2PUOB

Crystal srtucture of the nem modified ferredoxin:thioredoxin reductase
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
73
structure length
73
Chain Sequence
MNVGDRVRVTSSVVVYHHPEHKKTAFDLQGMEGEVAAVLTEWQGRPISANLPVLVKFEQRFKAHFRPDEVTLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural snapshots along the reaction pathway of ferredoxin-thioredoxin reductase.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Electron transport
molecule keywords Ferredoxin-thioredoxin reductase, catalytic chain
total genus 11
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02941 FeThRed_A Ferredoxin thioredoxin reductase variable alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2puoB00
3WVDB 2PUOB 1JB0E 3X24B 1DJ7B 1UGSB 1UGRB 2WSCE 3X26B 1GXIE 1UGQB 3A8LB 2CZ1B 2DXCA 2PU9B 2ZCFB 2ZZDA 1QP3A 2PVOB 3QXEB 4Y28E 4ZGJB 2ZPHB 3A8HB 2AHJB 4KT0E 3HHTB 4OB2B 2ZPGB 4L6V5 1V29B 2ZPIB 2ZPFB 3A8GB 3X20B 2DD4A 5L8RE 4XK8E 2CZ7B 1PSFA 2DD5A 2DXBA 2WSEE 3QZ5B 3QZ9B 4FM4B 3A8OB 2WSFE 2CZ6B 3A8MB 4OB1B 3X28B 4ZGEB 1QP2A 4OB0B 3X25B 3QYHB 2O01E 1PSEA 3QYGB 4ZGDB 1UGPB 2PVGB 2D0QB 3VYGA 4OB3B 3VYHB 3LW5E 2PVDB 4RKUE 1IREB 3WVEB 2CZ0B 2QDYB 2ZPBB 2PUKB 2ZPEB 1AHJB 2DPPB 2CYZB
chains in the Genus database with same CATH superfamily
1H3ZA 2QA4T 4FT4A 2E65A 4LNPA 5GANe 4A4HA 2VXFA 1X2QA 5A0DA 3FB9A 2BE7D 2IVWA 2WSFE 5GANg 3PIOA 3G6EQ 3VS0A 5DY9A 5IAYA 2JUFA 1TUDA 1YI2Q 2M0OA 1R77A 2HBWA 1XTDA 3TCJA 1KQSA 1IXDA 1ZUUA 4M75F 3CMEQ 4WF2A 1N27A 3CPWP 2BIVA 4XTUA 1R8OB 4OMMA 3M54A 1UHCA 2L3QA 4J9HA 3NHNA 3META 3ASKA 1Y96B 2E5QA 2L8DA 2DERA 2YWWA 4EMGA 3OA6A 2A3LA 2C06A 3GBQA 4A4GA 5GAN5 2K3BA 1UEBA 2QDLA 4M75D 2LVMA 3T9NA 4E7SA 3CMEA 1WJRA 3HFOA 1WXUA 3MKDA 4L6V5 1BI2A 1Y96A 4Y92A 1U3OA 3FRNA 3G4ST 2NLUA 1KJWA 2EQUA 3S3OA 4KGVB 2CP6A 1XOVA 2NUTA 1QP2A 1SHFA 3CXCS 2E6ZA 2H3JA 4K11A 2ZPBB 4QKUA 3NTKA 2HKQB 5LJ3e 5GAMh 1I8FA 3EG9B 2DIQA 1X01A 3VUZA 5IXFA 1TTHB 4MMKA 5A0LA 4NOYA 3RERA 1M1KR 2JJ9A 3VRYA 3OYKA 1TUCA 2DVJA 4FL6A 2LT1A 4MDWA 4AG2C 4ZGEB 4OMFB 1GCQA 2P0KA 3BDUA 3CXCA 2HMAA 3VV0A 1VQOA 2PNIA 4C8QG 4IURA 2HL5C 2RHZA 2EGCA 4M78E 3RR6A 1VQ6Q 2QGFB 4M7DF 2QQBA 3PVLA 5CKEA 2XICA 4XTYA 4C0FA 2GQVA 4ORZA 4XTZA 2KEAA 3CC7Q 2L0AA 5FLXE 3REBB 2X4YA 3LWIA 1Q86C 1M30A 2J7IA 1BKBA 3I55T 1QW1A 1VQMQ 1NYFA 2RJFA 3O5ZA 3CC7T 3IQLA 5GMKi 2MCNA 1RAIB 4UC4A 2QA4A 4IIOA 2QTXA 2RPNA 4DBHA 4OB2B 4LDWA 2VV5A 2D1XA 2H8HA 2X4JA 4A63B 1ZQ1A 1VQKT 1PD0A 2YSQA 1YJ9A 2FPFA 4JRQA 2ED0A 3HTRA 1VQ4T 2EKOA 1HD3A 2FZKB 1GRIA 2P0QA 4N4HA 2KXCA 1MMAA 2R5AA 2ZCFB 1GFDA 1W1FA 1WHKA 3M4YA 3JB9G 4FW1A 4QVCA 3DB3A 1LVKA 4M7AE 3RMQA 1OPKA 1D1CA 2LRQA 2MIOA 4OB0B 1VQKQ 3OS0A 3UF4A 4EMKC 3QJYA 3LW5E 2RI5A 4E7KA 2JXBA 3OW2A 1OZ3A 3JCMe 2LJ3A 4FSXA 3X24B 1ARKA 4BI3A 3A8LB 4B6MA 1YITT 4X9DA 2RMOA 2MAMA 2ZPFB 3J7AF 2YRCA 4M78D 3INZA 2QEXA 2RF0A 2DXTA 1M8MA 1W2BA 1VQKA 1HYOA 2K5FA 2FO0A 1KQ2A 5GAN3 1AZEA 5FRNA 4QQDA 2PVDB 3E19A 2X51A 2GF7A 3I35A 2KRSA 3BY7A 3G71A 4BDYA 3S6WA 2XDDA 3SHWA 3REAB 1KD1R 1JO8A 1V29B 2QEXQ 5M9OA 2XI9A 3CCUA 1FWZA 1Q7YC 3EHRA 2CUBA 2M51A 1FMKA 3CCRQ 4BE2A 1Q81C 1UDLA 4KGZB 4CC7A 4RCCA 1WXBA 1O75A 2VASA 3CCQQ 4DA4A 3MHXA 2EGEA 4F7UE 1XJWB 1PHTA 1Q82C 2A08A 3I5SA 4F14A 1RI0A 4PJNA 2JS0A 3C94A 2PQWA 1QMCA 5I21A 5I2SA 3EAEA 3SWNA 2EW3A 3JSCA 3CCRA 5KCHA 3RNJA 1KG1A 1SSFA 3JCMX 1NYGA 2KGTA 4PK4A 1HXDA 4LXCA 1MV0B 3KUFA 1OZ2A 3OYBA 2V26A 1GL5A 2R5MA 4BI8B 1VQLA 4D6WA 2Z0WA 3EGXA 2KAFA 3LX7A 3M0QA 3OQ5A 1WPYA 3RESA 4JS5A 2D0NA 5IXBA 1WNLA 4ELYC 5FWBA 1N5ZA 3VJPA 2DPPB 2DTHA 3CBMA 3V7RA 4N4GA 3H0FA 2CZ1B 4QT7A 2PVOB 2QG9B 1ZBJA 2HDAA 2JT4A 1WHLA 2L2PA 4JRPA 4PJOC 1YJ9T 1SHGA 2QQ9A 2RQUA 3GNGA 2DZCA 1YP5A 2ENMA 2QASA 1PRMC 2G6FX 3C4SA 1IGQA 9ATCB 3OYJA 5LJ3j 1OOTA 1YIJA 1UB4A 3ZEHA 5CK9A 8ATCB 3CCMA 1VQ7Q 4OVAA 2AIRB 1RADB 2FVUA 1JXOA 3FJPA 3MPUB 3OS5A 5GAMf 4OMNA 3CCST 1QWEA 3R6NA 1PM3A 1VQ4A 2K2VA 4PFPA 1BIBA 2Y4XA 2K5LA 1JB0E 5J26A 2QAZA 1M8VA 4C92F 4Y28E 2ZPHB 5LJ5d 2DL8A 5GMKh 4KUDK 3GF5A 3JCMV 4PJJA 5CQXA 4C8QF 3JCMh 5IHIA 3EG0A 2AKLA 1QCFA 3UWNA 3CEYA 3CCEA 1VQ6T 4J83A 1Q7YU 2VXEA 1G83A 4DEXA 3I55A 1WQ7A 3QKJA 1W4SA 4KT0E 1QVGA 4KULA 3JCMc 2KYMA 4IUTA 2KBTA 2LMJA 2KK4A 2QQSA 1WHGA 1IZ6A 2DL7A 2RM4A 3SD4A 4E47A 2NUTB 1ZUKA 1UTIA 3ER0A 2JOYA 1KD1C 2M9UA 1FX7A 5KYXA 1WA7A 2CREA 4M75E 5LJ3f 4DEYA 1M1FA 1VQ5T 2CP2A 3M0RA 2CH4A 2OTLA 1OYXA 4RG8A 2RN8A 5KYWA 2DEUA 2A7YA 2RA2A 2LNHB 3EGXB 2FYKA 3UA7A 2K57A 1N8RC 1OU8A 5GAOr 4MZPA 3MEVA 1IREB 4JJCA 4B9WA 1PRLC 1RL2A 1ABQA 2DRKA 1NEGA 4A54A 2V8IA 2PUOB 1NLPC 3RKYA 3EFOB 1S72T 1S72Q 1W2BP 4N0AC 4XU1A 1PCXA 1H92A 3CC4A 3O8VA 1YHQA 4NS5A 2ROLA 2DD5A 3VS2A 2QQAA 1HK9A 1VQ9Q 3MCAB 2QYZA 4R0KA 2E10A 1QLYA 2DIGA 4RTTA 4A4KA 1VQ5Q 2XIDA 4ZTFA 2RHXA 1HJDA 4ZN1A 1UJ0A 2DILA 5J39A 1K1ZA 1YN8A 2K3YA 2O2OA 4JJNK 2FEIA 2EYZA 4OMOA 4II1A 2GBQA 1Z9ZA 3CMAT 4OF1A 2CZ0B 1JEGA 4J9GA 3BE3A 1Z9QA 1M3AA 3CCSQ 1JU5C 4XTXA 2KXDA 1VQ5A 2D9TA 2HZYA 2NUPA 3THKA 4PJOE 3LLRA 5GANd 1WIEA 2LQ8A 2VB6A 4A4FA 2LX7A 5FU6C 3CC2T 3KBGA 2FPEA 1KHIA 2VC8A 2Y90A 3X28B 1VQ8Q 1TG0A 3EFOA 5IT9E 4R56A 4M75G 4OMQA 2CP3A 2JZ2A 3LH0A 2LZ6B 2ZPEB 1D09B 1ZSZA 5LL6S 4M7AB 2CT3A 1EZZB 2RK1A 1PG5B 5GMKe 1K9MC 4OMPA 4MZTA 5C6SA 5CKHA 3BW1A 8AT1B 5KYUA 1IO6A 3CCET 3GPLA 3QYHB 1YNZA 2VUBA 1I07A 1UGPB 2A0FB 1G3TA 1MMDA 4D8KA 1WGSA 2HNIA 2K2MA 2JS2A 2NUPB 1GXIE 4FYVB 2O9SA 2P84A 4NL2A 4C0DC 2DNUA 3EGDA 1QCOA 3DKMA 4ZGDB 3PMTA 2W10A 1R0BG 4DOWA 2OJ2A 4BUGA 4C92A 4C8QC 1N8RU 3HFNA 1NG2A 1RABB 2DLPA 2O9VA 4F7UB 5D6WA 1X75C 5DM7R 5LJ5g 1VQLT 4C0GA 5EC7A 2XK0A 2DAQA 2C0OA 2G3RA 1M2OA 1KK7A 2IIMA 3V7CA 1SSHA 1UGVA 3CC2A 1M5Q1 2JMAA 1CKBA 1BI1A 1TU0B 3P8DA 1QVFA 5IHKA 3PTAA 4D8DA 3L2WA 2RO0A 1NJIR 5GMKm 4KRTA 4HT8A 4QQGA 1PWTA 2HBPA 4FM4B 4CC2A 2RHIA 1I0CA 2QI2A 5FU7C 3G71T 3CC2Q 1OX9A 5D6YA 4FW2A 4BDZA 1QVGP 3L2RA 4A53A 2EQMA 5CO7A 1ZHIA 4FCYA 4BY6B 1YJNQ 2K9GA 5ECAA 3CCLT 5HKCA 3E9GA 1GCQC 1KD1U 3URGA 4M78G 1VIFA 1RAEB 3H6ZA 4V2SA 2EYQA 3EFSA 3A8OB 1ZA2B 4ME7A 4O6JA 4IUVA 2COZA 3EG1A 1C1AA 4GBQA 4RKUE 2E5KA 3HRUA 3HP9A 2K3XA 3OBYA 4HCCA 1MMGA 1WI7A 3MJXA 1NJIC 4M75A 2XU8A 2KRNA 2JTFA 2RQRA 2EPDA 5GMKl 2X4WA 4HKEA 3JB9D 3CBPA 1KIKA 3LH5A 2J6OA 2D8HA 3HRSA 4XU0A 4Z02A 2LDMA 2V1RA 2X4XA 1UE9A 1VUBA 3SWNB 3PFSA 2NUZA 2KR3A 2ZZDA 2ZPGB 2B8AA 2LQWA 4PJOG 4XAXB 5EG2A 2H3EB 4HVWA 2K4YA 4PLIA 4M78C 5KYXB 5GANh 5D6XA 4C92C 4GY5A 4OGCA 4TVRA 2CSIA 4CC3A 2NYSA 1BU1A 4OB1B 2M0YA 2F2WA 1ZA1B 3QO3A 5A0GA 2DFUA 3CD6Q 2BKDN 4C92B 4M75B 1G8XA 1VQNT 2F1LA 3CMAQ 3M5AA 4Z89A 1OPLA 3M0UA 3CCVQ 1GBQA 3SDZA 2COYA 1LNXA 4LDXA 4FYYB 2YT6A 2OTJA 3OYEA 1D3BB 3M0TA 1IGUA 2P4TA 3CCJQ 2EYXA 3RDVA 2RJEA 4JZ3A 4MMLA 3TEEA 3F70A 2FZGB 5I2MA 3CCVA 3QPHA 2DTOA 1EIFA 5FU6B 3CCUT 1YWPA 1ZX6A 1RACB 2HQXA 1M90U 1SG5A 2OTJQ 1YCYA 3TSWA 1D0XA 1NPPA 1B34A 1M3CA 1VQNQ 3G4SQ 4PLLA 2KVQG 4B9XA 1BCOA 3VYGA 4E7ZA 2L89A 3NTIA 2MYSA 1M90R 2JM9A 3OYLA 4RUGA 1NE8A 3G4SA 3E1SA 1WX6A 3JB9H 2WACA 3MP1A 5I11A 1K9AA 1ZSGA 1K8AC 3NTHA 2EVRA 3N5BB 1VQ8T 3ZFJA 2EYYA 3JCMP 2OAUA 3OB9A 2RB6A 4LUEA 3CXCP 2RJCA 1ACMB 1N9RA 4X34A 1H8KA 3FLGA 5FRMA 2LCLA 2E70A 2PUKB 2BUDA 2RI2A 3PVQA 2FL7A 3FC3A 4MDXA 1M3BA 2MI6A 1D1BA 4IUQA 5KCOA 1MUZA 1T0HA 5CKDA 3EGDB 2FRWA 5HCKA 3S3MA 2EBPA 1Y0MA 5AYFA 1EX4A 4C5GA 4RTYA 4ZTJA 5GAN4 5IH2A 1NPRA 1X6BA 5GAOn 5I22A 3OYAA 4M7DA 1K73R 2X35A 3GNFB 1LOJA 2FPDA 2VKNA 2DETA 4F04B 1D1AA 4RTUA 2HAXA 4J6WA 2DYBA 2GFAA 2MMPA 2XKOC 2DL5A 1AHJB 2YHTA 3H8ZA 1QWFA 3WXMB 1X43A 4KGXB 4PJMA 5KE2A 3CC7A 1BK2A 1JXMA 1YJWQ 5CKBA 3HSBA 2DBKA 3NFCA 4PJOD 5C0MA 4AG1C 2HL3A 2CP5A 2J06A 2M02A 3ULRB 2LNVA 4M77C 4M7AC 2DZ9A 2WSCE 4EMKB 2F69A 1UFFA 3OYMA 4M77D 2C0IA 2JTMA 1E7OA 1K0SA 3QWYA 3QIIA 1MGQA 2J6FA 1YJWA 5CKFA 1ZBXA 5IHNA 2DO3A 5CIUA 2EWNA 1KQSS 3A5ZB 2YDLA 3EH2A 5HY6A 5CVIA 4P5NA 4R55A 2RD1A 1SPKA 2KSSA 2M16A 5GAMg 3NPFA 1VYTA 4M7AA 2MK5A 1W70A 4CRIA 3VS6A 4JUVA 1C0MA 4FSSA 4PJLA 1YBYA 2KT8A 3VRZA 3VKIA 3X25B 2YXYA 1RAGB 1AWWA 2GNCA 3UATA 3Q1JA 4XU2A 3BDLA 5LJ3d 1BIAA 3A8HB 4PNOA 5KYWB 1VQPA 2DD4A 1N6AA 2HKNA 2GFUA 4YTLA 1Y71A 2V8JA 3QDRB 3FIFA 3OBWA 1P92A 1UJYA 2HEQA 2IG0A 3JB9I 2PU9B 4J9EA 1ZLMA 3FJ5A 4MZMA 1G3YA 1N8RR 3MEUA 3CCUQ 3G6EA 4L5GA 3A98A 4N4IA 5KH6A 3SWNC 1WJQA 1XNIA 4OP0A 2VGMA 4KUIA 1M4ZA 2MOXA 1RLPC 1AZGB 4M7DB 1K73C 3CCQA 1I81A 2VVKA 1WDXA 4AFUC 1SRLA 1WQWA 5DLOA 2XD0A 3A8GB 2BZ8A 5KYUB 1WHHA 1JJ2P 2CZ7B 1PNJA 2EIFA 3PE0A 1M1KU 3QYGB 2NWMA 3BFMA 1K8AU 3V8KA 1OV3A 4Z88A 4M77A 3R6OA 1B7TA 3E2UA 2DYIA 2HSEB 5GANf 4F7UA 3M0SA 3RKXA 1G3SA 3OMCA 5J3BA 1YHQT 2O31A 4E6RA 3OYGA 2E4HA 3JCMg 2DJZA 2LQKA 4PJOA 3CCLQ 1ZSZC 4IKFA 1O9SA 2YUQA 4J7IA 1K8AR 1GBRA 1AWJA 3TSZA 4C0ZA 1E6HA 4FYWB 2RHYA 2K5IA 2O4XB 1G5VA 2HSPA 2GGRA 5IN1A 1M90C 3CPWS 2OTLT 4X1VA 2E12A 2JM8A 1K0XA 1RI9A 1TXQA 2LT4A 1Y57A 4C8QE 3CCLA 1VQMT 2LC4A 2C0TA 1OI1A 1YFNA 3U23A 4EPCA 3VU3C 1VQOQ 1TOVA 2J05A 5KE3A 1VQ6A 4J8OA 1IHWA 2X3XD 2ABLA 1UHFA 1I4K1 4EDUA 4GLKA 1UUEA 2LJ1A 4ZGJB 3JCMf 3FEOA 1YI2T 4KBMB 1YIJQ 1JJ2S 1V1CA 4HVUA 4L59A 5CR2A 2EJGA 2ED1A 3CCMQ 1VQ7A 4FYXB 1SEMA 5GAMj 1VQMA 3C0CA 4DBFA 1MHNA 2D0QB 1OULA 5GAN2 3WVEB 4M78B 1AWXA 3AT1B 2QA4Q 2O4XA 1YITQ 2K79A 1M2VA 2DK3A 3MEAA 2LTOA 1TS9A 2DMOA 1YIJT 1X2KA 4Z8AA 3EG2A 2WSEE 3QUIA 4XTVA 1YJ9Q 2V1QA 7AT1B 3PMIA 2RQWA 4AT1B 1N9SA 2I2LA 4EIKA 4M7DE 3CCJT 1YITA 4ZNXA 5GJVB 1QQJA 3I9QA 4M77B 4RTXA 1BI3A 2ECZA 5GANj 1MNDA 1K73U 1D3BA 4JZ4A 2RNAA 4LDVA 3L2UA 2A28A 4BACA 1WLPB 1BB9A 2E64A 1JRIA 2PVGB 4PJOB 1E6GA 4C92G 2JMCA 4LDYA 3JB9F 1Q82R 1M1GA 1DJ7B 2OX7A 2BZXA 3OYHA 1Q95G 2YUPA 4M77G 1W2BS 2X3WD 3L2VA 4BY6C 2ATCB 2OTLQ 4RTWA 4JDSA 3ZBDA 1GFCA 2QK0A 1W6XA 1LCKA 2LJ0A 3G6ET 1AD5A 5GAOm 4C5IA 2L3SA 2DXUA 1NM7A 2CDTA 2RH2A 1PC0A 5KYYB 3G71Q 5GAOp 2XDBA 2DA9A 4M7AD 1T3LA 1AWOA 2OAWA 3OMGA 2FB7A 2L3RA 3CC4Q 4M7AF 1YHQQ 1X6OA 4M7DG 2CGHA 2VYTA 2KYBA 3RIRA 3UDCA 2BTTA 1C6VX 4VUBA 1VQPT 1BYMA 5GAN6 4J9IA 2CUDA 3G1JA 3OW2P 1IRXA 4OGEA 4JRIA 1V76A 1U8RA 2GTJA 1NZ9A 3ZL7C 4FT2A 2VWFA 4JRKA 3HRTA 3PIPA 2DXBA 1EFNA 1IB8A 4JLGA 3OYFA 4AFSC 4OB3B 4IIMA 2E6NA 2LCCA 2AKKA 3EG3A 3EGUA 3RMSA 1T0JA 3WVDB 2M1HA 4ELZC 2VGNA 2EFIA 2EJFA 5DLQE 3VS4A 1BCMA 5L23A 1VQLQ 3SEMA 2PTKA 3D7SB 3MP8A 1CKAA 3VUBA 2DTIA 1KC8C 2JN0A 1FXXA 3M4GA 2CYZB 4E2FB 2E3IA 3X26B 3G7ZA 2DXCA 3S3NA 1QKXA 3M59A 4RMOA 3GP8A 1VYUA 4DBRA 3KXTA 3PT9A 3GOXA 4EMHA 1VYVA 2HCKA 3LGFA 3OY9A 1Q86R 3CBOA 4J7FA 4JPBW 1VQ9T 3JB9J 2L3PA 3MP6A 1R0CB 3VS3A 3SFMA 1UGRB 1FYNA 4E7HA 3QXEB 4M77E 4J9CA 4KH1B 3QDFA 5FWCA 4Y91A 3M57A 3DB4A 2KT1A 2EQIA 1JJ2A 1BI0A 4LDUA 4M7DC 4LN2A 1U5SA 5KYNA 1OX8A 4PL6A 1SKUB 2DJQA 1VQ4Q 1M1KC 2EKHA 3L1AA 2A36A 1M27C 1B3QA 3L42A 2X9HA 2L5QA 5AT1B 1HSQA 3CCVT 3CCEQ 4M75C 2K7AA 2YLCA 3ME9A 5D7UA 4RG2A 2K6DA 4NL3A 1QKWA 1X27A 4J9DA 3I55Q 2DE0X 2F5TX 1NLOC 3QWXX 3HL8A 3EG9A 2QGGA 1ZSZB 3FDRA 4XK8E 3QZ5B 4JLIA 2DEQA 2XDPA 5LJ3g 3PGGA 1IHVA 2IPOB 2GQIA 3JCMb 2EJ9A 4X9CA 3LWHA 2RJDA 3C12A 2BE9B 4AFZC 4C5HA 1K9MU 5GMKj 3UT1A 1WJSA 4QVZA 2DM1A 3TVTA 2CP7A 3C95A 5CAIA 4AMCA 1RAAB 1VA7A 3HHTB 2GCXA 3OYNA 2EGAA 1WXTA 4HCKA 4AFQC 2B86A 2DBMA 1S1NA 4J6YA 3JRZA 2KI7A 2RQTA 2JVVA 2E1HA 4J6XA 4ANJA 4ESRA 1LJOA 3V8LA 4QVDA 3J81E 2DL3A 1S72A 4O5VA 2CT4A 4Q5WA 3J80E 4C8QB 1JBMA 3X20B 5L8RE 2LP5A 1VQ9A 2RI3A 3UA6A 1UECA 1D0ZA 2LX9A 3TU4K 4PFZA 4HCBA 1A0NB 2DF6A 2EYWA 2D8JA 2ROTA 4HT9A 3VS5A 1NEBA 2KY9A 3CCRT 3NMZC 2OTJT 1RAFB 2ZAEA 5FROA 2JNGA 2KNBB 1J3TA 3P8HA 5A2QE 2E3HA 5LJ5j 3M58A 3H0IA 3QHSA 2MWPA 4BB7A 5LJ5e 2ZGWA 3OSVA 1WZOA 3CCSA 3EHQA 4M78F 5HK3A 5GAN8 2D6FA 4WTOB 1YWOA 2I0NA 3OYCA 2EAYA 2AK5A 1H3HA 4CC4B 2W0ZA 3M0PA 5LJ3h 5GAMe 3JCMQ 4N0AA 4E7IA 2DL4A 1VQ8A 4C0DB 1UG1A 4ZN3A 3DLLA 3VYHB 1WYXA 2V8KA 3JCMJ 1AEYA 1QVGS 2SRCA 3H41A 4BE1A 4JJDA 1G2BA 2EQJA 3NGPA 4HA8A 4DQ2A 3CCJA 3TREA 2DX1A 5CQYA 1SRMA 3MO8A 2CZ6B 4A4EA 4QQ6A 4LD6A 4RCBA 1GCPA 2YRVA 3OYIA 3HKSA 3CCMT 1WHJA 2FZCB 1AVZC 3AHUA 2AT1B 3A1PA 3CC4T 4PJOF 1B34B 4M7AG 1MNEA 1PD1A 3SB2A 1AT1B 3LGLA 2MF2A 1VQNA 2HQEA 3GIBA 2CH4W 3QG1A 3CD6T 1PKTA 2LCSA 4F17A 4HVVA 1WFWA 2KMTA 2YUNA 1B07A 1BBZA 2O01E 1VQ7T 4DOVA 4M7DD 1ABOA 4BE0A 2BZYA 2F2XA 2Y4YA 5GAMd 3A8MB 2YRDA 2HD0A 3VS7A 3HPWA 3I5RA 2KQWA 1D0YA 1I5LA 1CSKA 1Q86U 3TQ7P 2FRYA 4C92D 2MWOA 4OMLA 3OYDA 2DVEA 3QZ9B 5GAOq 5LJ5f 2A37A 3JCMW 2OI3A 2XHCA 2KE9A 1FMWA 3QBYA 3CCQT 1RUWA 2GTOA 1RLQC 6AT1B 1KQ1A 1KFZA 5KYYA 4QW2A 1K76A 1UGQB 1G3WA 1I5OB 1QVFS 2KRMA 2YUOA 4LD9K 1KSWA 4M4ZA 2QEXT 1NBEB 3MEWA 1Q81U 2RHUA 2LQNA 3OS2A 2R58A 1YCSB 3V7SA 4E7JA 4JS4A 1YJNT 2FG0A 2QQRA 1TWBA 1K4US 1FMVA 2XG8D 3PNWC 5FU7B 4BI4A 1VQOT 1Q82U 1TUGB 1KQSP 2JTEA 2EQKA 3M9QA 5GAOl 1OQKA 1VIEA 3M56A 4IUPA 1YJNA 2ESWA 1OEBA 2QXFA 4J5YA 1QP3A 2YLBA 3RBBB 2COWA 4ATOA 3V8JA 4J9BA 3CPWA 1Q81R 1PSFA 4EMKA 3KFVA 1M9SA 3OS1A 2JW4A 1MV3A 1T3SA 1Q7YR 4BD3A 3JAME 3CPFA 3P8BB 3DLMA 2P0PA 2QDYB 2DKGA 1I1JA 4F7UF 1OU9A 1VOMA 2P4RA 4HCZA 5HK0A 3JCMd 1UGSB 2SEMA 1Y07A 5LJ5h 3M53A 4FIBA 2MPXC 4XU3A 2QTVA 1SF9A 3VS1A 2CS7A 4LUDA 1MMNA 1QVFP 4C8QD 2R57A 4DBQA 1LPLA 1WHMA 1H641 4JJBA 3OSSC 2KDSA 3L2QA 4WCIA 3OYYA 3JV3A 1KC8U 3CQTA 1ZUYA 2DRMA 1M2VB 2CP0A 4M77F 1YJWT 3CMET 5GJWB 2RK2A 4E7LA 4CI0C 4F16A 1JQQA 2RQVA 1RAHB 2J6KA 4F7UG 1K9MR 2O88A 2XMFA 2F5KA 4GLMA 4C5EA 4PKCC 3RKWA 3CD6A 4FU6A 1F1BB 2FHDA 2KROA 3OW2S 3M55A 4HXJA 1QCNA 1NJIU 3EH1A 3CMAA 4IUUA 4C8QA 3UPUA 3QSUA 1U1SA 2E41A 1U06A 1PKSA 3I56T 3H0HA 3I56Q 4KH0B 4XTWA 3L2ZA 1KHCA 3H9NA 4XQ3A 1XQHA 1TSFA 4RTZA 3RUXA 2F2VA 2AHJB 3EFRA 4C92E 2ZPIB 4PFOA 4RTVA 2CSQA 1AOJA 4J9FA 1VQPQ 1KC8R 1Y7XA 1TH7A 2AZVA 3E9FA 3GLXA 1X69A 4LE9A 2CKKA 5CCAA 2PZ1A 5FW9A 1QVPA 1PSEA 4M78A 1U1TA 1X6GA 5GAN7 2HQHA 3QJ6A 3LYIA 1YI2A 3I56A 2AZSA
chains in the Genus database with same CATH topology
2V8IA 2PUOB 1H3ZA 3SFMA 2QA4T 1UGRB 4FT4A 3RKYA 3WXMB 2E65A 5GANe 1S72T 4E7HA 3QXEB 4M77E 4A4HA 2VXFA 4N0AC 4XU1A 4Y91A 3CC4A 5KE2A 3M57A 3O8VA 3CC7A 3DB4A 1YHQA 4NS5A 5A0DA 3FB9A 1JJ2A 1BI0A 2DD5A 4LDUA 5CKBA 3HSBA 2IVWA 1HK9A 2QQAA 2WSFE 3NFCA 5C0MA 5GANg 3MCAB 3PIOA 4M7DC 4PJOD 2E10A 5DY9A 5IAYA 4PL6A 2DIGA 2JUFA 2LNVA 4M77C 4A4KA 4M7AC 2DZ9A 1M1KC 2M0OA 1XTDA 3TCJA 1KQSA 3L1AA 2WSCE 4EMKB 2F69A 3OYMA 2XIDA 4M77D 4ZTFA 2RHXA 2JTMA 4M75F 3QIIA 3L42A 4WF2A 1MGQA 1N27A 4ZN1A 2BIVA 4XTUA 1YJWA 1R8OB 5J39A 2L5QA 3M54A 2K3YA 4JJNK 5CKFA 1ZBXA 2DO3A 3META 4II1A 2EWNA 5CIUA 3A5ZB 3ASKA 3CCVT 1KQSS 1Y96B 2E5QA 2L8DA 4M75C 3CMAT 4OF1A 5HY6A 2YLCA 3ME9A 5CVIA 4P5NA 2CZ0B 4EMGA 3OA6A 2A3LA 4R55A 2RD1A 2C06A 4RG2A 4XTXA 2KSSA 2M16A 4A4GA 2D9TA 4NL3A 1VQ5A 5GAMg 5GAN5 4PJOE 3LLRA 2F5TX 1UEBA 4M7AA 4M75D 2LVMA 3T9NA 4CRIA 4JUVA 3HL8A 3CMEA 1WJRA 3HFOA 4L6V5 3FDRA 1BI2A 5GANd 2LQ8A 4A4FA 1Y96A 5FU6C 3FRNA 4XK8E 3CC2T 3QZ5B 3KBGA 1YBYA 3G4ST 2NLUA 2EQUA 4JLIA 2VC8A 1KHIA 2DEQA 3S3OA 1XOVA 2XDPA 5LJ3g 2Y90A 3X28B 1QP2A 3CXCS 3PGGA 3VKIA 2E6ZA 3X25B 3JCMb 2H3JA 2EJ9A 4X9CA 3LWHA 5IT9E 4R56A 2RJDA 3C12A 4M75G 4C5HA 2JZ2A 2ZPBB 3LH0A 3Q1JA 3NTKA 2ZPEB 4XU2A 3BDLA 1K9MU 5LJ3d 3UT1A 1WJSA 5GMKj 5LJ3e 5GAMh 1I8FA 4QVZA 5LL6S 3C95A 5CAIA 2DIQA 4M7AB 1X01A 1BIAA 3A8HB 4PNOA 3VUZA 3HHTB 4MMKA 2GCXA 2RK1A 4NOYA 5A0LA 5GMKe 3OYNA 1K9MC 3RERA 3OYKA 4MZTA 5C6SA 5CKHA 1VQPA 2DD4A 3BW1A 4FL6A 2LT1A 1N6AA 3CCET 4MDWA 2GFUA 4ZGEB 4OMFB 3GPLA 3QYHB 4YTLA 2P0KA 2VUBA 4J6YA 1UGPB 3BDUA 3JRZA 3CXCA 3VV0A 2JVVA 1G3TA 1VQOA 4C8QG 4IURA 2V8JA 1WGSA 1Y71A 2E1HA 2HNIA 2RHZA 4J6XA 3J81E 3QDRB 4M78E 3FIFA 1LJOA 2QQBA 3OBWA 1P92A 2IG0A 5CKEA 3V8LA 2XICA 4QVDA 4XTYA 3JB9I 4C0FA 2PU9B 4O5VA 2GQVA 1S72A 1GXIE 4Q5WA 4XTZA 3J80E 4C8QB 1JBMA 4NL2A 4C0DC 5FLXE 3X20B 4MZMA 1G3YA 2X4YA 5L8RE 4A54A 3LWIA 1VQ9A 2RI3A 1Q86C 3MEUA 3G6EA 4L5GA 1BKBA 4N4IA 3DKMA 5KH6A 2LX9A 3I55T 3SWNC 4ZGDB 1WJQA 1XNIA 1QW1A 3PMTA 4OP0A 3TU4K 4HCBA 2VGMA 4KUIA 1M4ZA 2RJFA 4DOWA 4M7DB 3CC7T 4BUGA 1K73C 4HT9A 4C92A 4C8QC 1N8RU 3CCQA 1I81A 5GMKi 3HFNA 2KY9A 3CCRT 4UC4A 2QA4A 4F7UB 2QTXA 2OTJT 5D6WA 4OB2B 1X75C 5DM7R 5LJ5g 1WQWA 5FROA 4LDWA 5DLOA 2VV5A 4C0GA 1VQLT 2XD0A 3A8GB 2JNGA 2XK0A 2X4JA 3P8HA 2DAQA 5A2QE 2CZ7B 5LJ5j 3M58A 2G3RA 3QHSA 2MWPA 2EIFA 3V7CA 1ZQ1A 1M1KU 1VQKT 4BB7A 5LJ5e 3QYGB 1YJ9A 2ZGWA 3OSVA 3CC2A 3BFMA 4JRQA 1K8AU 1M5Q1 1VQ4T 2EKOA 3V8KA 3CCSA 1BI1A 2P0QA 4N4HA 4M77A 3R6OA 3P8DA 2R5AA 1QVFA 4M78F 3PTAA 3L2WA 2RO0A 5HK3A 5GANf 2ZCFB 5GAN8 2D6FA 4F7UA 3OYCA 3M4YA 5GMKm 3JB9G 4QVCA 3RKXA 1G3SA 2EAYA 3OMCA 4QQGA 5J3BA 1YHQT 3DB3A 4HT8A 4M7AE 3OYGA 2HBPA 3RMQA 4FM4B 5LJ3h 2RHIA 3JCMg 2QI2A 2DJZA 2LQKA 5FU7C 5GAMe 2LRQA 4N0AA 4PJOA 4E7IA 4OB0B 4IKFA 3G71T 1VQ8A 4C0DB 3OS0A 1O9SA 4ZN3A 3DLLA 4J7IA 3VYHB 5D6YA 4EMKC 3QJYA 3LW5E 4BDZA 2RI5A 4C0ZA 4E7KA 2V8KA 3OW2A 3L2RA 4A53A 3JCMJ 1OZ3A 2EQMA 1ZHIA 5CO7A 2RHYA 3JCMe 2K5IA 1QVGS 4FSXA 2O4XB 4BY6B 3X24B 4BE1A 1G5VA 4BI3A 3A8LB 2EQJA 1YITT 4X9DA 3CCLT 5IN1A 1M90C 5HKCA 4HA8A 4DQ2A 3CPWS 2MAMA 3CCJA 2OTLT 3E9GA 2E12A 2ZPFB 3TREA 1KD1U 3J7AF 3URGA 4M78D 3INZA 2QEXA 4M78G 2LT4A 1VIFA 5CQYA 3H6ZA 3MO8A 2DXTA 2EYQA 3EFSA 3A8OB 4V2SA 4C8QE 2CZ6B 4A4EA 1VQMT 1W2BA 4QQ6A 4LD6A 3CCLA 2LC4A 4RCBA 1VQKA 4ME7A 2K5FA 4O6JA 4IUVA 1OI1A 2YRVA 1KQ2A 3OYIA 5GAN3 5FRNA 3HKSA 3CCMT 4EPCA 3VU3C 4QQDA 2PVDB 4RKUE 3E19A 3AHUA 3HRUA 2GF7A 2K3XA 3HP9A 5KE3A 3CC4T 4PJOF 1B34B 1VQ6A 4J8OA 4M7AG 3OBYA 4HCCA 1I4K1 4EDUA 4BDYA 3BY7A 3G71A 1NJIC 4GLKA 3S6WA 4M75A 2XU8A 3SB2A 2XDDA 4ZGJB 3LGLA 3JCMf 3FEOA 2MF2A 1YI2T 1VQNA 1V29B 2JTFA 4KBMB 4M7DF 2HQEA 1JJ2S 5M9OA 5GMKl 3GIBA 3QG1A 3CD6T 4L59A 5CR2A 2XI9A 2EJGA 1FWZA 3CCUA 2KMTA 1VQ7A 2X4WA 4HKEA 1Q7YC 3JB9D 3CBPA 5GAMj 1VQMA 2O01E 1VQ7T 1MHNA 3HRSA 4XU0A 4BE2A 2D0QB 1Q81C 4Z02A 2LDMA 2X4XA 3WVEB 4M78B 4RCCA 5GAN2 4DOVA 4M7DD 4BE0A 1VUBA 1O75A 2Y4YA 5GAMd 3A8MB 3SWNB 3PFSA 4DA4A 2HD0A 3MHXA 2O4XA 3HPWA 4F7UE 2KQWA 2ZZDA 1I5LA 2DK3A 3MEAA 2LTOA 2ZPGB 1Q86U 2B8AA 1Q82C 4C92D 1RI0A 2MWOA 3C94A 4XAXB 2PQWA 5EG2A 2DVEA 4PJOG 3OYDA 2K4YA 1YIJT 4PLIA 3QZ9B 2WSEE 5I21A 5GAOq 5LJ5f 3QUIA 4M78C 5I2SA 3JCMW 3EAEA 4XTVA 2XHCA 3SWNA 5GANh 5D6XA 3JSCA 3CCRA 4C92C 4GY5A 4OGCA 3QBYA 3PMIA 3CCQT 5KCHA 4TVRA 1KG1A 1N9SA 2I2LA 4OB1B 1SSFA 3JCMX 3CCJT 4M7DE 1KQ1A 1YITA 4QW2A 1UGQB 1G3WA 1HXDA 5GANj 4M77B 1BI3A 3QO3A 1QVFS 3KUFA 1OZ2A 5A0GA 1K73U 1D3BA 3OYBA 4LD9K 2BKDN 2R5MA 4LDVA 4C92B 3L2UA 3MEWA 4BI8B 2QEXT 1VQLA 1Q81U 4M75B 4D6WA 1VQNT 4BACA 2KAFA 3LX7A 3M5AA 2RHUA 3OQ5A 3OS2A 1WPYA 2R58A 4E7JA 3RESA 3V7SA 2E64A 4JS4A 1YJNT 4JS5A 3SDZA 1JRIA 2PVGB 2QQRA 4PJOB 4C92G 1LNXA 4LDXA 4LDYA 1WNLA 3JB9F 2XG8D 3PNWC 5FU7B 4BI4A 4ELYC 1VQOT 1Q82U 3VJPA 3M9QA 2DPPB 2EQKA 5GAOl 1M1GA 2DTHA 2OTJA 1VIEA 1D3BB 1DJ7B 3CBMA 3M56A 4IUPA 4N4GA 3V7RA 3OYEA 1YJNA 2CZ1B 2QXFA 4J5YA 1QP3A 2PVOB 2P4TA 2YLBA 3OYHA 1W2BS 4M77G 4ATOA 2RJEA 3L2VA 4BY6C 3V8JA 3CPWA 4MMLA 4JRPA 4PJOC 1PSFA 4EMKA 3TEEA 1YJ9T 1M9SA 3F70A 4JDSA 3ZBDA 3OS1A 5I2MA 3CCVA 3QPHA 2QQ9A 4BD3A 3G6ET 2DTOA 3JAME 3GNGA 1EIFA 5FU6B 2DZCA 3CCUT 3CPFA 5GAOm 3P8BB 4C5IA 3DLMA 2DXUA 2P0PA 2QDYB 2DKGA 3C4SA 2HQXA 2RH2A 1M90U 4F7UF 4HCZA 1YCYA 3JCMd 5HK0A 3OYJA 1UGSB 1NPPA 5GAOp 1Y07A 2XDBA 1B34A 4M7AD 5LJ3j 5LJ5h 3M53A 3OMGA 4FIBA 2FB7A 4XU3A 2L3RA 1YIJA 1UB4A 4M7AF 3ZEHA 1X6OA 4PLLA 2CS7A 4M7DG 2CGHA 5CK9A 2KVQG 3CCMA 2VYTA 4OVAA 4C8QD 2R57A 2FVUA 3FJPA 3OS5A 3RIRA 3UDCA 5GAMf 4B9XA 1H641 3VYGA 3CCST 2L89A 3NTIA 3OSSC 4VUBA 1VQPT 2KDSA 3L2QA 1BYMA 5GAN6 1VQ4A 3OYYA 2K2VA 1BIBA 2Y4XA 2K5LA 1JB0E 5J26A 3OYLA 4OGEA 1M8VA 4JRIA 1KC8U 1U8RA 4C92F 1NE8A 4Y28E 1NZ9A 2ZPHB 3G4SA 3E1SA 5LJ5d 4FT2A 3JB9H 5GMKh 2WACA 3MP1A 4JRKA 3GF5A 4M77F 3JCMV 4KUDK 1YJWT 1K8AC 3HRTA 3NTHA 5CQXA 4C8QF 3PIPA 3JCMh 2DXBA 3CMET 3N5BB 1VQ8T 3ZFJA 2RK2A 4JLGA 4E7LA 3JCMP 2OAUA 3OB9A 2RB6A 4CI0C 3OYFA 3UWNA 2RJCA 3CEYA 3CCEA 4OB3B 1N9RA 4X34A 1VQ6T 4J83A 1Q7YU 3FLGA 2E6NA 2LCCA 2LCLA 2E70A 5FRMA 2PUKB 4F7UG 2VXEA 2BUDA 2RI2A 3RMSA 3WVDB 2F5KA 2FL7A 2M1HA 4ELZC 3FC3A 4MDXA 2VGNA 3I55A 2EFIA 2EJFA 5DLQE 4C5EA 1WQ7A 2MI6A 3QKJA 1W4SA 4IUQA 4KT0E 4PKCC 3RKWA 5KCOA 3CD6A 4FU6A 1QVGA 2FHDA 3JCMQ 4KULA 3OW2S 3JCMc 3M55A 5CKDA 4IUTA 1NJIU 2KK4A 3MP8A 2QQSA 3CMAA 4IUUA 3S3MA 1IZ6A 4C8QA 3UPUA 3QSUA 2RM4A 5AYFA 1U1SA 3SD4A 2DTIA 2E41A 3VUBA 4C5GA 4E47A 4ZTJA 1KC8C 3I56T 5GAN4 2JN0A 1FXXA 3ER0A 1NPRA 2JOYA 3M4GA 1KD1C 2M9UA 4XTWA 2CYZB 1FX7A 3L2ZA 1KHCA 3X26B 4XQ3A 5GAOn 1XQHA 3G7ZA 2DXCA 4M75E 3S3NA 3RUXA 5LJ3f 2AHJB 3M59A 1M1FA 3EFRA 4C92E 3OYAA 2X35A 1VQ5T 4RMOA 3GP8A 2ZPIB 4M7DA 3GNFB 1LOJA 3KXTA 1OYXA 2OTLA 4RG8A 3PT9A 3GOXA 1Y7XA 4EMHA 1TH7A 3E9FA 2A7YA 2RA2A 3GLXA 2HAXA 4J6WA 2CKKA 2FYKA 3LGFA 5CCAA 2K57A 1QVPA 1PSEA 3CBOA 3OY9A 2GFAA 4M78A 1N8RC 1U1TA 2MMPA 2XKOC 4J7FA 5GAOr 4MZPA 1VQ9T 3MEVA 5GAN7 1IREB 3QJ6A 3JB9J 3LYIA 3MP6A 4B9WA 3I56A 1AHJB 1YI2A 1RL2A 2YHTA 3H8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WVD B;  2PUO B;  1JB0 E;  3X24 B;  1DJ7 B;  1UGS B;  1UGR B;  2WSC E;  3X26 B;  1GXI E;  1UGQ B;  3A8L B;  2CZ1 B;  2DXC A;  2PU9 B;  2ZCF B;  2ZZD A;  1QP3 A;  2PVO B;  3QXE B;  4Y28 E;  4ZGJ B;  2ZPH B;  3A8H B;  2AHJ B;  4KT0 E;  3HHT B;  4OB2 B;  2ZPG B;  4L6V 5;  1V29 B;  2ZPI B;  2ZPF B;  3A8G B;  3X20 B;  2DD4 A;  5L8R E;  4XK8 E;  2CZ7 B;  1PSF A;  2DD5 A;  2DXB A;  2WSE E;  3QZ5 B;  3QZ9 B;  4FM4 B;  3A8O B;  2WSF E;  2CZ6 B;  3A8M B;  4OB1 B;  3X28 B;  4ZGE B;  1QP2 A;  4OB0 B;  3X25 B;  3QYH B;  2O01 E;  1PSE A;  3QYG B;  4ZGD B;  1UGP B;  2PVG B;  2D0Q B;  3VYG A;  4OB3 B;  3VYH B;  3LW5 E;  2PVD B;  4RKU E;  1IRE B;  3WVE B;  2CZ0 B;  2QDY B;  2ZPB B;  2PUK B;  2ZPE B;  1AHJ B;  2DPP B;  2CYZ B; 
#chains in the Genus database with same CATH topology
 1H3Z A;  2QA4 T;  4FT4 A;  2E65 A;  4LNP A;  5GAN e;  4A4H A;  2VXF A;  1X2Q A;  5A0D A;  3FB9 A;  2BE7 D;  2IVW A;  2WSF E;  5GAN g;  3PIO A;  3G6E Q;  3VS0 A;  5DY9 A;  5IAY A;  2JUF A;  1TUD A;  1YI2 Q;  2M0O A;  1R77 A;  2HBW A;  1XTD A;  3TCJ A;  1KQS A;  1IXD A;  1ZUU A;  4M75 F;  3CME Q;  4WF2 A;  1N27 A;  3CPW P;  2BIV A;  4XTU A;  1R8O B;  4OMM A;  3M54 A;  1UHC A;  2L3Q A;  4J9H A;  3NHN A;  3MET A;  3ASK A;  1Y96 B;  2E5Q A;  2L8D A;  2DER A;  2YWW A;  4EMG A;  3OA6 A;  2A3L A;  2C06 A;  3GBQ A;  4A4G A;  5GAN 5;  2K3B A;  1UEB A;  2QDL A;  4M75 D;  2LVM A;  3T9N A;  4E7S A;  3CME A;  1WJR A;  3HFO A;  1WXU A;  3MKD A;  4L6V 5;  1BI2 A;  1Y96 A;  4Y92 A;  1U3O A;  3FRN A;  3G4S T;  2NLU A;  1KJW A;  2EQU A;  3S3O A;  4KGV B;  2CP6 A;  1XOV A;  2NUT A;  1QP2 A;  1SHF A;  3CXC S;  2E6Z A;  2H3J A;  4K11 A;  2ZPB B;  4QKU A;  3NTK A;  2HKQ B;  5LJ3 e;  5GAM h;  1I8F A;  3EG9 B;  2DIQ A;  1X01 A;  3VUZ A;  5IXF A;  1TTH B;  4MMK A;  5A0L A;  4NOY A;  3RER A;  1M1K R;  2JJ9 A;  3VRY A;  3OYK A;  1TUC A;  2DVJ A;  4FL6 A;  2LT1 A;  4MDW A;  4AG2 C;  4ZGE B;  4OMF B;  1GCQ A;  2P0K A;  3BDU A;  3CXC A;  2HMA A;  3VV0 A;  1VQO A;  2PNI A;  4C8Q G;  4IUR A;  2HL5 C;  2RHZ A;  2EGC A;  4M78 E;  3RR6 A;  1VQ6 Q;  2QGF B;  4M7D F;  2QQB A;  3PVL A;  5CKE A;  2XIC A;  4XTY A;  4C0F A;  2GQV A;  4ORZ A;  4XTZ A;  2KEA A;  3CC7 Q;  2L0A A;  5FLX E;  3REB B;  2X4Y A;  3LWI A;  1Q86 C;  1M30 A;  2J7I A;  1BKB A;  3I55 T;  1QW1 A;  1VQM Q;  1NYF A;  2RJF A;  3O5Z A;  3CC7 T;  3IQL A;  5GMK i;  2MCN A;  1RAI B;  4UC4 A;  2QA4 A;  4IIO A;  2QTX A;  2RPN A;  4DBH A;  4OB2 B;  4LDW A;  2VV5 A;  2D1X A;  2H8H A;  2X4J A;  4A63 B;  1ZQ1 A;  1VQK T;  1PD0 A;  2YSQ A;  1YJ9 A;  2FPF A;  4JRQ A;  2ED0 A;  3HTR A;  1VQ4 T;  2EKO A;  1HD3 A;  2FZK B;  1GRI A;  2P0Q A;  4N4H A;  2KXC A;  1MMA A;  2R5A A;  2ZCF B;  1GFD A;  1W1F A;  1WHK A;  3M4Y A;  3JB9 G;  4FW1 A;  4QVC A;  3DB3 A;  1LVK A;  4M7A E;  3RMQ A;  1OPK A;  1D1C A;  2LRQ A;  2MIO A;  4OB0 B;  1VQK Q;  3OS0 A;  3UF4 A;  4EMK C;  3QJY A;  3LW5 E;  2RI5 A;  4E7K A;  2JXB A;  3OW2 A;  1OZ3 A;  3JCM e;  2LJ3 A;  4FSX A;  3X24 B;  1ARK A;  4BI3 A;  3A8L B;  4B6M A;  1YIT T;  4X9D A;  2RMO A;  2MAM A;  2ZPF B;  3J7A F;  2YRC A;  4M78 D;  3INZ A;  2QEX A;  2RF0 A;  2DXT A;  1M8M A;  1W2B A;  1VQK A;  1HYO A;  2K5F A;  2FO0 A;  1KQ2 A;  5GAN 3;  1AZE A;  5FRN A;  4QQD A;  2PVD B;  3E19 A;  2X51 A;  2GF7 A;  3I35 A;  2KRS A;  3BY7 A;  3G71 A;  4BDY A;  3S6W A;  2XDD A;  3SHW A;  3REA B;  1KD1 R;  1JO8 A;  1V29 B;  2QEX Q;  5M9O A;  2XI9 A;  3CCU A;  1FWZ A;  1Q7Y C;  3EHR A;  2CUB A;  2M51 A;  1FMK A;  3CCR Q;  4BE2 A;  1Q81 C;  1UDL A;  4KGZ B;  4CC7 A;  4RCC A;  1WXB A;  1O75 A;  2VAS A;  3CCQ Q;  4DA4 A;  3MHX A;  2EGE A;  4F7U E;  1XJW B;  1PHT A;  1Q82 C;  2A08 A;  3I5S A;  4F14 A;  1RI0 A;  4PJN A;  2JS0 A;  3C94 A;  2PQW A;  1QMC A;  5I21 A;  5I2S A;  3EAE A;  3SWN A;  2EW3 A;  3JSC A;  3CCR A;  5KCH A;  3RNJ A;  1KG1 A;  1SSF A;  3JCM X;  1NYG A;  2KGT A;  4PK4 A;  1HXD A;  4LXC A;  1MV0 B;  3KUF A;  1OZ2 A;  3OYB A;  2V26 A;  1GL5 A;  2R5M A;  4BI8 B;  1VQL A;  4D6W A;  2Z0W A;  3EGX A;  2KAF A;  3LX7 A;  3M0Q A;  3OQ5 A;  1WPY A;  3RES A;  4JS5 A;  2D0N A;  5IXB A;  1WNL A;  4ELY C;  5FWB A;  1N5Z A;  3VJP A;  2DPP B;  2DTH A;  3CBM A;  3V7R A;  4N4G A;  3H0F A;  2CZ1 B;  4QT7 A;  2PVO B;  2QG9 B;  1ZBJ A;  2HDA A;  2JT4 A;  1WHL A;  2L2P A;  4JRP A;  4PJO C;  1YJ9 T;  1SHG A;  2QQ9 A;  2RQU A;  3GNG A;  2DZC A;  1YP5 A;  2ENM A;  2QAS A;  1PRM C;  2G6F X;  3C4S A;  1IGQ A;  9ATC B;  3OYJ A;  5LJ3 j;  1OOT A;  1YIJ A;  1UB4 A;  3ZEH A;  5CK9 A;  8ATC B;  3CCM A;  1VQ7 Q;  4OVA A;  2AIR B;  1RAD B;  2FVU A;  1JXO A;  3FJP A;  3MPU B;  3OS5 A;  5GAM f;  4OMN A;  3CCS T;  1QWE A;  3R6N A;  1PM3 A;  1VQ4 A;  2K2V A;  4PFP A;  1BIB A;  2Y4X A;  2K5L A;  1JB0 E;  5J26 A;  2QAZ A;  1M8V A;  4C92 F;  4Y28 E;  2ZPH B;  5LJ5 d;  2DL8 A;  5GMK h;  4KUD K;  3GF5 A;  3JCM V;  4PJJ A;  5CQX A;  4C8Q F;  3JCM h;  5IHI A;  3EG0 A;  2AKL A;  1QCF A;  3UWN A;  3CEY A;  3CCE A;  1VQ6 T;  4J83 A;  1Q7Y U;  2VXE A;  1G83 A;  4DEX A;  3I55 A;  1WQ7 A;  3QKJ A;  1W4S A;  4KT0 E;  1QVG A;  4KUL A;  3JCM c;  2KYM A;  4IUT A;  2KBT A;  2LMJ A;  2KK4 A;  2QQS A;  1WHG A;  1IZ6 A;  2DL7 A;  2RM4 A;  3SD4 A;  4E47 A;  2NUT B;  1ZUK A;  1UTI A;  3ER0 A;  2JOY A;  1KD1 C;  2M9U A;  1FX7 A;  5KYX A;  1WA7 A;  2CRE A;  4M75 E;  5LJ3 f;  4DEY A;  1M1F A;  1VQ5 T;  2CP2 A;  3M0R A;  2CH4 A;  2OTL A;  1OYX A;  4RG8 A;  2RN8 A;  5KYW A;  2DEU A;  2A7Y A;  2RA2 A;  2LNH B;  3EGX B;  2FYK A;  3UA7 A;  2K57 A;  1N8R C;  1OU8 A;  5GAO r;  4MZP A;  3MEV A;  1IRE B;  4JJC A;  4B9W A;  1PRL C;  1RL2 A;  1ABQ A;  2DRK A;  1NEG A;  4A54 A;  2V8I A;  2PUO B;  1NLP C;  3RKY A;  3EFO B;  1S72 T;  1S72 Q;  1W2B P;  4N0A C;  4XU1 A;  1PCX A;  1H92 A;  3CC4 A;  3O8V A;  1YHQ A;  4NS5 A;  2ROL A;  2DD5 A;  3VS2 A;  2QQA A;  1HK9 A;  1VQ9 Q;  3MCA B;  2QYZ A;  4R0K A;  2E10 A;  1QLY A;  2DIG A;  4RTT A;  4A4K A;  1VQ5 Q;  2XID A;  4ZTF A;  2RHX A;  1HJD A;  4ZN1 A;  1UJ0 A;  2DIL A;  5J39 A;  1K1Z A;  1YN8 A;  2K3Y A;  2O2O A;  4JJN K;  2FEI A;  2EYZ A;  4OMO A;  4II1 A;  2GBQ A;  1Z9Z A;  3CMA T;  4OF1 A;  2CZ0 B;  1JEG A;  4J9G A;  3BE3 A;  1Z9Q A;  1M3A A;  3CCS Q;  1JU5 C;  4XTX A;  2KXD A;  1VQ5 A;  2D9T A;  2HZY A;  2NUP A;  3THK A;  4PJO E;  3LLR A;  5GAN d;  1WIE A;  2LQ8 A;  2VB6 A;  4A4F A;  2LX7 A;  5FU6 C;  3CC2 T;  3KBG A;  2FPE A;  1KHI A;  2VC8 A;  2Y90 A;  3X28 B;  1VQ8 Q;  1TG0 A;  3EFO A;  5IT9 E;  4R56 A;  4M75 G;  4OMQ A;  2CP3 A;  2JZ2 A;  3LH0 A;  2LZ6 B;  2ZPE B;  1D09 B;  1ZSZ A;  5LL6 S;  4M7A B;  2CT3 A;  1EZZ B;  2RK1 A;  1PG5 B;  5GMK e;  1K9M C;  4OMP A;  4MZT A;  5C6S A;  5CKH A;  3BW1 A;  8AT1 B;  5KYU A;  1IO6 A;  3CCE T;  3GPL A;  3QYH B;  1YNZ A;  2VUB A;  1I07 A;  1UGP B;  2A0F B;  1G3T A;  1MMD A;  4D8K A;  1WGS A;  2HNI A;  2K2M A;  2JS2 A;  2NUP B;  1GXI E;  4FYV B;  2O9S A;  2P84 A;  4NL2 A;  4C0D C;  2DNU A;  3EGD A;  1QCO A;  3DKM A;  4ZGD B;  3PMT A;  2W10 A;  1R0B G;  4DOW A;  2OJ2 A;  4BUG A;  4C92 A;  4C8Q C;  1N8R U;  3HFN A;  1NG2 A;  1RAB B;  2DLP A;  2O9V A;  4F7U B;  5D6W A;  1X75 C;  5DM7 R;  5LJ5 g;  1VQL T;  4C0G A;  5EC7 A;  2XK0 A;  2DAQ A;  2C0O A;  2G3R A;  1M2O A;  1KK7 A;  2IIM A;  3V7C A;  1SSH A;  1UGV A;  3CC2 A;  1M5Q 1;  2JMA A;  1CKB A;  1BI1 A;  1TU0 B;  3P8D A;  1QVF A;  5IHK A;  3PTA A;  4D8D A;  3L2W A;  2RO0 A;  1NJI R;  5GMK m;  4KRT A;  4HT8 A;  4QQG A;  1PWT A;  2HBP A;  4FM4 B;  4CC2 A;  2RHI A;  1I0C A;  2QI2 A;  5FU7 C;  3G71 T;  3CC2 Q;  1OX9 A;  5D6Y A;  4FW2 A;  4BDZ A;  1QVG P;  3L2R A;  4A53 A;  2EQM A;  5CO7 A;  1ZHI A;  4FCY A;  4BY6 B;  1YJN Q;  2K9G A;  5ECA A;  3CCL T;  5HKC A;  3E9G A;  1GCQ C;  1KD1 U;  3URG A;  4M78 G;  1VIF A;  1RAE B;  3H6Z A;  4V2S A;  2EYQ A;  3EFS A;  3A8O B;  1ZA2 B;  4ME7 A;  4O6J A;  4IUV A;  2COZ A;  3EG1 A;  1C1A A;  4GBQ A;  4RKU E;  2E5K A;  3HRU A;  3HP9 A;  2K3X A;  3OBY A;  4HCC A;  1MMG A;  1WI7 A;  3MJX A;  1NJI C;  4M75 A;  2XU8 A;  2KRN A;  2JTF A;  2RQR A;  2EPD A;  5GMK l;  2X4W A;  4HKE A;  3JB9 D;  3CBP A;  1KIK A;  3LH5 A;  2J6O A;  2D8H A;  3HRS A;  4XU0 A;  4Z02 A;  2LDM A;  2V1R A;  2X4X A;  1UE9 A;  1VUB A;  3SWN B;  3PFS A;  2NUZ A;  2KR3 A;  2ZZD A;  2ZPG B;  2B8A A;  2LQW A;  4PJO G;  4XAX B;  5EG2 A;  2H3E B;  4HVW A;  2K4Y A;  4PLI A;  4M78 C;  5KYX B;  5GAN h;  5D6X A;  4C92 C;  4GY5 A;  4OGC A;  4TVR A;  2CSI A;  4CC3 A;  2NYS A;  1BU1 A;  4OB1 B;  2M0Y A;  2F2W A;  1ZA1 B;  3QO3 A;  5A0G A;  2DFU A;  3CD6 Q;  2BKD N;  4C92 B;  4M75 B;  1G8X A;  1VQN T;  2F1L A;  3CMA Q;  3M5A A;  4Z89 A;  1OPL A;  3M0U A;  3CCV Q;  1GBQ A;  3SDZ A;  2COY A;  1LNX A;  4LDX A;  4FYY B;  2YT6 A;  2OTJ A;  3OYE A;  1D3B B;  3M0T A;  1IGU A;  2P4T A;  3CCJ Q;  2EYX A;  3RDV A;  2RJE A;  4JZ3 A;  4MML A;  3TEE A;  3F70 A;  2FZG B;  5I2M A;  3CCV A;  3QPH A;  2DTO A;  1EIF A;  5FU6 B;  3CCU T;  1YWP A;  1ZX6 A;  1RAC B;  2HQX A;  1M90 U;  1SG5 A;  2OTJ Q;  1YCY A;  3TSW A;  1D0X A;  1NPP A;  1B34 A;  1M3C A;  1VQN Q;  3G4S Q;  4PLL A;  2KVQ G;  4B9X A;  1BCO A;  3VYG A;  4E7Z A;  2L89 A;  3NTI A;  2MYS A;  1M90 R;  2JM9 A;  3OYL A;  4RUG A;  1NE8 A;  3G4S A;  3E1S A;  1WX6 A;  3JB9 H;  2WAC A;  3MP1 A;  5I11 A;  1K9A A;  1ZSG A;  1K8A C;  3NTH A;  2EVR A;  3N5B B;  1VQ8 T;  3ZFJ A;  2EYY A;  3JCM P;  2OAU A;  3OB9 A;  2RB6 A;  4LUE A;  3CXC P;  2RJC A;  1ACM B;  1N9R A;  4X34 A;  1H8K A;  3FLG A;  5FRM A;  2LCL A;  2E70 A;  2PUK B;  2BUD A;  2RI2 A;  3PVQ A;  2FL7 A;  3FC3 A;  4MDX A;  1M3B A;  2MI6 A;  1D1B A;  4IUQ A;  5KCO A;  1MUZ A;  1T0H A;  5CKD A;  3EGD B;  2FRW A;  5HCK A;  3S3M A;  2EBP A;  1Y0M A;  5AYF A;  1EX4 A;  4C5G A;  4RTY A;  4ZTJ A;  5GAN 4;  5IH2 A;  1NPR A;  1X6B A;  5GAO n;  5I22 A;  3OYA A;  4M7D A;  1K73 R;  2X35 A;  3GNF B;  1LOJ A;  2FPD A;  2VKN A;  2DET A;  4F04 B;  1D1A A;  4RTU A;  2HAX A;  4J6W A;  2DYB A;  2GFA A;  2MMP A;  2XKO C;  2DL5 A;  1AHJ B;  2YHT A;  3H8Z A;  1QWF A;  3WXM B;  1X43 A;  4KGX B;  4PJM A;  5KE2 A;  3CC7 A;  1BK2 A;  1JXM A;  1YJW Q;  5CKB A;  3HSB A;  2DBK A;  3NFC A;  4PJO D;  5C0M A;  4AG1 C;  2HL3 A;  2CP5 A;  2J06 A;  2M02 A;  3ULR B;  2LNV A;  4M77 C;  4M7A C;  2DZ9 A;  2WSC E;  4EMK B;  2F69 A;  1UFF A;  3OYM A;  4M77 D;  2C0I A;  2JTM A;  1E7O A;  1K0S A;  3QWY A;  3QII A;  1MGQ A;  2J6F A;  1YJW A;  5CKF A;  1ZBX A;  5IHN A;  2DO3 A;  5CIU A;  2EWN A;  1KQS S;  3A5Z B;  2YDL A;  3EH2 A;  5HY6 A;  5CVI A;  4P5N A;  4R55 A;  2RD1 A;  1SPK A;  2KSS A;  2M16 A;  5GAM g;  3NPF A;  1VYT A;  4M7A A;  2MK5 A;  1W70 A;  4CRI A;  3VS6 A;  4JUV A;  1C0M A;  4FSS A;  4PJL A;  1YBY A;  2KT8 A;  3VRZ A;  3VKI A;  3X25 B;  2YXY A;  1RAG B;  1AWW A;  2GNC A;  3UAT A;  3Q1J A;  4XU2 A;  3BDL A;  5LJ3 d;  1BIA A;  3A8H B;  4PNO A;  5KYW B;  1VQP A;  2DD4 A;  1N6A A;  2HKN A;  2GFU A;  4YTL A;  1Y71 A;  2V8J A;  3QDR B;  3FIF A;  3OBW A;  1P92 A;  1UJY A;  2HEQ A;  2IG0 A;  3JB9 I;  2PU9 B;  4J9E A;  1ZLM A;  3FJ5 A;  4MZM A;  1G3Y A;  1N8R R;  3MEU A;  3CCU Q;  3G6E A;  4L5G A;  3A98 A;  4N4I A;  5KH6 A;  3SWN C;  1WJQ A;  1XNI A;  4OP0 A;  2VGM A;  4KUI A;  1M4Z A;  2MOX A;  1RLP C;  1AZG B;  4M7D B;  1K73 C;  3CCQ A;  1I81 A;  2VVK A;  1WDX A;  4AFU C;  1SRL A;  1WQW A;  5DLO A;  2XD0 A;  3A8G B;  2BZ8 A;  5KYU B;  1WHH A;  1JJ2 P;  2CZ7 B;  1PNJ A;  2EIF A;  3PE0 A;  1M1K U;  3QYG B;  2NWM A;  3BFM A;  1K8A U;  3V8K A;  1OV3 A;  4Z88 A;  4M77 A;  3R6O A;  1B7T A;  3E2U A;  2DYI A;  2HSE B;  5GAN f;  4F7U A;  3M0S A;  3RKX A;  1G3S A;  3OMC A;  5J3B A;  1YHQ T;  2O31 A;  4E6R A;  3OYG A;  2E4H A;  3JCM g;  2DJZ A;  2LQK A;  4PJO A;  3CCL Q;  1ZSZ C;  4IKF A;  1O9S A;  2YUQ A;  4J7I A;  1K8A R;  1GBR A;  1AWJ A;  3TSZ A;  4C0Z A;  1E6H A;  4FYW B;  2RHY A;  2K5I A;  2O4X B;  1G5V A;  2HSP A;  2GGR A;  5IN1 A;  1M90 C;  3CPW S;  2OTL T;  4X1V A;  2E12 A;  2JM8 A;  1K0X A;  1RI9 A;  1TXQ A;  2LT4 A;  1Y57 A;  4C8Q E;  3CCL A;  1VQM T;  2LC4 A;  2C0T A;  1OI1 A;  1YFN A;  3U23 A;  4EPC A;  3VU3 C;  1VQO Q;  1TOV A;  2J05 A;  5KE3 A;  1VQ6 A;  4J8O A;  1IHW A;  2X3X D;  2ABL A;  1UHF A;  1I4K 1;  4EDU A;  4GLK A;  1UUE A;  2LJ1 A;  4ZGJ B;  3JCM f;  3FEO A;  1YI2 T;  4KBM B;  1YIJ Q;  1JJ2 S;  1V1C A;  4HVU A;  4L59 A;  5CR2 A;  2EJG A;  2ED1 A;  3CCM Q;  1VQ7 A;  4FYX B;  1SEM A;  5GAM j;  1VQM A;  3C0C A;  4DBF A;  1MHN A;  2D0Q B;  1OUL A;  5GAN 2;  3WVE B;  4M78 B;  1AWX A;  3AT1 B;  2QA4 Q;  2O4X A;  1YIT Q;  2K79 A;  1M2V A;  2DK3 A;  3MEA A;  2LTO A;  1TS9 A;  2DMO A;  1YIJ T;  1X2K A;  4Z8A A;  3EG2 A;  2WSE E;  3QUI A;  4XTV A;  1YJ9 Q;  2V1Q A;  7AT1 B;  3PMI A;  2RQW A;  4AT1 B;  1N9S A;  2I2L A;  4EIK A;  4M7D E;  3CCJ T;  1YIT A;  4ZNX A;  5GJV B;  1QQJ A;  3I9Q A;  4M77 B;  4RTX A;  1BI3 A;  2ECZ A;  5GAN j;  1MND A;  1K73 U;  1D3B A;  4JZ4 A;  2RNA A;  4LDV A;  3L2U A;  2A28 A;  4BAC A;  1WLP B;  1BB9 A;  2E64 A;  1JRI A;  2PVG B;  4PJO B;  1E6G A;  4C92 G;  2JMC A;  4LDY A;  3JB9 F;  1Q82 R;  1M1G A;  1DJ7 B;  2OX7 A;  2BZX A;  3OYH A;  1Q95 G;  2YUP A;  4M77 G;  1W2B S;  2X3W D;  3L2V A;  4BY6 C;  2ATC B;  2OTL Q;  4RTW A;  4JDS A;  3ZBD A;  1GFC A;  2QK0 A;  1W6X A;  1LCK A;  2LJ0 A;  3G6E T;  1AD5 A;  5GAO m;  4C5I A;  2L3S A;  2DXU A;  1NM7 A;  2CDT A;  2RH2 A;  1PC0 A;  5KYY B;  3G71 Q;  5GAO p;  2XDB A;  2DA9 A;  4M7A D;  1T3L A;  1AWO A;  2OAW A;  3OMG A;  2FB7 A;  2L3R A;  3CC4 Q;  4M7A F;  1YHQ Q;  1X6O A;  4M7D G;  2CGH A;  2VYT A;  2KYB A;  3RIR A;  3UDC A;  2BTT A;  1C6V X;  4VUB A;  1VQP T;  1BYM A;  5GAN 6;  4J9I A;  2CUD A;  3G1J A;  3OW2 P;  1IRX A;  4OGE A;  4JRI A;  1V76 A;  1U8R A;  2GTJ A;  1NZ9 A;  3ZL7 C;  4FT2 A;  2VWF A;  4JRK A;  3HRT A;  3PIP A;  2DXB A;  1EFN A;  1IB8 A;  4JLG A;  3OYF A;  4AFS C;  4OB3 B;  4IIM A;  2E6N A;  2LCC A;  2AKK A;  3EG3 A;  3EGU A;  3RMS A;  1T0J A;  3WVD B;  2M1H A;  4ELZ C;  2VGN A;  2EFI A;  2EJF A;  5DLQ E;  3VS4 A;  1BCM A;  5L23 A;  1VQL Q;  3SEM A;  2PTK A;  3D7S B;  3MP8 A;  1CKA A;  3VUB A;  2DTI A;  1KC8 C;  2JN0 A;  1FXX A;  3M4G A;  2CYZ B;  4E2F B;  2E3I A;  3X26 B;  3G7Z A;  2DXC A;  3S3N A;  1QKX A;  3M59 A;  4RMO A;  3GP8 A;  1VYU A;  4DBR A;  3KXT A;  3PT9 A;  3GOX A;  4EMH A;  1VYV A;  2HCK A;  3LGF A;  3OY9 A;  1Q86 R;  3CBO A;  4J7F A;  4JPB W;  1VQ9 T;  3JB9 J;  2L3P A;  3MP6 A;  1R0C B;  3VS3 A;  3SFM A;  1UGR B;  1FYN A;  4E7H A;  3QXE B;  4M77 E;  4J9C A;  4KH1 B;  3QDF A;  5FWC A;  4Y91 A;  3M57 A;  3DB4 A;  2KT1 A;  2EQI A;  1JJ2 A;  1BI0 A;  4LDU A;  4M7D C;  4LN2 A;  1U5S A;  5KYN A;  1OX8 A;  4PL6 A;  1SKU B;  2DJQ A;  1VQ4 Q;  1M1K C;  2EKH A;  3L1A A;  2A36 A;  1M27 C;  1B3Q A;  3L42 A;  2X9H A;  2L5Q A;  5AT1 B;  1HSQ A;  3CCV T;  3CCE Q;  4M75 C;  2K7A A;  2YLC A;  3ME9 A;  5D7U A;  4RG2 A;  2K6D A;  4NL3 A;  1QKW A;  1X27 A;  4J9D A;  3I55 Q;  2DE0 X;  2F5T X;  1NLO C;  3QWX X;  3HL8 A;  3EG9 A;  2QGG A;  1ZSZ B;  3FDR A;  4XK8 E;  3QZ5 B;  4JLI A;  2DEQ A;  2XDP A;  5LJ3 g;  3PGG A;  1IHV A;  2IPO B;  2GQI A;  3JCM b;  2EJ9 A;  4X9C A;  3LWH A;  2RJD A;  3C12 A;  2BE9 B;  4AFZ C;  4C5H A;  1K9M U;  5GMK j;  3UT1 A;  1WJS A;  4QVZ A;  2DM1 A;  3TVT A;  2CP7 A;  3C95 A;  5CAI A;  4AMC A;  1RAA B;  1VA7 A;  3HHT B;  2GCX A;  3OYN A;  2EGA A;  1WXT A;  4HCK A;  4AFQ C;  2B86 A;  2DBM A;  1S1N A;  4J6Y A;  3JRZ A;  2KI7 A;  2RQT A;  2JVV A;  2E1H A;  4J6X A;  4ANJ A;  4ESR A;  1LJO A;  3V8L A;  4QVD A;  3J81 E;  2DL3 A;  1S72 A;  4O5V A;  2CT4 A;  4Q5W A;  3J80 E;  4C8Q B;  1JBM A;  3X20 B;  5L8R E;  2LP5 A;  1VQ9 A;  2RI3 A;  3UA6 A;  1UEC A;  1D0Z A;  2LX9 A;  3TU4 K;  4PFZ A;  4HCB A;  1A0N B;  2DF6 A;  2EYW A;  2D8J A;  2ROT A;  4HT9 A;  3VS5 A;  1NEB A;  2KY9 A;  3CCR T;  3NMZ C;  2OTJ T;  1RAF B;  2ZAE A;  5FRO A;  2JNG A;  2KNB B;  1J3T A;  3P8H A;  5A2Q E;  2E3H A;  5LJ5 j;  3M58 A;  3H0I A;  3QHS A;  2MWP A;  4BB7 A;  5LJ5 e;  2ZGW A;  3OSV A;  1WZO A;  3CCS A;  3EHQ A;  4M78 F;  5HK3 A;  5GAN 8;  2D6F A;  4WTO B;  1YWO A;  2I0N A;  3OYC A;  2EAY A;  2AK5 A;  1H3H A;  4CC4 B;  2W0Z A;  3M0P A;  5LJ3 h;  5GAM e;  3JCM Q;  4N0A A;  4E7I A;  2DL4 A;  1VQ8 A;  4C0D B;  1UG1 A;  4ZN3 A;  3DLL A;  3VYH B;  1WYX A;  2V8K A;  3JCM J;  1AEY A;  1QVG S;  2SRC A;  3H41 A;  4BE1 A;  4JJD A;  1G2B A;  2EQJ A;  3NGP A;  4HA8 A;  4DQ2 A;  3CCJ A;  3TRE A;  2DX1 A;  5CQY A;  1SRM A;  3MO8 A;  2CZ6 B;  4A4E A;  4QQ6 A;  4LD6 A;  4RCB A;  1GCP A;  2YRV A;  3OYI A;  3HKS A;  3CCM T;  1WHJ A;  2FZC B;  1AVZ C;  3AHU A;  2AT1 B;  3A1P A;  3CC4 T;  4PJO F;  1B34 B;  4M7A G;  1MNE A;  1PD1 A;  3SB2 A;  1AT1 B;  3LGL A;  2MF2 A;  1VQN A;  2HQE A;  3GIB A;  2CH4 W;  3QG1 A;  3CD6 T;  1PKT A;  2LCS A;  4F17 A;  4HVV A;  1WFW A;  2KMT A;  2YUN A;  1B07 A;  1BBZ A;  2O01 E;  1VQ7 T;  4DOV A;  4M7D D;  1ABO A;  4BE0 A;  2BZY A;  2F2X A;  2Y4Y A;  5GAM d;  3A8M B;  2YRD A;  2HD0 A;  3VS7 A;  3HPW A;  3I5R A;  2KQW A;  1D0Y A;  1I5L A;  1CSK A;  1Q86 U;  3TQ7 P;  2FRY A;  4C92 D;  2MWO A;  4OML A;  3OYD A;  2DVE A;  3QZ9 B;  5GAO q;  5LJ5 f;  2A37 A;  3JCM W;  2OI3 A;  2XHC A;  2KE9 A;  1FMW A;  3QBY A;  3CCQ T;  1RUW A;  2GTO A;  1RLQ C;  6AT1 B;  1KQ1 A;  1KFZ A;  5KYY A;  4QW2 A;  1K76 A;  1UGQ B;  1G3W A;  1I5O B;  1QVF S;  2KRM A;  2YUO A;  4LD9 K;  1KSW A;  4M4Z A;  2QEX T;  1NBE B;  3MEW A;  1Q81 U;  2RHU A;  2LQN A;  3OS2 A;  2R58 A;  1YCS B;  3V7S A;  4E7J A;  4JS4 A;  1YJN T;  2FG0 A;  2QQR A;  1TWB A;  1K4U S;  1FMV A;  2XG8 D;  3PNW C;  5FU7 B;  4BI4 A;  1VQO T;  1Q82 U;  1TUG B;  1KQS P;  2JTE A;  2EQK A;  3M9Q A;  5GAO l;  1OQK A;  1VIE A;  3M56 A;  4IUP A;  1YJN A;  2ESW A;  1OEB A;  2QXF A;  4J5Y A;  1QP3 A;  2YLB A;  3RBB B;  2COW A;  4ATO A;  3V8J A;  4J9B A;  3CPW A;  1Q81 R;  1PSF A;  4EMK A;  3KFV A;  1M9S A;  3OS1 A;  2JW4 A;  1MV3 A;  1T3S A;  1Q7Y R;  4BD3 A;  3JAM E;  3CPF A;  3P8B B;  3DLM A;  2P0P A;  2QDY B;  2DKG A;  1I1J A;  4F7U F;  1OU9 A;  1VOM A;  2P4R A;  4HCZ A;  5HK0 A;  3JCM d;  1UGS B;  2SEM A;  1Y07 A;  5LJ5 h;  3M53 A;  4FIB A;  2MPX C;  4XU3 A;  2QTV A;  1SF9 A;  3VS1 A;  2CS7 A;  4LUD A;  1MMN A;  1QVF P;  4C8Q D;  2R57 A;  4DBQ A;  1LPL A;  1WHM A;  1H64 1;  4JJB A;  3OSS C;  2KDS A;  3L2Q A;  4WCI A;  3OYY A;  3JV3 A;  1KC8 U;  3CQT A;  1ZUY A;  2DRM A;  1M2V B;  2CP0 A;  4M77 F;  1YJW T;  3CME T;  5GJW B;  2RK2 A;  4E7L A;  4CI0 C;  4F16 A;  1JQQ A;  2RQV A;  1RAH B;  2J6K A;  4F7U G;  1K9M R;  2O88 A;  2XMF A;  2F5K A;  4GLM A;  4C5E A;  4PKC C;  3RKW A;  3CD6 A;  4FU6 A;  1F1B B;  2FHD A;  2KRO A;  3OW2 S;  3M55 A;  4HXJ A;  1QCN A;  1NJI U;  3EH1 A;  3CMA A;  4IUU A;  4C8Q A;  3UPU A;  3QSU A;  1U1S A;  2E41 A;  1U06 A;  1PKS A;  3I56 T;  3H0H A;  3I56 Q;  4KH0 B;  4XTW A;  3L2Z A;  1KHC A;  3H9N A;  4XQ3 A;  1XQH A;  1TSF A;  4RTZ A;  3RUX A;  2F2V A;  2AHJ B;  3EFR A;  4C92 E;  2ZPI B;  4PFO A;  4RTV A;  2CSQ A;  1AOJ A;  4J9F A;  1VQP Q;  1KC8 R;  1Y7X A;  1TH7 A;  2AZV A;  3E9F A;  3GLX A;  1X69 A;  4LE9 A;  2CKK A;  5CCA A;  2PZ1 A;  5FW9 A;  1QVP A;  1PSE A;  4M78 A;  1U1T A;  1X6G A;  5GAN 7;  2HQH A;  3QJ6 A;  3LYI A;  1YI2 A;  3I56 A;  2AZS A; 
#chains in the Genus database with same CATH homology
 2V8I A;  2PUO B;  1H3Z A;  3SFM A;  2QA4 T;  1UGR B;  4FT4 A;  3RKY A;  3WXM B;  2E65 A;  5GAN e;  1S72 T;  4E7H A;  3QXE B;  4M77 E;  4A4H A;  2VXF A;  4N0A C;  4XU1 A;  4Y91 A;  3CC4 A;  5KE2 A;  3M57 A;  3O8V A;  3CC7 A;  3DB4 A;  1YHQ A;  4NS5 A;  5A0D A;  3FB9 A;  1JJ2 A;  1BI0 A;  2DD5 A;  4LDU A;  5CKB A;  3HSB A;  2IVW A;  1HK9 A;  2QQA A;  2WSF E;  3NFC A;  5C0M A;  5GAN g;  3MCA B;  3PIO A;  4M7D C;  4PJO D;  2E10 A;  5DY9 A;  5IAY A;  4PL6 A;  2DIG A;  2JUF A;  2LNV A;  4M77 C;  4A4K A;  4M7A C;  2DZ9 A;  1M1K C;  2M0O A;  1XTD A;  3TCJ A;  1KQS A;  3L1A A;  2WSC E;  4EMK B;  2F69 A;  3OYM A;  2XID A;  4M77 D;  4ZTF A;  2RHX A;  2JTM A;  4M75 F;  3QII A;  3L42 A;  4WF2 A;  1MGQ A;  1N27 A;  4ZN1 A;  2BIV A;  4XTU A;  1YJW A;  1R8O B;  5J39 A;  2L5Q A;  3M54 A;  2K3Y A;  4JJN K;  5CKF A;  1ZBX A;  2DO3 A;  3MET A;  4II1 A;  2EWN A;  5CIU A;  3A5Z B;  3ASK A;  3CCV T;  1KQS S;  1Y96 B;  2E5Q A;  2L8D A;  4M75 C;  3CMA T;  4OF1 A;  5HY6 A;  2YLC A;  3ME9 A;  5CVI A;  4P5N A;  2CZ0 B;  4EMG A;  3OA6 A;  2A3L A;  4R55 A;  2RD1 A;  2C06 A;  4RG2 A;  4XTX A;  2KSS A;  2M16 A;  4A4G A;  2D9T A;  4NL3 A;  1VQ5 A;  5GAM g;  5GAN 5;  4PJO E;  3LLR A;  2F5T X;  1UEB A;  4M7A A;  4M75 D;  2LVM A;  3T9N A;  4CRI A;  4JUV A;  3HL8 A;  3CME A;  1WJR A;  3HFO A;  4L6V 5;  3FDR A;  1BI2 A;  5GAN d;  2LQ8 A;  4A4F A;  1Y96 A;  5FU6 C;  3FRN A;  4XK8 E;  3CC2 T;  3QZ5 B;  3KBG A;  1YBY A;  3G4S T;  2NLU A;  2EQU A;  4JLI A;  2VC8 A;  1KHI A;  2DEQ A;  3S3O A;  1XOV A;  2XDP A;  5LJ3 g;  2Y90 A;  3X28 B;  1QP2 A;  3CXC S;  3PGG A;  3VKI A;  2E6Z A;  3X25 B;  3JCM b;  2H3J A;  2EJ9 A;  4X9C A;  3LWH A;  5IT9 E;  4R56 A;  2RJD A;  3C12 A;  4M75 G;  4C5H A;  2JZ2 A;  2ZPB B;  3LH0 A;  3Q1J A;  3NTK A;  2ZPE B;  4XU2 A;  3BDL A;  1K9M U;  5LJ3 d;  3UT1 A;  1WJS A;  5GMK j;  5LJ3 e;  5GAM h;  1I8F A;  4QVZ A;  5LL6 S;  3C95 A;  5CAI A;  2DIQ A;  4M7A B;  1X01 A;  1BIA A;  3A8H B;  4PNO A;  3VUZ A;  3HHT B;  4MMK A;  2GCX A;  2RK1 A;  4NOY A;  5A0L A;  5GMK e;  3OYN A;  1K9M C;  3RER A;  3OYK A;  4MZT A;  5C6S A;  5CKH A;  1VQP A;  2DD4 A;  3BW1 A;  4FL6 A;  2LT1 A;  1N6A A;  3CCE T;  4MDW A;  2GFU A;  4ZGE B;  4OMF B;  3GPL A;  3QYH B;  4YTL A;  2P0K A;  2VUB A;  4J6Y A;  1UGP B;  3BDU A;  3JRZ A;  3CXC A;  3VV0 A;  2JVV A;  1G3T A;  1VQO A;  4C8Q G;  4IUR A;  2V8J A;  1WGS A;  1Y71 A;  2E1H A;  2HNI A;  2RHZ A;  4J6X A;  3J81 E;  3QDR B;  4M78 E;  3FIF A;  1LJO A;  2QQB A;  3OBW A;  1P92 A;  2IG0 A;  5CKE A;  3V8L A;  2XIC A;  4QVD A;  4XTY A;  3JB9 I;  4C0F A;  2PU9 B;  4O5V A;  2GQV A;  1S72 A;  1GXI E;  4Q5W A;  4XTZ A;  3J80 E;  4C8Q B;  1JBM A;  4NL2 A;  4C0D C;  5FLX E;  3X20 B;  4MZM A;  1G3Y A;  2X4Y A;  5L8R E;  4A54 A;  3LWI A;  1VQ9 A;  2RI3 A;  1Q86 C;  3MEU A;  3G6E A;  4L5G A;  1BKB A;  4N4I A;  3DKM A;  5KH6 A;  2LX9 A;  3I55 T;  3SWN C;  4ZGD B;  1WJQ A;  1XNI A;  1QW1 A;  3PMT A;  4OP0 A;  3TU4 K;  4HCB A;  2VGM A;  4KUI A;  1M4Z A;  2RJF A;  4DOW A;  4M7D B;  3CC7 T;  4BUG A;  1K73 C;  4HT9 A;  4C92 A;  4C8Q C;  1N8R U;  3CCQ A;  1I81 A;  5GMK i;  3HFN A;  2KY9 A;  3CCR T;  4UC4 A;  2QA4 A;  4F7U B;  2QTX A;  2OTJ T;  5D6W A;  4OB2 B;  1X75 C;  5DM7 R;  5LJ5 g;  1WQW A;  5FRO A;  4LDW A;  5DLO A;  2VV5 A;  4C0G A;  1VQL T;  2XD0 A;  3A8G B;  2JNG A;  2XK0 A;  2X4J A;  3P8H A;  2DAQ A;  5A2Q E;  2CZ7 B;  5LJ5 j;  3M58 A;  2G3R A;  3QHS A;  2MWP A;  2EIF A;  3V7C A;  1ZQ1 A;  1M1K U;  1VQK T;  4BB7 A;  5LJ5 e;  3QYG B;  1YJ9 A;  2ZGW A;  3OSV A;  3CC2 A;  3BFM A;  4JRQ A;  1K8A U;  1M5Q 1;  1VQ4 T;  2EKO A;  3V8K A;  3CCS A;  1BI1 A;  2P0Q A;  4N4H A;  4M77 A;  3R6O A;  3P8D A;  2R5A A;  1QVF A;  4M78 F;  3PTA A;  3L2W A;  2RO0 A;  5HK3 A;  5GAN f;  2ZCF B;  5GAN 8;  2D6F A;  4F7U A;  3OYC A;  3M4Y A;  5GMK m;  3JB9 G;  4QVC A;  3RKX A;  1G3S A;  2EAY A;  3OMC A;  4QQG A;  5J3B A;  1YHQ T;  3DB3 A;  4HT8 A;  4M7A E;  3OYG A;  2HBP A;  3RMQ A;  4FM4 B;  5LJ3 h;  2RHI A;  3JCM g;  2QI2 A;  2DJZ A;  2LQK A;  5FU7 C;  5GAM e;  2LRQ A;  4N0A A;  4PJO A;  4E7I A;  4OB0 B;  4IKF A;  3G71 T;  1VQ8 A;  4C0D B;  3OS0 A;  1O9S A;  4ZN3 A;  3DLL A;  4J7I A;  3VYH B;  5D6Y A;  4EMK C;  3QJY A;  3LW5 E;  4BDZ A;  2RI5 A;  4C0Z A;  4E7K A;  2V8K A;  3OW2 A;  3L2R A;  4A53 A;  3JCM J;  1OZ3 A;  2EQM A;  1ZHI A;  5CO7 A;  2RHY A;  3JCM e;  2K5I A;  1QVG S;  4FSX A;  2O4X B;  4BY6 B;  3X24 B;  4BE1 A;  1G5V A;  4BI3 A;  3A8L B;  2EQJ A;  1YIT T;  4X9D A;  3CCL T;  5IN1 A;  1M90 C;  5HKC A;  4HA8 A;  4DQ2 A;  3CPW S;  2MAM A;  3CCJ A;  2OTL T;  3E9G A;  2E12 A;  2ZPF B;  3TRE A;  1KD1 U;  3J7A F;  3URG A;  4M78 D;  3INZ A;  2QEX A;  4M78 G;  2LT4 A;  1VIF A;  5CQY A;  3H6Z A;  3MO8 A;  2DXT A;  2EYQ A;  3EFS A;  3A8O B;  4V2S A;  4C8Q E;  2CZ6 B;  4A4E A;  1VQM T;  1W2B A;  4QQ6 A;  4LD6 A;  3CCL A;  2LC4 A;  4RCB A;  1VQK A;  4ME7 A;  2K5F A;  4O6J A;  4IUV A;  1OI1 A;  2YRV A;  1KQ2 A;  3OYI A;  5GAN 3;  5FRN A;  3HKS A;  3CCM T;  4EPC A;  3VU3 C;  4QQD A;  2PVD B;  4RKU E;  3E19 A;  3AHU A;  3HRU A;  2GF7 A;  2K3X A;  3HP9 A;  5KE3 A;  3CC4 T;  4PJO F;  1B34 B;  1VQ6 A;  4J8O A;  4M7A G;  3OBY A;  4HCC A;  1I4K 1;  4EDU A;  4BDY A;  3BY7 A;  3G71 A;  1NJI C;  4GLK A;  3S6W A;  4M75 A;  2XU8 A;  3SB2 A;  2XDD A;  4ZGJ B;  3LGL A;  3JCM f;  3FEO A;  2MF2 A;  1YI2 T;  1VQN A;  1V29 B;  2JTF A;  4KBM B;  4M7D F;  2HQE A;  1JJ2 S;  5M9O A;  5GMK l;  3GIB A;  3QG1 A;  3CD6 T;  4L59 A;  5CR2 A;  2XI9 A;  2EJG A;  1FWZ A;  3CCU A;  2KMT A;  1VQ7 A;  2X4W A;  4HKE A;  1Q7Y C;  3JB9 D;  3CBP A;  5GAM j;  1VQM A;  2O01 E;  1VQ7 T;  1MHN A;  3HRS A;  4XU0 A;  4BE2 A;  2D0Q B;  1Q81 C;  4Z02 A;  2LDM A;  2X4X A;  3WVE B;  4M78 B;  4RCC A;  5GAN 2;  4DOV A;  4M7D D;  4BE0 A;  1VUB A;  1O75 A;  2Y4Y A;  5GAM d;  3A8M B;  3SWN B;  3PFS A;  4DA4 A;  2HD0 A;  3MHX A;  2O4X A;  3HPW A;  4F7U E;  2KQW A;  2ZZD A;  1I5L A;  2DK3 A;  3MEA A;  2LTO A;  2ZPG B;  1Q86 U;  2B8A A;  1Q82 C;  4C92 D;  1RI0 A;  2MWO A;  3C94 A;  4XAX B;  2PQW A;  5EG2 A;  2DVE A;  4PJO G;  3OYD A;  2K4Y A;  1YIJ T;  4PLI A;  3QZ9 B;  2WSE E;  5I21 A;  5GAO q;  5LJ5 f;  3QUI A;  4M78 C;  5I2S A;  3JCM W;  3EAE A;  4XTV A;  2XHC A;  3SWN A;  5GAN h;  5D6X A;  3JSC A;  3CCR A;  4C92 C;  4GY5 A;  4OGC A;  3QBY A;  3PMI A;  3CCQ T;  5KCH A;  4TVR A;  1KG1 A;  1N9S A;  2I2L A;  4OB1 B;  1SSF A;  3JCM X;  3CCJ T;  4M7D E;  1KQ1 A;  1YIT A;  4QW2 A;  1UGQ B;  1G3W A;  1HXD A;  5GAN j;  4M77 B;  1BI3 A;  3QO3 A;  1QVF S;  3KUF A;  1OZ2 A;  5A0G A;  1K73 U;  1D3B A;  3OYB A;  4LD9 K;  2BKD N;  2R5M A;  4LDV A;  4C92 B;  3L2U A;  3MEW A;  4BI8 B;  2QEX T;  1VQL A;  1Q81 U;  4M75 B;  4D6W A;  1VQN T;  4BAC A;  2KAF A;  3LX7 A;  3M5A A;  2RHU A;  3OQ5 A;  3OS2 A;  1WPY A;  2R58 A;  4E7J A;  3RES A;  3V7S A;  2E64 A;  4JS4 A;  1YJN T;  4JS5 A;  3SDZ A;  1JRI A;  2PVG B;  2QQR A;  4PJO B;  4C92 G;  1LNX A;  4LDX A;  4LDY A;  1WNL A;  3JB9 F;  2XG8 D;  3PNW C;  5FU7 B;  4BI4 A;  4ELY C;  1VQO T;  1Q82 U;  3VJP A;  3M9Q A;  2DPP B;  2EQK A;  5GAO l;  1M1G A;  2DTH A;  2OTJ A;  1VIE A;  1D3B B;  1DJ7 B;  3CBM A;  3M56 A;  4IUP A;  4N4G A;  3V7R A;  3OYE A;  1YJN A;  2CZ1 B;  2QXF A;  4J5Y A;  1QP3 A;  2PVO B;  2P4T A;  2YLB A;  3OYH A;  1W2B S;  4M77 G;  4ATO A;  2RJE A;  3L2V A;  4BY6 C;  3V8J A;  3CPW A;  4MML A;  4JRP A;  4PJO C;  1PSF A;  4EMK A;  3TEE A;  1YJ9 T;  1M9S A;  3F70 A;  4JDS A;  3ZBD A;  3OS1 A;  5I2M A;  3CCV A;  3QPH A;  2QQ9 A;  4BD3 A;  3G6E T;  2DTO A;  3JAM E;  3GNG A;  1EIF A;  5FU6 B;  2DZC A;  3CCU T;  3CPF A;  5GAO m;  3P8B B;  4C5I A;  3DLM A;  2DXU A;  2P0P A;  2QDY B;  2DKG A;  3C4S A;  2HQX A;  2RH2 A;  1M90 U;  4F7U F;  4HCZ A;  1YCY A;  3JCM d;  5HK0 A;  3OYJ A;  1UGS B;  1NPP A;  5GAO p;  1Y07 A;  2XDB A;  1B34 A;  4M7A D;  5LJ3 j;  5LJ5 h;  3M53 A;  3OMG A;  4FIB A;  2FB7 A;  4XU3 A;  2L3R A;  1YIJ A;  1UB4 A;  4M7A F;  3ZEH A;  1X6O A;  4PLL A;  2CS7 A;  4M7D G;  2CGH A;  5CK9 A;  2KVQ G;  3CCM A;  2VYT A;  4OVA A;  4C8Q D;  2R57 A;  2FVU A;  3FJP A;  3OS5 A;  3RIR A;  3UDC A;  5GAM f;  4B9X A;  1H64 1;  3VYG A;  3CCS T;  2L89 A;  3NTI A;  3OSS C;  4VUB A;  1VQP T;  2KDS A;  3L2Q A;  1BYM A;  5GAN 6;  1VQ4 A;  3OYY A;  2K2V A;  1BIB A;  2Y4X A;  2K5L A;  1JB0 E;  5J26 A;  3OYL A;  4OGE A;  1M8V A;  4JRI A;  1KC8 U;  1U8R A;  4C92 F;  1NE8 A;  4Y28 E;  1NZ9 A;  2ZPH B;  3G4S A;  3E1S A;  5LJ5 d;  4FT2 A;  3JB9 H;  5GMK h;  2WAC A;  3MP1 A;  4JRK A;  3GF5 A;  4M77 F;  3JCM V;  4KUD K;  1YJW T;  1K8A C;  3HRT A;  3NTH A;  5CQX A;  4C8Q F;  3PIP A;  3JCM h;  2DXB A;  3CME T;  3N5B B;  1VQ8 T;  3ZFJ A;  2RK2 A;  4JLG A;  4E7L A;  3JCM P;  2OAU A;  3OB9 A;  2RB6 A;  4CI0 C;  3OYF A;  3UWN A;  2RJC A;  3CEY A;  3CCE A;  4OB3 B;  1N9R A;  4X34 A;  1VQ6 T;  4J83 A;  1Q7Y U;  3FLG A;  2E6N A;  2LCC A;  2LCL A;  2E70 A;  5FRM A;  2PUK B;  4F7U G;  2VXE A;  2BUD A;  2RI2 A;  3RMS A;  3WVD B;  2F5K A;  2FL7 A;  2M1H A;  4ELZ C;  3FC3 A;  4MDX A;  2VGN A;  3I55 A;  2EFI A;  2EJF A;  5DLQ E;  4C5E A;  1WQ7 A;  2MI6 A;  3QKJ A;  1W4S A;  4IUQ A;  4KT0 E;  4PKC C;  3RKW A;  5KCO A;  3CD6 A;  4FU6 A;  1QVG A;  2FHD A;  3JCM Q;  4KUL A;  3OW2 S;  3JCM c;  3M55 A;  5CKD A;  4IUT A;  1NJI U;  2KK4 A;  3MP8 A;  2QQS A;  3CMA A;  4IUU A;  3S3M A;  1IZ6 A;  4C8Q A;  3UPU A;  3QSU A;  2RM4 A;  5AYF A;  1U1S A;  3SD4 A;  2DTI A;  2E41 A;  3VUB A;  4C5G A;  4E47 A;  4ZTJ A;  1KC8 C;  3I56 T;  5GAN 4;  2JN0 A;  1FXX A;  3ER0 A;  1NPR A;  2JOY A;  3M4G A;  1KD1 C;  2M9U A;  4XTW A;  2CYZ B;  1FX7 A;  3L2Z A;  1KHC A;  3X26 B;  4XQ3 A;  5GAO n;  1XQH A;  3G7Z A;  2DXC A;  4M75 E;  3S3N A;  3RUX A;  5LJ3 f;  2AHJ B;  3M59 A;  1M1F A;  3EFR A;  4C92 E;  3OYA A;  2X35 A;  1VQ5 T;  4RMO A;  3GP8 A;  2ZPI B;  4M7D A;  3GNF B;  1LOJ A;  3KXT A;  1OYX A;  2OTL A;  4RG8 A;  3PT9 A;  3GOX A;  1Y7X A;  4EMH A;  1TH7 A;  3E9F A;  2A7Y A;  2RA2 A;  3GLX A;  2HAX A;  4J6W A;  2CKK A;  2FYK A;  3LGF A;  5CCA A;  2K57 A;  1QVP A;  1PSE A;  3CBO A;  3OY9 A;  2GFA A;  4M78 A;  1N8R C;  1U1T A;  2MMP A;  2XKO C;  4J7F A;  5GAO r;  4MZP A;  1VQ9 T;  3MEV A;  5GAN 7;  1IRE B;  3QJ6 A;  3JB9 J;  3LYI A;  3MP6 A;  4B9W A;  3I56 A;  1AHJ B;  1YI2 A;  1RL2 A;  2YHT A;  3H8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...