 A;  1VQ5 T;  4X34 A;  2EYQ A;  4RCC A;  2E5Q A;  4HA8 A;  2MF2 A;  4N4G A;  1W2B A;  3CCL T;  4NOY A;  5KE2 A;  1U8R A;  4M7A B;  4BDZ A;  2XDB A;  2KK4 A;  2RO0 A;  3HL8 A;  5A2Q E;  4E7L A;  1VQ9 T;  4ZN3 A;  4OB0 B;  4M77 B;  4M78 B;  3CME T;  2M16 A;  3CCU T;  2EQJ A;  4XU1 A;  3I56 T;  4ELY C;  2DAQ A;  1WJS A;  2DEQ A;  4M75 F;  3H6Z A;  4C8Q A;  2R57 A;  2P0K A;  2GQV A;  3E9F A;  3VUB A;  5LJ5 d;  1Y96 B;  2CZ0 B;  1BYM A;  4MZT A;  2K5L A;  5FU6 C;  2A3L A;  4PL6 A;  3QKJ A;  3G4S T;  4C8Q E;  4PLL A;  2M0O A;  2XIC A;  5C0M A;  2EFI A;  3PNW C;  4O5V A;  3VUZ A;  3L2W A;  4BUG A;  4CRI A;  4M75 G;  2QTX A;  3BDU A;  2VXF A;  3M56 A;  3HSB A;  2NLU A;  3CCR T;  2ZPI B;  3QHS A;  4E7H A;  5CVI A;  3RES A;  1VQP A;  1MGQ A;  3ASK A;  4GY5 A;  1R8O B;  1X01 A;  2FVU A;  4M7D D;  4RG2 A;  2RH2 A;  1NE8 A;  1LOJ A;  5LJ5 e;  2D0Q B;  3A8O B;  5GAO q;  2KY9 A;  2JVV A;  1YJW T;  1G3W A;  4BY6 B;  5LJ5 f;  4BE2 A;  2RHY A;  4IKF A;  1KG1 A;  2DVE A;  4C8Q B;  5GMK i;  5GAO n;  3FJP A;  5D6X A;  3SB2 A;  4E47 A;  3LWH A;  4NS5 A;  2GCX A;  5GAM d;  2DTH A;  1WQ7 A;  4XTU A;  4EMK C;  2OTJ T;  1H3Z A;  3A8G B;  2RI3 A;  4J7I A;  2I2L A;  3LH0 A;  2QQ9 A;  4IUR A;  4ZGE B;  3PT9 A;  3J80 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...