2PUOB

Crystal srtucture of the nem modified ferredoxin:thioredoxin reductase
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
73
structure length
73
Chain Sequence
MNVGDRVRVTSSVVVYHHPEHKKTAFDLQGMEGEVAAVLTEWQGRPISANLPVLVKFEQRFKAHFRPDEVTLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural snapshots along the reaction pathway of ferredoxin-thioredoxin reductase.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Electron transport
molecule keywords Ferredoxin-thioredoxin reductase, catalytic chain
total genus 11
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02941 FeThRed_A Ferredoxin thioredoxin reductase variable alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2puoB00
2CZ0B 3A8LB 3WVEB 2CZ1B 2ZPBB 4L6V5 2DD5A 3QZ9B 4OB0B 3A8GB 1PSEA 3QZ5B 1IREB 1UGRB 3QXEB 3A8OB 3QYGB 2CZ7B 2CZ6B 3HHTB 3X20B 4XK8E 2PUKB 3X25B 2WSFE 1JB0E 1UGPB 2WSCE 2PUOB 2DXBA 2PU9B 3QYHB 4KT0E 2ZZDA 2WSEE 4Y28E 4RKUE 1AHJB 2DPPB 1UGQB 4OB1B 4OB3B 3A8MB 4OB2B 2ZPIB 2O01E 3WVDB 1QP2A 2ZPEB 3A8HB 3VYGA 3VYHB 1QP3A 2QDYB 4FM4B 2DXCA 2AHJB 5L8RE 2ZPFB 4ZGEB 1V29B 2ZPHB 3X24B 1UGSB 4ZGDB 4ZGJB 1GXIE 2CYZB 1PSFA 2DD4A 3X26B 3LW5E 2ZPGB 2D0QB 2PVDB 2PVGB 2ZCFB 1DJ7B 3X28B 2PVOB
chains in the Genus database with same CATH superfamily
1XTDA 3E2UA 3CCVT 3OSVA 2XDDA 1ZUUA 2ATCB 2DXUA 2P0PA 1D0ZA 1KD1R 3CCEQ 2YRCA 3G4ST 1VUBA 3A8MB 3VV0A 2KRMA 4A4GA 3CCLT 2P0KA 1WHGA 4HCBA 4QVDA 4RCCA 1S1NA 2RJDA 1R0BG 2HMAA 1K73R 1M2OA 3NMZC 2NUPB 3CC7T 1GCQA 3M59A 1BU1A 4C0DB 3UT1A 3QYHB 5GAMf 2E5KA 3MP6A 3H41A 3TCJA 4NS5A 2DMOA 3EG2A 4OP0A 4X9CA 3MKDA 1G3YA 3PVLA 2LVMA 3C94A 1Q7YC 5A0DA 4JJDA 1VQ4Q 2LC4A 1IHWA 2E4HA 2EBPA 2DIQA 2DLPA 1YJWT 4RTVA 3H6ZA 2K9GA 4J9DA 3V8LA 1NM7A 3JCMc 2O2OA 2X4YA 3OS1A 4CC2A 1OULA 3EHQA 2IG0A 3CC7Q 4FIBA 5D6YA 1ZQ1A 3M4GA 1U5SA 2A0FB 4F7UB 2B8AA 3HPWA 1AD5A 3TSWA 1FXXA 2HEQA 2PVOB 3RESA 2MAMA 2OX7A 2QTVA 3C12A 4IUUA 1WDXA 3RBBB 1NLOC 3QUIA 2RQWA 4M7DD 2DTIA 4Q5WA 2K5IA 4HT9A 1MGQA 3PGGA 4L5GA 2LCSA 3GF5A 3CCMQ 2E41A 2RI5A 1YHQT 3RKYA 2D8HA 3OMGA 1W6XA 1NPPA 1VQ6T 3OYCA 4J9FA 4AMCA 5KCHA 4M78D 1Y96A 3EG3A 4C5GA 1OI1A 3OSSC 4LN2A 3JCMX 2PUOB 2DKGA 2XG8D 2RHUA 3EFOA 3M9QA 2L8DA 3OS0A 3VYHB 2DIGA 1QWFA 5FW9A 2ECZA 4PJOE 3DB3A 3R6OA 4ZGDB 1BIBA 1PSFA 1X2QA 2V8KA 2E6ZA 4CC4B 1IB8A 4J5YA 2EQJA 4M75D 1Y96B 3HKSA 2MWPA 2GBQA 2DRMA 3RUXA 4J9EA 3JAME 4OB1B 1QKWA 2RI2A 3T9NA 2JS0A 1VQ6A 2RO0A 1YIJQ 4AFQC 2L3RA 3A1PA 4FU6A 2CUBA 3HRSA 2JTEA 4EMHA 1ZA1B 1MUZA 2J6OA 4NL2A 2EKOA 1AT1B 3H0HA 1ARKA 4OGEA 3OYHA 5FU6B 2DPPB 4M7AA 1HJDA 2ZPEB 3M0UA 2ZAEA 4M77D 4M78F 2DXCA 2K5LA 2OI3A 1LNXA 2H3JA 1KHCA 2X4JA 4PFZA 1YITT 2LZ6B 1D3BA 1HD3A 2CH4W 3I5SA 1Q81C 3NTHA 4M7AC 3CCSQ 4M75E 1GCQC 2AKLA 1C6VX 2CUDA 2KRSA 1W4SA 2DL8A 2EYXA 5I2MA 1QVFA 1C1AA 1YJ9T 2CP2A 1QW1A 1IGUA 1SF9A 4LUDA 1VQ5T 2FRYA 2L5QA 2J6FA 1E7OA 1WIEA 2O31A 1M30A 3SB2A 2NUTA 2LJ3A 3L2QA 1HSQA 1D3BB 3JCMe 2KROA 4PFOA 4J83A 1Y57A 5IAYA 1CKAA 3JCMJ 3G6EQ 4M77B 3MHXA 4MDWA 3DLLA 2YUPA 1PD1A 1D1BA 2DEQA 1N6AA 1H641 3TVTA 1TOVA 2QA4T 3J80E 5CO7A 4DBRA 4PL6A 3INZA 1CKBA 2X9HA 3VS4A 3O5ZA 5IN1A 4JRQA 2FHDA 5IHKA 2BTTA 1ZA2B 1K9AA 2JXBA 3SD4A 5LL6S 3E19A 1KQSS 4XTVA 3EGDA 1TUGB 4XU1A 2LJ1A 1S72Q 2LCLA 1JO8A 4BDYA 1M90R 1KG1A 2M16A 4EMKC 2DXBA 3L1AA 4MZTA 3EHRA 3OYYA 3EGXA 2VC8A 3OYDA 3CD6T 1K73U 1GBRA 1QMCA 1QP3A 1ZBXA 2FZGB 1VQPQ 4XU3A 1OYXA 2ZPHB 3FC3A 3M5AA 4XU2A 4C92G 4C8QA 4JS5A 4BY6C 1NZ9A 4V2SA 3EGDB 3AT1B 1ZUKA 1VQMA 3LYIA 3I56T 4CC3A 3EH1A 3AHUA 4NOYA 4A63B 1OPKA 4A4HA 3F70A 3QIIA 4Z89A 3VU3C 5CR2A 3M0QA 1TUDA 3UA6A 4JPBW 2HSEB 4AFUC 3QDFA 4M7DE 3OYIA 3DB4A 1K8AC 1AZGB 2HAXA 2YT6A 4JLIA 1YFNA 3PTAA 1YCSB 3HL8A 4X9DA 5HY6A 6AT1B 2GTJA 1GXIE 1U3OA 1O9SA 4F7UG 3L2RA 2KE9A 4ZTFA 3OYMA 4OB0B 1M90U 2OTJT 2VVKA 3KBGA 3MPUB 1X75C 2OJ2A 5GJVB 2YRDA 1D1AA 3CCUQ 4DBFA 3VRZA 2EIFA 8AT1B 1KHIA 1G2BA 3LLRA 1CSKA 2LQKA 1X6GA 2F1LA 2RJCA 4C5HA 5CKDA 1P92A 2KRNA 2DO3A 1N8RU 1MMGA 1JRIA 2DXTA 2ZPBB 4ZN1A 1V1CA 4YTLA 2EYWA 2V26A 4BI8B 1ZX6A 1R0CB 2D1XA 3CCRQ 2VWFA 4C0DC 2DTHA 1PRLC 4QQ6A 3L2UA 4ELYC 3WVEB 3QZ5B 1BIAA 2CZ6B 4F16A 3CMAA 4DOVA 5DY9A 2YLCA 4F04B 3JCMf 4RTWA 2FZCB 1YITA 1H8KA 4RTZA 4M78A 2QDYB 4C92F 3PT9A 3OMCA 2CREA 4R56A 4ZN3A 8ATCB 2CZ0B 4N0AA 2QK0A 2EGEA 1UGRB 2COYA 2RI3A 2A08A 3RR6A 4LD6A 2H8HA 1ZUYA 2RN8A 2WSFE 3CCMA 3FDRA 3CCVQ 2EGAA 3BE3A 3RERA 1ZSGA 2SEMA 3GIBA 3VYGA 4DQ2A 1B7TA 1RAGB 2K3XA 4R0KA 4OMFB 3JCMd 2EGCA 2KBTA 1I8FA 2QGFB 2C0IA 1BI2A 2PVDB 3J7AF 2DJZA 4JLGA 3CXCA 5DLQE 1ZHIA 2QA4A 5CAIA 3VS0A 1VQLQ 2VV5A 1KC8R 1I1JA 2FG0A 1U8RA 2F5TX 2WACA 5LJ5j 2COWA 4MMKA 2ROLA 1YITQ 3CCJA 1QKXA 5LJ3d 4FW1A 4PK4A 1SG5A 3J81E 3EG9A 3CMAQ 2C06A 2P4TA 1OZ2A 3QSUA 1K4US 1K73C 1XQHA 2M9UA 3CCJQ 3A8LB 2XU8A 2HZYA 3CMEA 1G5VA 1W2BP 5GANf 1KC8U 5A2QE 4A53A 1QVGS 1VQLA 2XIDA 4C92E 4Y91A 1AHJB 2DRKA 2XHCA 3V7CA 3WVDB 3JCMQ 1MV0B 2GGRA 3FLGA 3G6ET 3OYAA 1NEGA 1V29B 4KH0B 3S6WA 2V1QA 2VXEA 2QQ9A 3CCSA 2ESWA 3MEUA 1RACB 3UF4A 3HRTA 3CCJT 5GAN6 1S72A 2JZ2A 5GJWB 4Y28E 1M90C 5GAOp 1Q81U 2EYYA 2OTLA 2GNCA 5CKFA 1M3CA 1OOTA 1RI0A 1UB4A 3NGPA 2VYTA 4EIKA 4KGXB 2JN0A 2K57A 2DA9A 4NL3A 3LWHA 4AG2C 1BB9A 2DL5A 4OF1A 1GCPA 1W1FA 3O8VA 5FWCA 1UGVA 2EFIA 3RKWA 3G6EA 4XQ3A 3P8DA 2JM8A 2CP0A 1VQ9Q 2J6KA 1X6OA 3ME9A 1ACMB 3MEVA 4M77G 5KYYB 2JW4A 4J7FA 1QVFP 3NHNA 5FU6C 4J8OA 1X2KA 4O6JA 4J6YA 1WJQA 1YIJT 2FZKB 1M8MA 3QWYA 2WSCE 2DL4A 2GFUA 2LRQA 2F69A 2EJFA 3QPHA 3L2WA 3JCMW 3M0SA 1BKBA 1KQSP 2HKNA 4E2FB 5D6WA 5CCAA 4TVRA 1NYGA 3QZ9B 3OA6A 2K2MA 3PE0A 5GMKl 2J7IA 2HKQB 1UECA 2MK5A 2ZZDA 2PTKA 4X34A 3ZFJA 2K3YA 3CPWA 4MZMA 2EQMA 3HTRA 1IXDA 2KYMA 3JSCA 1BK2A 4ZNXA 4KUDK 4D6WA 5CKBA 1K0XA 1V76A 2JUFA 1RAFB 3G4SA 1VYUA 4XTXA 2LT1A 4KH1B 4M78E 4OMLA 3NFCA 4MZPA 1TWBA 3CC7A 1VQOQ 5HK3A 2DVEA 2XDPA 2RHZA 2HBWA 1XNIA 2V1RA 4C92C 2KXCA 2MCNA 5CKEA 5CK9A 1ZSZA 2HCKA 2R57A 4M78C 3QG1A 4RTUA 2W10A 2QQAA 4CRIA 1EX4A 4M7AD 1VQ7T 2L3QA 4JRKA 4AG1C 1YJWA 4N4HA 2A28A 3JB9H 2YWWA 1QWEA 4ATOA 2YLBA 5M9OA 3JCMb 1UG1A 2BZ8A 2KYBA 4M75B 2KT8A 2O9VA 5A0LA 2QASA 3KUFA 2X3WD 4RUGA 2RK1A 1KQ1A 2CZ1B 2O9SA 2XD0A 1IREB 4E7HA 2NYSA 3QYGB 1SPKA 2RMOA 3EFRA 1AWOA 1NJIU 1GRIA 3META 3QJ6A 5LJ3e 2KR3A 4PNOA 5I11A 2Y4YA 4C8QC 2JT4A 2HQEA 5GAMd 1Z9QA 1Q7YU 5KYNA 2E65A 2QGGA 4FW2A 4L59A 3OYEA 3ASKA 3S3MA 1VIEA 4BE1A 1YHQA 3D7SB 1VQ5Q 4QVCA 1OZ3A 5CQXA 1IRXA 1IGQA 3TREA 1UUEA 4DA4A 3A8HB 1Q7YR 3FEOA 1WXUA 2Y90A 4ELZC 4AFSC 2F2WA 1TSFA 1S72T 1OU8A 3PIOA 1VQ9A 1G3SA 4UC4A 1YJNA 5C0MA 1WXBA 2FEIA 3MO8A 4BE2A 1WHHA 1AEYA 1WHKA 2EYZA 4HA8A 1Q82C 3S3OA 1KFZA 2FL7A 2CT4A 3MCAB 5HKCA 2CP3A 2XK0A 4M7AF 3VUZA 3H8ZA 4LDYA 1DJ7B 1YHQQ 5GAN5 1Q86U 3NTKA 2P84A 4A4FA 1NJIR 2M1HA 1I5OB 3CBMA 4PJOF 1M3BA 1KD1C 2J05A 1VQKA 5LJ3h 2BE9B 2JNGA 2CSQA 2DE0X 1UFFA 3OBWA 3CC2T 1VQ9T 4KBMB 1Y07A 4HKEA 1YIJA 2W0ZA 4F7UA 3SFMA 2DILA 1ZLMA 3PIPA 5CVIA 2BZYA 2KGTA 3I35A 1M1KU 3JCMV 1M9SA 4J9GA 1OX8A 2KNBB 1WNLA 2RM4A 3OYFA 3QJYA 2A36A 1C0MA 2E1HA 3H9NA 4PJMA 2HQHA 3VS1A 4J9IA 1N9SA 3MP8A 3G7ZA 4OMOA 3C0CA 2QEXA 2JTFA 3A98A 4PJOD 4HT8A 1FMWA 3PMIA 3LGLA 1EIFA 1K8AU 2CP5A 3JB9F 1WX6A 4JRIA 2RPNA 3EH2A 2QEXQ 2COZA 4C0ZA 2O4XA 5EC7A 1ABOA 1ZSZB 1D0XA 2BE7D 3BFMA 3OW2A 4BB7A 3TSZA 4HVVA 1PHTA 1Q82U 2HNIA 3GNFB 2YHTA 1HYOA 1KK7A 2VUBA 4RTTA 4IUTA 2QEXT 1QVPA 4M75F 3V7RA 1J3TA 2SRCA 2AKKA 3OYKA 1K9MU 1NJIC 4QT7A 2ZPFB 3SWNC 2R5MA 2GTOA 1QVFS 2EPDA 1VQ7A 3E9FA 1NPRA 4M77F 5GANe 1LVKA 2ED0A 3SWNA 2LP5A 1VQ4T 4DEYA 1M1KR 1QCFA 2EVRA 4EDUA 1AZEA 1EFNA 5ECAA 4Y92A 4FYXB 3OS2A 4FT2A 1OPLA 1H3ZA 4P5NA 4HCKA 1HK9A 1U1SA 1B07A 3CPWS 4QQGA 2NUPA 2QAZA 5LJ5d 2EQKA 1PM3A 3HHTB 4FCYA 3SWNB 3VS5A 1VQOA 3LGFA 5FWBA 2KAFA 2DVJA 1SHFA 1RL2A 1MHNA 4WTOB 3G4SQ 1GFDA 2NUTB 1JJ2P 2KSSA 2PVGB 1WFWA 1M2VA 2I0NA 1TTHB 3GPLA 5I22A 2HL5C 4M77A 4J6XA 4C0GA 2RA2A 3FJ5A 3GNGA 4HCCA 2EQUA 3R6NA 4OB2B 1B3QA 4GY5A 5EG2A 1YWPA 5L8RE 1PKSA 1KSWA 4X1VA 4BD3A 2GQIA 5GAOn 2C0OA 2GCXA 3SDZA 4HXJA 4RTYA 3RDVA 2DX1A 2MI6A 2RHIA 3JB9I 3A5ZB 4CC7A 2CH4A 3X20B 1VQ8A 4KT0E 4PJJA 5FU7C 5GMKm 4IUVA 3EGXB 1VQ6Q 1M27C 3MEWA 2CP6A 3HP9A 1GL5A 1OEBA 4PKCC 5KH6A 3ZBDA 1OQKA 1VA7A 4IUPA 1YJ9A 1PCXA 4JJBA 2LQNA 4C8QB 2NWMA 4KGVB 4D8KA 3I55A 3CMEQ 3I9QA 4PJOC 4M77C 1B34B 3G71Q 4KRTA 1D0YA 4M78G 3CMAT 2LX9A 4XTUA 2L3SA 2JJ9A 3EGUA 2PQWA 4JJCA 1SRLA 5CKHA 9ATCB 2LDMA 5LJ3f 4MDXA 4KULA 5GMKi 5GAN4 3OYGA 2QTXA 4N0AC 2L3PA 1FMVA 2VGMA 1IO6A 2E3IA 2CS7A 3QXEB 2C0TA 4JJNK 3JCMg 1JJ2S 2J06A 2YXYA 1T3LA 4EPCA 1T0HA 4E7KA 2DAQA 4DBQA 3VS6A 3HFNA 4M75G 2O4XB 3BW1A 2EKHA 3CCMT 3M0RA 2JTMA 3CCVA 2KK4A 1M3AA 3UDCA 1UGSB 4PJNA 4Z88A 4LNPA 2ED1A 3CD6A 5KCOA 2D9TA 1GFCA 4RG8A 3CXCP 4OVAA 2LQWA 1TS9A 1PSEA 2XMFA 4JZ4A 1XJWB 3G71A 5IHIA 3EAEA 1M8VA 2QQRA 4ZTJA 1WJSA 4E7SA 1VQMT 1N5ZA 4HVWA 3UWNA 4C8QD 3I56A 2EAYA 5GANd 1YJ9Q 1UTIA 3BDLA 3TEEA 3KXTA 2QDLA 2ZPGB 5CIUA 1YP5A 2DYBA 3VUBA 3A8OB 5LJ3g 2EJGA 4XK8E 2AIRB 2P4RA 2IVWA 2MPXC 3OQ5A 4MMLA 3M55A 2K79A 1VQLT 1Y0MA 2FVUA 1WA7A 2VASA 3P8BB 2DBMA 2G3RA 3ER0A 3LH5A 3CBOA 4FSXA 3OY9A 1VQKQ 2DD5A 1E6GA 3UPUA 4J9BA 1T3SA 1BBZA 3OYLA 1TG0A 1WJRA 2E10A 1JQQA 3OBYA 5GAN7 2MOXA 5J39A 2OTLQ 2CGHA 3CCLQ 2DJQA 5A0GA 3CCEA 1NG2A 2AHJB 1NLPC 2D8JA 2X4XA 1SRMA 4IKFA 2OTLT 2M0OA 1FYNA 4JDSA 1I07A 1MMDA 1M2VB 3UA7A 5KE3A 3CC4A 4E7JA 2D0NA 2K4YA 1BI3A 4LUEA 2E3HA 1XOVA 2XKOC 2WSEE 5LJ5f 5LJ3j 2JOYA 4IURA 2LJ0A 2DERA 3OYNA 1PC0A 1VQNQ 4ME7A 1BCOA 4IIOA 3M58A 1ZSZC 1UE9A 2K3BA 3JB9J 1I81A 2DETA 1WHMA 4M7AE 2DL7A 1YI2T 1AWWA 4C92D 2OAWA 2RD1A 3RMSA 3VS3A 3VJPA 2FRWA 2KI7A 2A7YA 1KC8C 4PFPA 3CC4T 1E6HA 2L0AA 2QA4Q 2VB6A 2CSIA 1LOJA 3JCMP 2YDLA 3CCUA 5IXBA 1WQ7A 1TUCA 1YN8A 1AVZC 3OS5A 2A37A 3C95A 3IQLA 1R8OB 3REAB 1T0JA 2OTJQ 2KEAA 3PVQA 2RK2A 2V8JA 3FB9A 4PJOA 5GAN8 1RAEB 3H0FA 1YI2A 1K76A 4LDWA 4B9WA 5DLOA 2PNIA 4FYVB 4DEXA 3CCLA 4E7IA 3EFOB 1TXQA 4RKUE 2E64A 3CQTA 4GLKA 4BDZA 3CPWP 3HFOA 5GAMg 4FT4A 4XAXB 1A0NB 5IHNA 4PJOB 1RLPC 1M1GA 3G1JA 2JS2A 2HD0A 1QCOA 1KQSA 5I21A 2LQ8A 3HSBA 3X25B 1K9MC 3SEMA 3M56A 4A54A 5GMKh 4E47A 3DKMA 1JBMA 4OMMA 1LCKA 2R5AA 2CT3A 2EWNA 4OMNA 4J6WA 4J7IA 2M02A 2DZCA 3EFSA 1UJYA 5KYWA 1YCYA 3CCST 2RB6A 2JMCA 2RQRA 2Z0WA 1NBEB 3BDUA 4FYYB 2MMPA 1MV3A 1MNDA 2I2LA 1VYTA 5AT1B 3NPFA 2L89A 1QVGP 1JEGA 1BI0A 5CQYA 3RNJA 2E5QA 3U23A 3CD6Q 1TH7A 1RAIB 4F17A 2FB7A 5KYWB 2LCCA 1MMAA 4JZ3A 5GANh 2L2PA 1Q95G 4KUIA 1U1TA 1YJNQ 3QKJA 2JVVA 4B6MA 4N4GA 2V8IA 2QG9B 1NE8A 1X6BA 3S3NA 3JCMh 3QDRB 3SHWA 3CCRA 4GLMA 2HL3A 2E70A 2IPOB 4LE9A 3CCET 1YNZA 2DTOA 4B9XA 2EW3A 5IXFA 1K9MR 1UGQB 4M78B 3EG9B 1AOJA 5HK0A 2X3XD 1OV3A 1W2BA 2F2VA 4QVZA 3I55Q 5C6SA 4LDXA 3OYBA 2JMAA 1I0CA 4C8QF 1G83A 1UGPB 1VQPA 1X27A 3UATA 5LJ5e 3CCRT 1YI2Q 2DZ9A 3HRUA 1WPYA 1QCNA 3GP8A 2GQVA 2CKKA 2MF2A 1KD1U 1FWZA 2OTJA 4PLIA 4IUQA 5GAMh 3CC2A 4M77E 3M53A 4JRPA 4QW2A 3CXCS 3X28B 2PU9B 1G3WA 4OMPA 4HCZA 1KQ2A 2LX7A 3RKXA 1GBQA 5IT9E 1SEMA 3JV3A 3JB9D 4VUBA 5GAOr 4JS4A 4QKUA 3M0TA 3CCUT 5KE2A 2HDAA 2DK3A 2K5FA 4CI0C 3X26B 1BCMA 1VQPT 1WHLA 4EMKB 3PFSA 3VS7A 1M5Q1 1RABB 4WCIA 3H0IA 4FSSA 4WF2A 2PUKB 3CEYA 1JJ2A 4DBHA 1R77A 1WI7A 4LDVA 5DM7R 1M1KC 2LT4A 1F1BB 3OW2S 4C8QG 3OW2P 4F14A 2ZGWA 5J3BA 3L2ZA 1PNJA 2DBKA 1BYMA 3FJPA 2YUQA 4IIMA 2ROTA 3P8HA 1YBYA 4EMKA 2O88A 4J9HA 1N27A 1ZBJA 3L2VA 4A4KA 1M1FA 3EG1A 4LDUA 5FLXE 3EG0A 4E7ZA 1WXTA 1QQJA 4OB3B 1JXOA 3V8KA 4N4IA 4Z02A 3THKA 2KDSA 2YSQA 1NEBA 4Z8AA 4XTYA 5HCKA 2X4WA 4D8DA 1H92A 5FU7B 3TQ7P 2FYKA 4O5VA 1JXMA 1SKUB 4F7UE 4BUGA 1VQ4A 2KVQG 3E9GA 4LXCA 4R55A 4C0FA 4M7DF 3X24B 1IZ6A 2JM9A 2RQUA 4BE0A 2FO0A 4BY6B 3Q1JA 2B86A 1K0SA 3LH0A 2KT1A 1X43A 2NUZA 2QQSA 1N9RA 2LMJA 5FRNA 3I5RA 2G6FX 1AWJA 2FPDA 3WXMB 2HQXA 3QWXX 1RADB 2QYZA 1AWXA 1G8XA 4AT1B 1YJWQ 2VKNA 1MMNA 3CCQT 3M54A 4J9CA 3NTIA 2AT1B 2LTOA 3OYJA 3CBPA 1D09B 1MNEA 2RQTA 3VS2A 3LX7A 3CC2Q 1UJ0A 3GBQA 4M7AG 1VIFA 1VYVA 2RH2A 1VQKT 2MYSA 3TU4K 4M75A 2CYZB 2LNVA 1PKTA 3CC4Q 2E6NA 2EQIA 2BUDA 2YUOA 2QQBA 1BI1A 1Q82R 1EZZB 2LNHB 3MEAA 4GBQA 5KYXA 4C92A 3MJXA 1VQ8T 3VKIA 4BACA 2K6DA 4ESRA 3CCQA 1PRMC 1OX9A 3URGA 2DM1A 4FM4B 3M4YA 4ZGEB 4RMOA 2CP7A 3LW5E 2DYIA 2QI2A 1W70A 3OB9A 1I5LA 1ABQA 2K7AA 1SSFA 2DFUA 2KXDA 3L42A 1K8AR 3I55T 1KJWA 1VQMQ 1HXDA 3QHSA 4JUVA 4K11A 4C92B 2KY9A 2GFAA 3REBB 4M4ZA 1WHJA 2E12A 3JRZA 5KYUA 4LD9K 5AYFA 1QVGA 2MWOA 2MIOA 2HBPA 3FRNA 1LPLA 1SHGA 3I56Q 1JB0E 4OMQA 2RQVA 3FIFA 2BIVA 1JU5C 2X51A 1LJOA 4AFZC 1G3TA 1X69A 2AZVA 5GAN2 2BZXA 3ULRB 1VOMA 2RJFA 4KGZB 3ZL7C 3E1SA 4C5IA 1WGSA 3LWIA 4C8QE 1UHCA 1FX7A 4XTZA 2YUNA 4E7LA 5FROA 2Y4XA 1Q86R 5I2SA 3V8JA 1UHFA 3G71T 2XICA 1UEBA 2VXFA 5KYYA 4E6RA 5GAOq 1Y71A 1SSHA 1RUWA 4RCBA 1X01A 2HSPA 5IH2A 2VGNA 2F5KA 4FL6A 1NYFA 1PD0A 2KQWA 1QLYA 2ABLA 2RF0A 3VRYA 5GANj 2RNAA 2D6FA 3QBYA 1YWOA 5GANg 5D6XA 2FPFA 2O01E 1VQOT 3N5BB 1TU0B 2PZ1A 1Z9ZA 5GMKe 2FPEA 2QXFA 3CMET 2ENMA 2OAUA 1D1CA 4BI4A 2ZCFB 4ORZA 4C5EA 1WLPB 4RTXA 1B34A 1N8RR 3GLXA 5GAOl 4HVUA 2EJ9A 4XTWA 5D7UA 1I4K1 4XU0A 4QQDA 5GAOm 3M0PA 3RMQA 5FRMA 1Q81R 1VQ8Q 5L23A 1WZOA 2YRVA 2DD4A 4A4EA 4EMGA 2AK5A 2AZSA 4M7DC 1KIKA 3C4SA 1OU9A 1WYXA 3DLMA 3M57A 4L6V5 3PNWC 2K2VA 1UDLA 1VQNT 2RHYA 2M51A 4PJOG 2BKDN 4ANJA 2RJEA 1RAAB 2DNUA 2ZPIB 3BY7A 2KMTA 1N8RC 1Y7XA 1QP2A 4OGCA 1K1ZA 2A3LA 4M7DG 1FMKA 2M0YA 3ZEHA 5GAMj 3CPFA 2DL3A 5J26A 5LJ5g 3V7SA 4FYWB 1H3HA 2P0QA 1IHVA 4DOWA 2H3EB 4RG2A 3KFVA 4M7DB 2XI9A 5KYXB 5LJ5h 1RI9A 4M75C 2DF6A 2EYQA 2X35A 4PJLA 2GF7A 1YJNT 1O75A 1VQNA 4ZGJB 2F2XA 2D0QB 3CCQQ 4PLLA 2R58A 1M4ZA 3PMTA 4II1A 2RHXA 3A8GB 7AT1B 2CZ7B 3QO3A 3GOXA 5GAMe 2CDTA 3MP1A 2IIMA 2DEUA 1RAHB 1RLQC 1U06A 4F7UF 1W2BS 4M7DA 2NLUA 4M7AB 3RIRA 5GMKj 1Q86C 2XDBA 3JB9G 1WQWA 1PWTA 1VQ5A 4BI3A 1PG5B 5KYUB 5GAN3 1VQ7Q
chains in the Genus database with same CATH topology
5DLQE 1ZHIA 1XTDA 5C6SA 3CCVT 4LDXA 3OSVA 3OYBA 2QA4A 2XDDA 5CAIA 2VV5A 2DXUA 3HHTB 3SWNB 1VQOA 2P0PA 2F5TX 4C8QF 3LGFA 1U8RA 1UGPB 2KAFA 2WACA 5LJ5j 1VQPA 4MMKA 3CCJA 1RL2A 5LJ5e 3G4ST 5LJ3d 1MHNA 1VUBA 3A8MB 3VV0A 3CCRT 4A4GA 2DZ9A 3HRUA 1WPYA 3GP8A 2GQVA 2CKKA 3J81E 3CCLT 2MF2A 2P0KA 4HCBA 4QVDA 4RCCA 1KD1U 2C06A 1FWZA 2RJDA 2OTJA 4PLIA 2P4TA 2KSSA 1OZ2A 3QSUA 2PVGB 3CC7T 4IUQA 5GAMh 1XQHA 2M9UA 3M59A 4M77E 3GPLA 3A8LB 2XU8A 3CMEA 1G5VA 3M53A 5GANf 4JRPA 4M77A 4J6XA 4C0GA 4QW2A 4C0DB 5A2QE 3UT1A 4A53A 3CXCS 2RA2A 3X28B 2XIDA 2PU9B 1QVGS 1G3WA 3QYHB 4Y91A 4C92E 1VQLA 3GNGA 4HCZA 5GAMf 4HCCA 1AHJB 2EQUA 3MP6A 3TCJA 1KQ2A 3RKXA 2XHCA 4OB2B 4NS5A 3V7CA 3WVDB 3JCMQ 5IT9E 3FLGA 4GY5A 4OP0A 3JB9D 4VUBA 5EG2A 5GAOr 3G6ET 4X9CA 3OYAA 4JS4A 1G3YA 5L8RE 3CCUT 5KE2A 1V29B 2DK3A 2LVMA 2K5FA 3C94A 4BD3A 3S6WA 2GCXA 3X26B 4CI0C 5GAOn 3SDZA 2VXEA 2QQ9A 1Q7YC 3CCSA 5A0DA 2LC4A 2MI6A 3MEUA 1VQPT 2DIQA 4EMKB 2RHIA 3HRTA 3PFSA 3JB9I 3H6ZA 3CCJT 1YJWT 3A5ZB 1M5Q1 5GAN6 3V8LA 3X20B 1VQ8A 4WF2A 1JJ2A 3JCMc 2PUKB 3CEYA 1S72A 2JZ2A 4KT0E 4Y28E 5FU7C 5GMKm 4IUVA 4LDVA 2X4YA 1M90C 5DM7R 3MEWA 5GAOp 3OS1A 1Q81U 3HP9A 2OTLA 1M1KC 2LT4A 5CKFA 3OW2S 1RI0A 1UB4A 4PKCC 4C8QG 5KH6A 2IG0A 3ZBDA 4FIBA 4IUPA 5D6YA 1YJ9A 2VYTA 2ZGWA 1ZQ1A 3M4GA 5J3BA 3L2ZA 4F7UB 2B8AA 2JN0A 2K57A 3HPWA 3FJPA 4NL3A 4C8QB 1BYMA 3I55A 3LWHA 1FXXA 2PVOB 3RESA 2MAMA 1YBYA 3P8HA 3C12A 4IUUA 1N27A 4OF1A 4EMKA 4PJOC 3L2VA 3O8VA 4M77C 4A4KA 1M1FA 3QUIA 2EFIA 1B34B 4LDUA 3RKWA 5FLXE 3G6EA 4M7DD 4XQ3A 3P8DA 2DTIA 4Q5WA 1X6OA 2K5IA 4HT9A 1MGQA 4M78G 4OB3B 3ME9A 3CMAT 3PGGA 4L5GA 3V8KA 2LX9A 4XTUA 3MEVA 4M77G 4N4IA 4Z02A 3GF5A 4J7FA 2E41A 5FU6C 2KDSA 2RI5A 1YHQT 4XTYA 3RKYA 2PQWA 4J8OA 5CKHA 3OMGA 2LDMA 5LJ3f 4MDXA 4O6JA 1NPPA 4J6YA 2X4WA 4KULA 5GMKi 5GAN4 3OYCA 2QTXA 3OYGA 1VQ6T 1WJQA 4N0AC 5KCHA 2VGMA 4M78D 1Y96A 5FU7B 1YIJT 2CS7A 3QXEB 4C5GA 4JJNK 3JCMg 1JJ2S 1OI1A 2FYKA 3OSSC 4EPCA 4O5VA 3JCMX 2WSCE 2PUOB 2DKGA 2XG8D 2RHUA 4E7KA 2DAQA 2GFUA 3HFNA 3M9QA 4M75G 4F7UE 2O4XB 4BUGA 3BW1A 2L8DA 2LRQA 1VQ4A 2F69A 2EJFA 2KVQG 3OS0A 3CCMT 3VYHB 2DIGA 3E9GA 3QPHA 1KC8U 3L2WA 3JCMW 4R55A 1BKBA 2JTMA 4C0FA 3CCVA 4M7DF 2KK4A 3DB3A 3UDCA 4PJOE 3X24B 1IZ6A 1UGSB 3R6OA 4ZGDB 1BIBA 3CD6A 5KCOA 4BE0A 2D9TA 1PSFA 2V8KA 4OVAA 2E6ZA 4RG8A 5D6WA 4BY6B 3Q1JA 4J5YA 2EQJA 4M75D 5CCAA 4TVRA 1Y96B 3HKSA 3QZ9B 3LH0A 1PSEA 3OA6A 2MWPA 5GMKl 3G71A 2QQSA 1N9RA 5FRNA 3EAEA 1M8VA 2ZZDA 2QQRA 4X34A 3RUXA 3ZFJA 2K3YA 3CPWA 4MZMA 4ZTJA 2EQMA 3JAME 4OB1B 3WXMB 1WJSA 2HQXA 1VQMT 2RI2A 3JSCA 3T9NA 1VQ6A 2RO0A 3UWNA 4KUDK 4C8QD 4D6WA 5CKBA 2EAYA 3I56A 2L3RA 5GANd 2JUFA 3BDLA 3G4SA 3TEEA 4FU6A 3KXTA 3CCQT 4XTXA 2ZPGB 3HRSA 3M54A 2LT1A 5CIUA 4EMHA 3VUBA 3A8OB 3NTIA 4M78E 3NFCA 5LJ3g 4NL2A 2EKOA 2LTOA 3OYJA 3CBPA 2EJGA 4MZPA 4OGEA 3OYHA 4XK8E 3CC7A 2IVWA 5HK3A 2DVEA 2XDPA 3LX7A 4JLGA 5FU6B 2DPPB 2RHZA 1XNIA 4M7AA 3OQ5A 4C92C 4MMLA 3M55A 2ZPEB 4M7AG 4M77D 1VQLT 4M78F 1VIFA 2DXCA 5CKEA 5CK9A 2K5LA 2FVUA 2R57A 2RH2A 3P8BB 1VQKT 3ER0A 1LNXA 2G3RA 2H3JA 4M78C 3TU4K 1KHCA 2X4JA 2CYZB 3CBOA 3QG1A 4FSXA 4M75A 1YITT 1D3BA 2LNVA 1Q81C 3NTHA 3OY9A 4M7AC 2E6NA 4M75E 2QQAA 2BUDA 2DD5A 4CRIA 3UPUA 4M7AD 3OYLA 1VQ7T 4JRKA 1W4SA 1WJRA 2QQBA 5I2MA 1BI1A 1QVFA 1YJWA 2E10A 3OBYA 4N4HA 1K73C 3MEAA 5GAN7 1YJ9T 1QW1A 4C92A 1VQ5T 5J39A 1VQ8T 3VKIA 4BACA 3JB9H 2L5QA 2CGHA 3CCQA 5A0GA 4ATOA 3URGA 3CCEA 4FM4B 2AHJB 2YLBA 3M4YA 4ZGEB 2X4XA 3SB2A 5M9OA 3JCMb 4RMOA 4IKFA 2OTLT 2M0OA 5A0LA 4JDSA 4M75B 3L2QA 3LW5E 1D3BB 2QI2A 3KUFA 3JCMe 4J83A 3OB9A 5KE3A 1I5LA 3CC4A 2RK1A 5IAYA 1KQ1A 2CZ1B 4E7JA 3JCMJ 2XD0A 1SSFA 1IREB 4E7HA 4M77B 3QYGB 3MHXA 3EFRA 4MDWA 3DLLA 2DEQA 2K4YA 1BI3A 3L42A 3META 3I55T 1N6AA 1NJIU 1H641 3QJ6A 1HXDA 1XOVA 2XKOC 5LJ3e 2WSEE 4PNOA 5LJ5f 2Y4YA 3QHSA 2QA4T 4C8QC 3CC2A 5LJ3j 2HQEA 2JOYA 4IURA 4JUVA 4C92B 5GAMd 2KY9A 3J80E 5CO7A 3OYNA 2GFAA 1Q7YU 4PL6A 3INZA 4ME7A 3M58A 5IN1A 4JRQA 2FHDA 2E65A 3JB9J 4L59A 3OYEA 1I81A 3ASKA 2E12A 1VIEA 3JRZA 3S3MA 3SD4A 4LD9K 4BE1A 5AYFA 1YHQA 5LL6S 1QVGA 3E19A 1KQSS 2MWOA 4XTVA 4XU1A 4M7AE 2HBPA 2LCLA 4QVCA 4BDYA 3FRNA 1YI2T 1KG1A 1JB0E 1OZ3A 2M16A 4C92D 2DXBA 3L1AA 3FIFA 4MZTA 4EMKC 5CQXA 2RD1A 3OYYA 3RMSA 2VC8A 3OYDA 3TREA 2BIVA 4DA4A 3CD6T 1K73U 3A8HB 3VJPA 1LJOA 1QP3A 1ZBXA 2A7YA 1KC8C 1G3TA 3FEOA 5GAN2 4XU3A 3CC4T 2Y90A 4ELZC 1OYXA 2RJFA 2ZPHB 3FC3A 3E1SA 4C5IA 3M5AA 4XU2A 4C92G 4C8QA 4JS5A 1S72T 1WGSA 3PIOA 1LOJA 1NZ9A 4BY6C 3JCMP 3LWIA 1VQ9A 3CCUA 4V2SA 1G3SA 4UC4A 4C8QE 1YJNA 1WQ7A 5C0MA 1FX7A 4XTZA 4E7LA 1VQMA 3MO8A 4BE2A 5FROA 2Y4XA 3LYIA 3OS5A 3I56T 5I2SA 3C95A 3V8JA 3CXCA 3AHUA 4HA8A 1Q82C 4NOYA 3G71T 2XICA 3S3OA 1R8OB 1UEBA 2VXFA 4A4HA 2FL7A 3F70A 5GAOq 1Y71A 3MCAB 5HKCA 2RK2A 2XK0A 2V8JA 3QIIA 4RCBA 3FB9A 4M7AF 1X01A 4PJOA 5GAN8 2VGNA 3VUZA 3H8ZA 2F5KA 4FL6A 4LDYA 1DJ7B 1YI2A 3VU3C 5GAN5 5CR2A 1Q86U 3NTKA 4LDWA 4B9WA 5DLOA 4A4FA 2KQWA 5GANj 2D6FA 2M1HA 3CBMA 3QBYA 4PJOF 5GANg 3OYIA 1KD1C 3CCLA 4E7IA 4M7DE 3DB4A 1K8AC 4RKUE 2E64A 5D6XA 1VQKA 4GLKA 2HAXA 4BDZA 2O01E 5LJ3h 1VQOT 3HFOA 4JLIA 3N5BB 5GAMg 4FT4A 4XAXB 2JNGA 3PTAA 5GMKe 3OBWA 3CC2T 1VQ9T 2QXFA 4KBMB 3CMET 1Y07A 4HKEA 3HL8A 4X9DA 1YIJA 2OAUA 5HY6A 3SFMA 4F7UA 1GXIE 4BI4A 4PJOB 1O9SA 4F7UG 3PIPA 2ZCFB 1M1GA 5CVIA 3L2RA 1M1KU 4ZTFA 2HD0A 3JCMV 3OYMA 4C5EA 1M9SA 4OB0B 1M90U 2OTJT 1KQSA 3KBGA 5I21A 2LQ8A 1X75C 3HSBA 3X25B 1K9MC 1B34A 1WNLA 2RM4A 3GLXA 3M56A 3OYFA 3QJYA 2E1HA 5GAOl 4A54A 5GMKh 2EJ9A 4XTWA 1I4K1 4E47A 3DKMA 4XU0A 4QQDA 1JBMA 5GAOm 2EIFA 1N9SA 3MP8A 3G7ZA 3RMQA 1KHIA 3LLRA 5FRMA 2QEXA 2JTFA 4PJOD 2LQKA 4HT8A 3PMIA 3LGLA 2YRVA 2R5AA 2DD4A 2RJCA 4A4EA 4EMGA 4C5HA 5CKDA 2EWNA 4M7DC 1P92A 4J6WA 4J7IA 3C4SA 2DO3A 1N8RU 1EIFA 1JRIA 2DXTA 2ZPBB 3DLMA 3M57A 3PNWC 4L6V5 1K8AU 2K2VA 1VQNT 2DZCA 2RHYA 3JB9F 3EFSA 4JRIA 1YCYA 3CCST 2RB6A 4PJOG 4ZN1A 2BKDN 4YTLA 4C0ZA 2RJEA 2O4XA 2ZPIB 3BDUA 2KMTA 3BY7A 1Y7XA 1QP2A 4BI8B 1N8RC 2MMPA 4OGCA 2I2LA 4C0DC 5GAN3 2DTHA 3BFMA 3OW2A 2A3LA 2L89A 4BB7A 4M7DG 3ZEHA 5GAMj 4QQ6A 1Q82U 1BI0A 3CPFA 5CQYA 4ELYC 3L2UA 2E5QA 2HNIA 3GNFB 2YHTA 3WVEB 1TH7A 2VUBA 3QZ5B 1BIAA 5J26A 2CZ6B 3CMAA 2FB7A 4DOVA 5DY9A 2YLCA 2LCCA 3V7SA 5LJ5g 2P0QA 4DOWA 5GANh 4IUTA 3JCMf 2QEXT 4KUIA 4RG2A 1QVPA 4M75F 1U1TA 2XI9A 3V7RA 4M7DB 3QKJA 5LJ5h 2JVVA 4N4GA 1YITA 2V8IA 4M75C 2EYQA 2X35A 4M78A 2QDYB 1NE8A 3OYKA 3S3NA 1NJIC 1K9MU 3JCMh 3QDRB 4C92F 2ZPFB 2GF7A 1YJNT 3SWNC 1O75A 2R5MA 3CCRA 1VQNA 1QVFS 4ZGJB 3PT9A 3OMCA 2D0QB 4R56A 1VQ7A 4PLLA 4ZN3A 2R58A 1M4ZA 3E9FA 1NPRA 4M77F 2CZ0B 2E70A 3PMTA 2RHXA 4II1A 4N0AA 5GANe 3A8GB 1UGRB 2RI3A 2CZ7B 3QO3A 4LD6A 3SWNA 1VQ4T 2WSFE 3CCMA 3FDRA 3GOXA 3CCET 5GAMe 2DTOA 3MP1A 3RERA 4B9XA 4EDUA 1W2BS 4M7DA 4F7UF 1UGQB 2NLUA 4M7AB 3RIRA 3GIBA 5GMKj 1Q86C 3VYGA 4DQ2A 3OS2A 4FT2A 2XDBA 4M78B 1H3ZA 4P5NA 2K3XA 3JB9G 1WQWA 4OMFB 3JCMd 5HK0A 1VQ5A 1I8FA 4BI3A 1HK9A 1W2BA 1U1SA 1BI2A 3CPWS 4QQGA 2PVDB 3J7AF 4QVZA 2DJZA 5LJ5d 2EQKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CZ0 B;  3A8L B;  3WVE B;  2CZ1 B;  2ZPB B;  4L6V 5;  2DD5 A;  3QZ9 B;  4OB0 B;  3A8G B;  1PSE A;  3QZ5 B;  1IRE B;  1UGR B;  3QXE B;  3A8O B;  3QYG B;  2CZ7 B;  2CZ6 B;  3HHT B;  3X20 B;  4XK8 E;  2PUK B;  3X25 B;  2WSF E;  1JB0 E;  1UGP B;  2WSC E;  2PUO B;  2DXB A;  2PU9 B;  3QYH B;  4KT0 E;  2ZZD A;  2WSE E;  4Y28 E;  4RKU E;  1AHJ B;  2DPP B;  1UGQ B;  4OB1 B;  4OB3 B;  3A8M B;  4OB2 B;  2ZPI B;  2O01 E;  3WVD B;  1QP2 A;  2ZPE B;  3A8H B;  3VYG A;  3VYH B;  1QP3 A;  2QDY B;  4FM4 B;  2DXC A;  2AHJ B;  5L8R E;  2ZPF B;  4ZGE B;  1V29 B;  2ZPH B;  3X24 B;  1UGS B;  4ZGD B;  4ZGJ B;  1GXI E;  2CYZ B;  1PSF A;  2DD4 A;  3X26 B;  3LW5 E;  2ZPG B;  2D0Q B;  2PVD B;  2PVG B;  2ZCF B;  1DJ7 B;  3X28 B;  2PVO B; 
#chains in the Genus database with same CATH topology
 1XTD A;  3E2U A;  3CCV T;  3OSV A;  2XDD A;  1ZUU A;  2ATC B;  2DXU A;  2P0P A;  1D0Z A;  1KD1 R;  3CCE Q;  2YRC A;  3G4S T;  1VUB A;  3A8M B;  3VV0 A;  2KRM A;  4A4G A;  3CCL T;  2P0K A;  1WHG A;  4HCB A;  4QVD A;  4RCC A;  1S1N A;  2RJD A;  1R0B G;  2HMA A;  1K73 R;  1M2O A;  3NMZ C;  2NUP B;  3CC7 T;  1GCQ A;  3M59 A;  1BU1 A;  4C0D B;  3UT1 A;  3QYH B;  5GAM f;  2E5K A;  3MP6 A;  3H41 A;  3TCJ A;  4NS5 A;  2DMO A;  3EG2 A;  4OP0 A;  4X9C A;  3MKD A;  1G3Y A;  3PVL A;  2LVM A;  3C94 A;  1Q7Y C;  5A0D A;  4JJD A;  1VQ4 Q;  2LC4 A;  1IHW A;  2E4H A;  2EBP A;  2DIQ A;  2DLP A;  1YJW T;  4RTV A;  3H6Z A;  2K9G A;  4J9D A;  3V8L A;  1NM7 A;  3JCM c;  2O2O A;  2X4Y A;  3OS1 A;  4CC2 A;  1OUL A;  3EHQ A;  2IG0 A;  3CC7 Q;  4FIB A;  5D6Y A;  1ZQ1 A;  3M4G A;  1U5S A;  2A0F B;  4F7U B;  2B8A A;  3HPW A;  1AD5 A;  3TSW A;  1FXX A;  2HEQ A;  2PVO B;  3RES A;  2MAM A;  2OX7 A;  2QTV A;  3C12 A;  4IUU A;  1WDX A;  3RBB B;  1NLO C;  3QUI A;  2RQW A;  4M7D D;  2DTI A;  4Q5W A;  2K5I A;  4HT9 A;  1MGQ A;  3PGG A;  4L5G A;  2LCS A;  3GF5 A;  3CCM Q;  2E41 A;  2RI5 A;  1YHQ T;  3RKY A;  2D8H A;  3OMG A;  1W6X A;  1NPP A;  1VQ6 T;  3OYC A;  4J9F A;  4AMC A;  5KCH A;  4M78 D;  1Y96 A;  3EG3 A;  4C5G A;  1OI1 A;  3OSS C;  4LN2 A;  3JCM X;  2PUO B;  2DKG A;  2XG8 D;  2RHU A;  3EFO A;  3M9Q A;  2L8D A;  3OS0 A;  3VYH B;  2DIG A;  1QWF A;  5FW9 A;  2ECZ A;  4PJO E;  3DB3 A;  3R6O A;  4ZGD B;  1BIB A;  1PSF A;  1X2Q A;  2V8K A;  2E6Z A;  4CC4 B;  1IB8 A;  4J5Y A;  2EQJ A;  4M75 D;  1Y96 B;  3HKS A;  2MWP A;  2GBQ A;  2DRM A;  3RUX A;  4J9E A;  3JAM E;  4OB1 B;  1QKW A;  2RI2 A;  3T9N A;  2JS0 A;  1VQ6 A;  2RO0 A;  1YIJ Q;  4AFQ C;  2L3R A;  3A1P A;  4FU6 A;  2CUB A;  3HRS A;  2JTE A;  4EMH A;  1ZA1 B;  1MUZ A;  2J6O A;  4NL2 A;  2EKO A;  1AT1 B;  3H0H A;  1ARK A;  4OGE A;  3OYH A;  5FU6 B;  2DPP B;  4M7A A;  1HJD A;  2ZPE B;  3M0U A;  2ZAE A;  4M77 D;  4M78 F;  2DXC A;  2K5L A;  2OI3 A;  1LNX A;  2H3J A;  1KHC A;  2X4J A;  4PFZ A;  1YIT T;  2LZ6 B;  1D3B A;  1HD3 A;  2CH4 W;  3I5S A;  1Q81 C;  3NTH A;  4M7A C;  3CCS Q;  4M75 E;  1GCQ C;  2AKL A;  1C6V X;  2CUD A;  2KRS A;  1W4S A;  2DL8 A;  2EYX A;  5I2M A;  1QVF A;  1C1A A;  1YJ9 T;  2CP2 A;  1QW1 A;  1IGU A;  1SF9 A;  4LUD A;  1VQ5 T;  2FRY A;  2L5Q A;  2J6F A;  1E7O A;  1WIE A;  2O31 A;  1M30 A;  3SB2 A;  2NUT A;  2LJ3 A;  3L2Q A;  1HSQ A;  1D3B B;  3JCM e;  2KRO A;  4PFO A;  4J83 A;  1Y57 A;  5IAY A;  1CKA A;  3JCM J;  3G6E Q;  4M77 B;  3MHX A;  4MDW A;  3DLL A;  2YUP A;  1PD1 A;  1D1B A;  2DEQ A;  1N6A A;  1H64 1;  3TVT A;  1TOV A;  2QA4 T;  3J80 E;  5CO7 A;  4DBR A;  4PL6 A;  3INZ A;  1CKB A;  2X9H A;  3VS4 A;  3O5Z A;  5IN1 A;  4JRQ A;  2FHD A;  5IHK A;  2BTT A;  1ZA2 B;  1K9A A;  2JXB A;  3SD4 A;  5LL6 S;  3E19 A;  1KQS S;  4XTV A;  3EGD A;  1TUG B;  4XU1 A;  2LJ1 A;  1S72 Q;  2LCL A;  1JO8 A;  4BDY A;  1M90 R;  1KG1 A;  2M16 A;  4EMK C;  2DXB A;  3L1A A;  4MZT A;  3EHR A;  3OYY A;  3EGX A;  2VC8 A;  3OYD A;  3CD6 T;  1K73 U;  1GBR A;  1QMC A;  1QP3 A;  1ZBX A;  2FZG B;  1VQP Q;  4XU3 A;  1OYX A;  2ZPH B;  3FC3 A;  3M5A A;  4XU2 A;  4C92 G;  4C8Q A;  4JS5 A;  4BY6 C;  1NZ9 A;  4V2S A;  3EGD B;  3AT1 B;  1ZUK A;  1VQM A;  3LYI A;  3I56 T;  4CC3 A;  3EH1 A;  3AHU A;  4NOY A;  4A63 B;  1OPK A;  4A4H A;  3F70 A;  3QII A;  4Z89 A;  3VU3 C;  5CR2 A;  3M0Q A;  1TUD A;  3UA6 A;  4JPB W;  2HSE B;  4AFU C;  3QDF A;  4M7D E;  3OYI A;  3DB4 A;  1K8A C;  1AZG B;  2HAX A;  2YT6 A;  4JLI A;  1YFN A;  3PTA A;  1YCS B;  3HL8 A;  4X9D A;  5HY6 A;  6AT1 B;  2GTJ A;  1GXI E;  1U3O A;  1O9S A;  4F7U G;  3L2R A;  2KE9 A;  4ZTF A;  3OYM A;  4OB0 B;  1M90 U;  2OTJ T;  2VVK A;  3KBG A;  3MPU B;  1X75 C;  2OJ2 A;  5GJV B;  2YRD A;  1D1A A;  3CCU Q;  4DBF A;  3VRZ A;  2EIF A;  8AT1 B;  1KHI A;  1G2B A;  3LLR A;  1CSK A;  2LQK A;  1X6G A;  2F1L A;  2RJC A;  4C5H A;  5CKD A;  1P92 A;  2KRN A;  2DO3 A;  1N8R U;  1MMG A;  1JRI A;  2DXT A;  2ZPB B;  4ZN1 A;  1V1C A;  4YTL A;  2EYW A;  2V26 A;  4BI8 B;  1ZX6 A;  1R0C B;  2D1X A;  3CCR Q;  2VWF A;  4C0D C;  2DTH A;  1PRL C;  4QQ6 A;  3L2U A;  4ELY C;  3WVE B;  3QZ5 B;  1BIA A;  2CZ6 B;  4F16 A;  3CMA A;  4DOV A;  5DY9 A;  2YLC A;  4F04 B;  3JCM f;  4RTW A;  2FZC B;  1YIT A;  1H8K A;  4RTZ A;  4M78 A;  2QDY B;  4C92 F;  3PT9 A;  3OMC A;  2CRE A;  4R56 A;  4ZN3 A;  8ATC B;  2CZ0 B;  4N0A A;  2QK0 A;  2EGE A;  1UGR B;  2COY A;  2RI3 A;  2A08 A;  3RR6 A;  4LD6 A;  2H8H A;  1ZUY A;  2RN8 A;  2WSF E;  3CCM A;  3FDR A;  3CCV Q;  2EGA A;  3BE3 A;  3RER A;  1ZSG A;  2SEM A;  3GIB A;  3VYG A;  4DQ2 A;  1B7T A;  1RAG B;  2K3X A;  4R0K A;  4OMF B;  3JCM d;  2EGC A;  2KBT A;  1I8F A;  2QGF B;  2C0I A;  1BI2 A;  2PVD B;  3J7A F;  2DJZ A;  4JLG A;  3CXC A;  5DLQ E;  1ZHI A;  2QA4 A;  5CAI A;  3VS0 A;  1VQL Q;  2VV5 A;  1KC8 R;  1I1J A;  2FG0 A;  1U8R A;  2F5T X;  2WAC A;  5LJ5 j;  2COW A;  4MMK A;  2ROL A;  1YIT Q;  3CCJ A;  1QKX A;  5LJ3 d;  4FW1 A;  4PK4 A;  1SG5 A;  3J81 E;  3EG9 A;  3CMA Q;  2C06 A;  2P4T A;  1OZ2 A;  3QSU A;  1K4U S;  1K73 C;  1XQH A;  2M9U A;  3CCJ Q;  3A8L B;  2XU8 A;  2HZY A;  3CME A;  1G5V A;  1W2B P;  5GAN f;  1KC8 U;  5A2Q E;  4A53 A;  1QVG S;  1VQL A;  2XID A;  4C92 E;  4Y91 A;  1AHJ B;  2DRK A;  2XHC A;  3V7C A;  3WVD B;  3JCM Q;  1MV0 B;  2GGR A;  3FLG A;  3G6E T;  3OYA A;  1NEG A;  1V29 B;  4KH0 B;  3S6W A;  2V1Q A;  2VXE A;  2QQ9 A;  3CCS A;  2ESW A;  3MEU A;  1RAC B;  3UF4 A;  3HRT A;  3CCJ T;  5GAN 6;  1S72 A;  2JZ2 A;  5GJW B;  4Y28 E;  1M90 C;  5GAO p;  1Q81 U;  2EYY A;  2OTL A;  2GNC A;  5CKF A;  1M3C A;  1OOT A;  1RI0 A;  1UB4 A;  3NGP A;  2VYT A;  4EIK A;  4KGX B;  2JN0 A;  2K57 A;  2DA9 A;  4NL3 A;  3LWH A;  4AG2 C;  1BB9 A;  2DL5 A;  4OF1 A;  1GCP A;  1W1F A;  3O8V A;  5FWC A;  1UGV A;  2EFI A;  3RKW A;  3G6E A;  4XQ3 A;  3P8D A;  2JM8 A;  2CP0 A;  1VQ9 Q;  2J6K A;  1X6O A;  3ME9 A;  1ACM B;  3MEV A;  4M77 G;  5KYY B;  2JW4 A;  4J7F A;  1QVF P;  3NHN A;  5FU6 C;  4J8O A;  1X2K A;  4O6J A;  4J6Y A;  1WJQ A;  1YIJ T;  2FZK B;  1M8M A;  3QWY A;  2WSC E;  2DL4 A;  2GFU A;  2LRQ A;  2F69 A;  2EJF A;  3QPH A;  3L2W A;  3JCM W;  3M0S A;  1BKB A;  1KQS P;  2HKN A;  4E2F B;  5D6W A;  5CCA A;  4TVR A;  1NYG A;  3QZ9 B;  3OA6 A;  2K2M A;  3PE0 A;  5GMK l;  2J7I A;  2HKQ B;  1UEC A;  2MK5 A;  2ZZD A;  2PTK A;  4X34 A;  3ZFJ A;  2K3Y A;  3CPW A;  4MZM A;  2EQM A;  3HTR A;  1IXD A;  2KYM A;  3JSC A;  1BK2 A;  4ZNX A;  4KUD K;  4D6W A;  5CKB A;  1K0X A;  1V76 A;  2JUF A;  1RAF B;  3G4S A;  1VYU A;  4XTX A;  2LT1 A;  4KH1 B;  4M78 E;  4OML A;  3NFC A;  4MZP A;  1TWB A;  3CC7 A;  1VQO Q;  5HK3 A;  2DVE A;  2XDP A;  2RHZ A;  2HBW A;  1XNI A;  2V1R A;  4C92 C;  2KXC A;  2MCN A;  5CKE A;  5CK9 A;  1ZSZ A;  2HCK A;  2R57 A;  4M78 C;  3QG1 A;  4RTU A;  2W10 A;  2QQA A;  4CRI A;  1EX4 A;  4M7A D;  1VQ7 T;  2L3Q A;  4JRK A;  4AG1 C;  1YJW A;  4N4H A;  2A28 A;  3JB9 H;  2YWW A;  1QWE A;  4ATO A;  2YLB A;  5M9O A;  3JCM b;  1UG1 A;  2BZ8 A;  2KYB A;  4M75 B;  2KT8 A;  2O9V A;  5A0L A;  2QAS A;  3KUF A;  2X3W D;  4RUG A;  2RK1 A;  1KQ1 A;  2CZ1 B;  2O9S A;  2XD0 A;  1IRE B;  4E7H A;  2NYS A;  3QYG B;  1SPK A;  2RMO A;  3EFR A;  1AWO A;  1NJI U;  1GRI A;  3MET A;  3QJ6 A;  5LJ3 e;  2KR3 A;  4PNO A;  5I11 A;  2Y4Y A;  4C8Q C;  2JT4 A;  2HQE A;  5GAM d;  1Z9Q A;  1Q7Y U;  5KYN A;  2E65 A;  2QGG A;  4FW2 A;  4L59 A;  3OYE A;  3ASK A;  3S3M A;  1VIE A;  4BE1 A;  1YHQ A;  3D7S B;  1VQ5 Q;  4QVC A;  1OZ3 A;  5CQX A;  1IRX A;  1IGQ A;  3TRE A;  1UUE A;  4DA4 A;  3A8H B;  1Q7Y R;  3FEO A;  1WXU A;  2Y90 A;  4ELZ C;  4AFS C;  2F2W A;  1TSF A;  1S72 T;  1OU8 A;  3PIO A;  1VQ9 A;  1G3S A;  4UC4 A;  1YJN A;  5C0M A;  1WXB A;  2FEI A;  3MO8 A;  4BE2 A;  1WHH A;  1AEY A;  1WHK A;  2EYZ A;  4HA8 A;  1Q82 C;  3S3O A;  1KFZ A;  2FL7 A;  2CT4 A;  3MCA B;  5HKC A;  2CP3 A;  2XK0 A;  4M7A F;  3VUZ A;  3H8Z A;  4LDY A;  1DJ7 B;  1YHQ Q;  5GAN 5;  1Q86 U;  3NTK A;  2P84 A;  4A4F A;  1NJI R;  2M1H A;  1I5O B;  3CBM A;  4PJO F;  1M3B A;  1KD1 C;  2J05 A;  1VQK A;  5LJ3 h;  2BE9 B;  2JNG A;  2CSQ A;  2DE0 X;  1UFF A;  3OBW A;  3CC2 T;  1VQ9 T;  4KBM B;  1Y07 A;  4HKE A;  1YIJ A;  2W0Z A;  4F7U A;  3SFM A;  2DIL A;  1ZLM A;  3PIP A;  5CVI A;  2BZY A;  2KGT A;  3I35 A;  1M1K U;  3JCM V;  1M9S A;  4J9G A;  1OX8 A;  2KNB B;  1WNL A;  2RM4 A;  3OYF A;  3QJY A;  2A36 A;  1C0M A;  2E1H A;  3H9N A;  4PJM A;  2HQH A;  3VS1 A;  4J9I A;  1N9S A;  3MP8 A;  3G7Z A;  4OMO A;  3C0C A;  2QEX A;  2JTF A;  3A98 A;  4PJO D;  4HT8 A;  1FMW A;  3PMI A;  3LGL A;  1EIF A;  1K8A U;  2CP5 A;  3JB9 F;  1WX6 A;  4JRI A;  2RPN A;  3EH2 A;  2QEX Q;  2COZ A;  4C0Z A;  2O4X A;  5EC7 A;  1ABO A;  1ZSZ B;  1D0X A;  2BE7 D;  3BFM A;  3OW2 A;  4BB7 A;  3TSZ A;  4HVV A;  1PHT A;  1Q82 U;  2HNI A;  3GNF B;  2YHT A;  1HYO A;  1KK7 A;  2VUB A;  4RTT A;  4IUT A;  2QEX T;  1QVP A;  4M75 F;  3V7R A;  1J3T A;  2SRC A;  2AKK A;  3OYK A;  1K9M U;  1NJI C;  4QT7 A;  2ZPF B;  3SWN C;  2R5M A;  2GTO A;  1QVF S;  2EPD A;  1VQ7 A;  3E9F A;  1NPR A;  4M77 F;  5GAN e;  1LVK A;  2ED0 A;  3SWN A;  2LP5 A;  1VQ4 T;  4DEY A;  1M1K R;  1QCF A;  2EVR A;  4EDU A;  1AZE A;  1EFN A;  5ECA A;  4Y92 A;  4FYX B;  3OS2 A;  4FT2 A;  1OPL A;  1H3Z A;  4P5N A;  4HCK A;  1HK9 A;  1U1S A;  1B07 A;  3CPW S;  4QQG A;  2NUP A;  2QAZ A;  5LJ5 d;  2EQK A;  1PM3 A;  3HHT B;  4FCY A;  3SWN B;  3VS5 A;  1VQO A;  3LGF A;  5FWB A;  2KAF A;  2DVJ A;  1SHF A;  1RL2 A;  1MHN A;  4WTO B;  3G4S Q;  1GFD A;  2NUT B;  1JJ2 P;  2KSS A;  2PVG B;  1WFW A;  1M2V A;  2I0N A;  1TTH B;  3GPL A;  5I22 A;  2HL5 C;  4M77 A;  4J6X A;  4C0G A;  2RA2 A;  3FJ5 A;  3GNG A;  4HCC A;  2EQU A;  3R6N A;  4OB2 B;  1B3Q A;  4GY5 A;  5EG2 A;  1YWP A;  5L8R E;  1PKS A;  1KSW A;  4X1V A;  4BD3 A;  2GQI A;  5GAO n;  2C0O A;  2GCX A;  3SDZ A;  4HXJ A;  4RTY A;  3RDV A;  2DX1 A;  2MI6 A;  2RHI A;  3JB9 I;  3A5Z B;  4CC7 A;  2CH4 A;  3X20 B;  1VQ8 A;  4KT0 E;  4PJJ A;  5FU7 C;  5GMK m;  4IUV A;  3EGX B;  1VQ6 Q;  1M27 C;  3MEW A;  2CP6 A;  3HP9 A;  1GL5 A;  1OEB A;  4PKC C;  5KH6 A;  3ZBD A;  1OQK A;  1VA7 A;  4IUP A;  1YJ9 A;  1PCX A;  4JJB A;  2LQN A;  4C8Q B;  2NWM A;  4KGV B;  4D8K A;  3I55 A;  3CME Q;  3I9Q A;  4PJO C;  4M77 C;  1B34 B;  3G71 Q;  4KRT A;  1D0Y A;  4M78 G;  3CMA T;  2LX9 A;  4XTU A;  2L3S A;  2JJ9 A;  3EGU A;  2PQW A;  4JJC A;  1SRL A;  5CKH A;  9ATC B;  2LDM A;  5LJ3 f;  4MDX A;  4KUL A;  5GMK i;  5GAN 4;  3OYG A;  2QTX A;  4N0A C;  2L3P A;  1FMV A;  2VGM A;  1IO6 A;  2E3I A;  2CS7 A;  3QXE B;  2C0T A;  4JJN K;  3JCM g;  1JJ2 S;  2J06 A;  2YXY A;  1T3L A;  4EPC A;  1T0H A;  4E7K A;  2DAQ A;  4DBQ A;  3VS6 A;  3HFN A;  4M75 G;  2O4X B;  3BW1 A;  2EKH A;  3CCM T;  3M0R A;  2JTM A;  3CCV A;  2KK4 A;  1M3A A;  3UDC A;  1UGS B;  4PJN A;  4Z88 A;  4LNP A;  2ED1 A;  3CD6 A;  5KCO A;  2D9T A;  1GFC A;  4RG8 A;  3CXC P;  4OVA A;  2LQW A;  1TS9 A;  1PSE A;  2XMF A;  4JZ4 A;  1XJW B;  3G71 A;  5IHI A;  3EAE A;  1M8V A;  2QQR A;  4ZTJ A;  1WJS A;  4E7S A;  1VQM T;  1N5Z A;  4HVW A;  3UWN A;  4C8Q D;  3I56 A;  2EAY A;  5GAN d;  1YJ9 Q;  1UTI A;  3BDL A;  3TEE A;  3KXT A;  2QDL A;  2ZPG B;  5CIU A;  1YP5 A;  2DYB A;  3VUB A;  3A8O B;  5LJ3 g;  2EJG A;  4XK8 E;  2AIR B;  2P4R A;  2IVW A;  2MPX C;  3OQ5 A;  4MML A;  3M55 A;  2K79 A;  1VQL T;  1Y0M A;  2FVU A;  1WA7 A;  2VAS A;  3P8B B;  2DBM A;  2G3R A;  3ER0 A;  3LH5 A;  3CBO A;  4FSX A;  3OY9 A;  1VQK Q;  2DD5 A;  1E6G A;  3UPU A;  4J9B A;  1T3S A;  1BBZ A;  3OYL A;  1TG0 A;  1WJR A;  2E10 A;  1JQQ A;  3OBY A;  5GAN 7;  2MOX A;  5J39 A;  2OTL Q;  2CGH A;  3CCL Q;  2DJQ A;  5A0G A;  3CCE A;  1NG2 A;  2AHJ B;  1NLP C;  2D8J A;  2X4X A;  1SRM A;  4IKF A;  2OTL T;  2M0O A;  1FYN A;  4JDS A;  1I07 A;  1MMD A;  1M2V B;  3UA7 A;  5KE3 A;  3CC4 A;  4E7J A;  2D0N A;  2K4Y A;  1BI3 A;  4LUE A;  2E3H A;  1XOV A;  2XKO C;  2WSE E;  5LJ5 f;  5LJ3 j;  2JOY A;  4IUR A;  2LJ0 A;  2DER A;  3OYN A;  1PC0 A;  1VQN Q;  4ME7 A;  1BCO A;  4IIO A;  3M58 A;  1ZSZ C;  1UE9 A;  2K3B A;  3JB9 J;  1I81 A;  2DET A;  1WHM A;  4M7A E;  2DL7 A;  1YI2 T;  1AWW A;  4C92 D;  2OAW A;  2RD1 A;  3RMS A;  3VS3 A;  3VJP A;  2FRW A;  2KI7 A;  2A7Y A;  1KC8 C;  4PFP A;  3CC4 T;  1E6H A;  2L0A A;  2QA4 Q;  2VB6 A;  2CSI A;  1LOJ A;  3JCM P;  2YDL A;  3CCU A;  5IXB A;  1WQ7 A;  1TUC A;  1YN8 A;  1AVZ C;  3OS5 A;  2A37 A;  3C95 A;  3IQL A;  1R8O B;  3REA B;  1T0J A;  2OTJ Q;  2KEA A;  3PVQ A;  2RK2 A;  2V8J A;  3FB9 A;  4PJO A;  5GAN 8;  1RAE B;  3H0F A;  1YI2 A;  1K76 A;  4LDW A;  4B9W A;  5DLO A;  2PNI A;  4FYV B;  4DEX A;  3CCL A;  4E7I A;  3EFO B;  1TXQ A;  4RKU E;  2E64 A;  3CQT A;  4GLK A;  4BDZ A;  3CPW P;  3HFO A;  5GAM g;  4FT4 A;  4XAX B;  1A0N B;  5IHN A;  4PJO B;  1RLP C;  1M1G A;  3G1J A;  2JS2 A;  2HD0 A;  1QCO A;  1KQS A;  5I21 A;  2LQ8 A;  3HSB A;  3X25 B;  1K9M C;  3SEM A;  3M56 A;  4A54 A;  5GMK h;  4E47 A;  3DKM A;  1JBM A;  4OMM A;  1LCK A;  2R5A A;  2CT3 A;  2EWN A;  4OMN A;  4J6W A;  4J7I A;  2M02 A;  2DZC A;  3EFS A;  1UJY A;  5KYW A;  1YCY A;  3CCS T;  2RB6 A;  2JMC A;  2RQR A;  2Z0W A;  1NBE B;  3BDU A;  4FYY B;  2MMP A;  1MV3 A;  1MND A;  2I2L A;  1VYT A;  5AT1 B;  3NPF A;  2L89 A;  1QVG P;  1JEG A;  1BI0 A;  5CQY A;  3RNJ A;  2E5Q A;  3U23 A;  3CD6 Q;  1TH7 A;  1RAI B;  4F17 A;  2FB7 A;  5KYW B;  2LCC A;  1MMA A;  4JZ3 A;  5GAN h;  2L2P A;  1Q95 G;  4KUI A;  1U1T A;  1YJN Q;  3QKJ A;  2JVV A;  4B6M A;  4N4G A;  2V8I A;  2QG9 B;  1NE8 A;  1X6B A;  3S3N A;  3JCM h;  3QDR B;  3SHW A;  3CCR A;  4GLM A;  2HL3 A;  2E70 A;  2IPO B;  4LE9 A;  3CCE T;  1YNZ A;  2DTO A;  4B9X A;  2EW3 A;  5IXF A;  1K9M R;  1UGQ B;  4M78 B;  3EG9 B;  1AOJ A;  5HK0 A;  2X3X D;  1OV3 A;  1W2B A;  2F2V A;  4QVZ A;  3I55 Q;  5C6S A;  4LDX A;  3OYB A;  2JMA A;  1I0C A;  4C8Q F;  1G83 A;  1UGP B;  1VQP A;  1X27 A;  3UAT A;  5LJ5 e;  3CCR T;  1YI2 Q;  2DZ9 A;  3HRU A;  1WPY A;  1QCN A;  3GP8 A;  2GQV A;  2CKK A;  2MF2 A;  1KD1 U;  1FWZ A;  2OTJ A;  4PLI A;  4IUQ A;  5GAM h;  3CC2 A;  4M77 E;  3M53 A;  4JRP A;  4QW2 A;  3CXC S;  3X28 B;  2PU9 B;  1G3W A;  4OMP A;  4HCZ A;  1KQ2 A;  2LX7 A;  3RKX A;  1GBQ A;  5IT9 E;  1SEM A;  3JV3 A;  3JB9 D;  4VUB A;  5GAO r;  4JS4 A;  4QKU A;  3M0T A;  3CCU T;  5KE2 A;  2HDA A;  2DK3 A;  2K5F A;  4CI0 C;  3X26 B;  1BCM A;  1VQP T;  1WHL A;  4EMK B;  3PFS A;  3VS7 A;  1M5Q 1;  1RAB B;  4WCI A;  3H0I A;  4FSS A;  4WF2 A;  2PUK B;  3CEY A;  1JJ2 A;  4DBH A;  1R77 A;  1WI7 A;  4LDV A;  5DM7 R;  1M1K C;  2LT4 A;  1F1B B;  3OW2 S;  4C8Q G;  3OW2 P;  4F14 A;  2ZGW A;  5J3B A;  3L2Z A;  1PNJ A;  2DBK A;  1BYM A;  3FJP A;  2YUQ A;  4IIM A;  2ROT A;  3P8H A;  1YBY A;  4EMK A;  2O88 A;  4J9H A;  1N27 A;  1ZBJ A;  3L2V A;  4A4K A;  1M1F A;  3EG1 A;  4LDU A;  5FLX E;  3EG0 A;  4E7Z A;  1WXT A;  1QQJ A;  4OB3 B;  1JXO A;  3V8K A;  4N4I A;  4Z02 A;  3THK A;  2KDS A;  2YSQ A;  1NEB A;  4Z8A A;  4XTY A;  5HCK A;  2X4W A;  4D8D A;  1H92 A;  5FU7 B;  3TQ7 P;  2FYK A;  4O5V A;  1JXM A;  1SKU B;  4F7U E;  4BUG A;  1VQ4 A;  2KVQ G;  3E9G A;  4LXC A;  4R55 A;  4C0F A;  4M7D F;  3X24 B;  1IZ6 A;  2JM9 A;  2RQU A;  4BE0 A;  2FO0 A;  4BY6 B;  3Q1J A;  2B86 A;  1K0S A;  3LH0 A;  2KT1 A;  1X43 A;  2NUZ A;  2QQS A;  1N9R A;  2LMJ A;  5FRN A;  3I5R A;  2G6F X;  1AWJ A;  2FPD A;  3WXM B;  2HQX A;  3QWX X;  1RAD B;  2QYZ A;  1AWX A;  1G8X A;  4AT1 B;  1YJW Q;  2VKN A;  1MMN A;  3CCQ T;  3M54 A;  4J9C A;  3NTI A;  2AT1 B;  2LTO A;  3OYJ A;  3CBP A;  1D09 B;  1MNE A;  2RQT A;  3VS2 A;  3LX7 A;  3CC2 Q;  1UJ0 A;  3GBQ A;  4M7A G;  1VIF A;  1VYV A;  2RH2 A;  1VQK T;  2MYS A;  3TU4 K;  4M75 A;  2CYZ B;  2LNV A;  1PKT A;  3CC4 Q;  2E6N A;  2EQI A;  2BUD A;  2YUO A;  2QQB A;  1BI1 A;  1Q82 R;  1EZZ B;  2LNH B;  3MEA A;  4GBQ A;  5KYX A;  4C92 A;  3MJX A;  1VQ8 T;  3VKI A;  4BAC A;  2K6D A;  4ESR A;  3CCQ A;  1PRM C;  1OX9 A;  3URG A;  2DM1 A;  4FM4 B;  3M4Y A;  4ZGE B;  4RMO A;  2CP7 A;  3LW5 E;  2DYI A;  2QI2 A;  1W70 A;  3OB9 A;  1I5L A;  1ABQ A;  2K7A A;  1SSF A;  2DFU A;  2KXD A;  3L42 A;  1K8A R;  3I55 T;  1KJW A;  1VQM Q;  1HXD A;  3QHS A;  4JUV A;  4K11 A;  4C92 B;  2KY9 A;  2GFA A;  3REB B;  4M4Z A;  1WHJ A;  2E12 A;  3JRZ A;  5KYU A;  4LD9 K;  5AYF A;  1QVG A;  2MWO A;  2MIO A;  2HBP A;  3FRN A;  1LPL A;  1SHG A;  3I56 Q;  1JB0 E;  4OMQ A;  2RQV A;  3FIF A;  2BIV A;  1JU5 C;  2X51 A;  1LJO A;  4AFZ C;  1G3T A;  1X69 A;  2AZV A;  5GAN 2;  2BZX A;  3ULR B;  1VOM A;  2RJF A;  4KGZ B;  3ZL7 C;  3E1S A;  4C5I A;  1WGS A;  3LWI A;  4C8Q E;  1UHC A;  1FX7 A;  4XTZ A;  2YUN A;  4E7L A;  5FRO A;  2Y4X A;  1Q86 R;  5I2S A;  3V8J A;  1UHF A;  3G71 T;  2XIC A;  1UEB A;  2VXF A;  5KYY A;  4E6R A;  5GAO q;  1Y71 A;  1SSH A;  1RUW A;  4RCB A;  1X01 A;  2HSP A;  5IH2 A;  2VGN A;  2F5K A;  4FL6 A;  1NYF A;  1PD0 A;  2KQW A;  1QLY A;  2ABL A;  2RF0 A;  3VRY A;  5GAN j;  2RNA A;  2D6F A;  3QBY A;  1YWO A;  5GAN g;  5D6X A;  2FPF A;  2O01 E;  1VQO T;  3N5B B;  1TU0 B;  2PZ1 A;  1Z9Z A;  5GMK e;  2FPE A;  2QXF A;  3CME T;  2ENM A;  2OAU A;  1D1C A;  4BI4 A;  2ZCF B;  4ORZ A;  4C5E A;  1WLP B;  4RTX A;  1B34 A;  1N8R R;  3GLX A;  5GAO l;  4HVU A;  2EJ9 A;  4XTW A;  5D7U A;  1I4K 1;  4XU0 A;  4QQD A;  5GAO m;  3M0P A;  3RMQ A;  5FRM A;  1Q81 R;  1VQ8 Q;  5L23 A;  1WZO A;  2YRV A;  2DD4 A;  4A4E A;  4EMG A;  2AK5 A;  2AZS A;  4M7D C;  1KIK A;  3C4S A;  1OU9 A;  1WYX A;  3DLM A;  3M57 A;  4L6V 5;  3PNW C;  2K2V A;  1UDL A;  1VQN T;  2RHY A;  2M51 A;  4PJO G;  2BKD N;  4ANJ A;  2RJE A;  1RAA B;  2DNU A;  2ZPI B;  3BY7 A;  2KMT A;  1N8R C;  1Y7X A;  1QP2 A;  4OGC A;  1K1Z A;  2A3L A;  4M7D G;  1FMK A;  2M0Y A;  3ZEH A;  5GAM j;  3CPF A;  2DL3 A;  5J26 A;  5LJ5 g;  3V7S A;  4FYW B;  1H3H A;  2P0Q A;  1IHV A;  4DOW A;  2H3E B;  4RG2 A;  3KFV A;  4M7D B;  2XI9 A;  5KYX B;  5LJ5 h;  1RI9 A;  4M75 C;  2DF6 A;  2EYQ A;  2X35 A;  4PJL A;  2GF7 A;  1YJN T;  1O75 A;  1VQN A;  4ZGJ B;  2F2X A;  2D0Q B;  3CCQ Q;  4PLL A;  2R58 A;  1M4Z A;  3PMT A;  4II1 A;  2RHX A;  3A8G B;  7AT1 B;  2CZ7 B;  3QO3 A;  3GOX A;  5GAM e;  2CDT A;  3MP1 A;  2IIM A;  2DEU A;  1RAH B;  1RLQ C;  1U06 A;  4F7U F;  1W2B S;  4M7D A;  2NLU A;  4M7A B;  3RIR A;  5GMK j;  1Q86 C;  2XDB A;  3JB9 G;  1WQW A;  1PWT A;  1VQ5 A;  4BI3 A;  1PG5 B;  5KYU B;  5GAN 3;  1VQ7 Q; 
#chains in the Genus database with same CATH homology
 5DLQ E;  1ZHI A;  1XTD A;  5C6S A;  3CCV T;  4LDX A;  3OSV A;  3OYB A;  2QA4 A;  2XDD A;  5CAI A;  2VV5 A;  2DXU A;  3HHT B;  3SWN B;  1VQO A;  2P0P A;  2F5T X;  4C8Q F;  3LGF A;  1U8R A;  1UGP B;  2KAF A;  2WAC A;  5LJ5 j;  1VQP A;  4MMK A;  3CCJ A;  1RL2 A;  5LJ5 e;  3G4S T;  5LJ3 d;  1MHN A;  1VUB A;  3A8M B;  3VV0 A;  3CCR T;  4A4G A;  2DZ9 A;  3HRU A;  1WPY A;  3GP8 A;  2GQV A;  2CKK A;  3J81 E;  3CCL T;  2MF2 A;  2P0K A;  4HCB A;  4QVD A;  4RCC A;  1KD1 U;  2C06 A;  1FWZ A;  2RJD A;  2OTJ A;  4PLI A;  2P4T A;  2KSS A;  1OZ2 A;  3QSU A;  2PVG B;  3CC7 T;  4IUQ A;  5GAM h;  1XQH A;  2M9U A;  3M59 A;  4M77 E;  3GPL A;  3A8L B;  2XU8 A;  3CME A;  1G5V A;  3M53 A;  5GAN f;  4JRP A;  4M77 A;  4J6X A;  4C0G A;  4QW2 A;  4C0D B;  5A2Q E;  3UT1 A;  4A53 A;  3CXC S;  2RA2 A;  3X28 B;  2XID A;  2PU9 B;  1QVG S;  1G3W A;  3QYH B;  4Y91 A;  4C92 E;  1VQL A;  3GNG A;  4HCZ A;  5GAM f;  4HCC A;  1AHJ B;  2EQU A;  3MP6 A;  3TCJ A;  1KQ2 A;  3RKX A;  2XHC A;  4OB2 B;  4NS5 A;  3V7C A;  3WVD B;  3JCM Q;  5IT9 E;  3FLG A;  4GY5 A;  4OP0 A;  3JB9 D;  4VUB A;  5EG2 A;  5GAO r;  3G6E T;  4X9C A;  3OYA A;  4JS4 A;  1G3Y A;  5L8R E;  3CCU T;  5KE2 A;  1V29 B;  2DK3 A;  2LVM A;  2K5F A;  3C94 A;  4BD3 A;  3S6W A;  2GCX A;  3X26 B;  4CI0 C;  5GAO n;  3SDZ A;  2VXE A;  2QQ9 A;  1Q7Y C;  3CCS A;  5A0D A;  2LC4 A;  2MI6 A;  3MEU A;  1VQP T;  2DIQ A;  4EMK B;  2RHI A;  3HRT A;  3PFS A;  3JB9 I;  3H6Z A;  3CCJ T;  1YJW T;  3A5Z B;  1M5Q 1;  5GAN 6;  3V8L A;  3X20 B;  1VQ8 A;  4WF2 A;  1JJ2 A;  3JCM c;  2PUK B;  3CEY A;  1S72 A;  2JZ2 A;  4KT0 E;  4Y28 E;  5FU7 C;  5GMK m;  4IUV A;  4LDV A;  2X4Y A;  1M90 C;  5DM7 R;  3MEW A;  5GAO p;  3OS1 A;  1Q81 U;  3HP9 A;  2OTL A;  1M1K C;  2LT4 A;  5CKF A;  3OW2 S;  1RI0 A;  1UB4 A;  4PKC C;  4C8Q G;  5KH6 A;  2IG0 A;  3ZBD A;  4FIB A;  4IUP A;  5D6Y A;  1YJ9 A;  2VYT A;  2ZGW A;  1ZQ1 A;  3M4G A;  5J3B A;  3L2Z A;  4F7U B;  2B8A A;  2JN0 A;  2K57 A;  3HPW A;  3FJP A;  4NL3 A;  4C8Q B;  1BYM A;  3I55 A;  3LWH A;  1FXX A;  2PVO B;  3RES A;  2MAM A;  1YBY A;  3P8H A;  3C12 A;  4IUU A;  1N27 A;  4OF1 A;  4EMK A;  4PJO C;  3L2V A;  3O8V A;  4M77 C;  4A4K A;  1M1F A;  3QUI A;  2EFI A;  1B34 B;  4LDU A;  3RKW A;  5FLX E;  3G6E A;  4M7D D;  4XQ3 A;  3P8D A;  2DTI A;  4Q5W A;  1X6O A;  2K5I A;  4HT9 A;  1MGQ A;  4M78 G;  4OB3 B;  3ME9 A;  3CMA T;  3PGG A;  4L5G A;  3V8K A;  2LX9 A;  4XTU A;  3MEV A;  4M77 G;  4N4I A;  4Z02 A;  3GF5 A;  4J7F A;  2E41 A;  5FU6 C;  2KDS A;  2RI5 A;  1YHQ T;  4XTY A;  3RKY A;  2PQW A;  4J8O A;  5CKH A;  3OMG A;  2LDM A;  5LJ3 f;  4MDX A;  4O6J A;  1NPP A;  4J6Y A;  2X4W A;  4KUL A;  5GMK i;  5GAN 4;  3OYC A;  2QTX A;  3OYG A;  1VQ6 T;  1WJQ A;  4N0A C;  5KCH A;  2VGM A;  4M78 D;  1Y96 A;  5FU7 B;  1YIJ T;  2CS7 A;  3QXE B;  4C5G A;  4JJN K;  3JCM g;  1JJ2 S;  1OI1 A;  2FYK A;  3OSS C;  4EPC A;  4O5V A;  3JCM X;  2WSC E;  2PUO B;  2DKG A;  2XG8 D;  2RHU A;  4E7K A;  2DAQ A;  2GFU A;  3HFN A;  3M9Q A;  4M75 G;  4F7U E;  2O4X B;  4BUG A;  3BW1 A;  2L8D A;  2LRQ A;  1VQ4 A;  2F69 A;  2EJF A;  2KVQ G;  3OS0 A;  3CCM T;  3VYH B;  2DIG A;  3E9G A;  3QPH A;  1KC8 U;  3L2W A;  3JCM W;  4R55 A;  1BKB A;  2JTM A;  4C0F A;  3CCV A;  4M7D F;  2KK4 A;  3DB3 A;  3UDC A;  4PJO E;  3X24 B;  1IZ6 A;  1UGS B;  3R6O A;  4ZGD B;  1BIB A;  3CD6 A;  5KCO A;  4BE0 A;  2D9T A;  1PSF A;  2V8K A;  4OVA A;  2E6Z A;  4RG8 A;  5D6W A;  4BY6 B;  3Q1J A;  4J5Y A;  2EQJ A;  4M75 D;  5CCA A;  4TVR A;  1Y96 B;  3HKS A;  3QZ9 B;  3LH0 A;  1PSE A;  3OA6 A;  2MWP A;  5GMK l;  3G71 A;  2QQS A;  1N9R A;  5FRN A;  3EAE A;  1M8V A;  2ZZD A;  2QQR A;  4X34 A;  3RUX A;  3ZFJ A;  2K3Y A;  3CPW A;  4MZM A;  4ZTJ A;  2EQM A;  3JAM E;  4OB1 B;  3WXM B;  1WJS A;  2HQX A;  1VQM T;  2RI2 A;  3JSC A;  3T9N A;  1VQ6 A;  2RO0 A;  3UWN A;  4KUD K;  4C8Q D;  4D6W A;  5CKB A;  2EAY A;  3I56 A;  2L3R A;  5GAN d;  2JUF A;  3BDL A;  3G4S A;  3TEE A;  4FU6 A;  3KXT A;  3CCQ T;  4XTX A;  2ZPG B;  3HRS A;  3M54 A;  2LT1 A;  5CIU A;  4EMH A;  3VUB A;  3A8O B;  3NTI A;  4M78 E;  3NFC A;  5LJ3 g;  4NL2 A;  2EKO A;  2LTO A;  3OYJ A;  3CBP A;  2EJG A;  4MZP A;  4OGE A;  3OYH A;  4XK8 E;  3CC7 A;  2IVW A;  5HK3 A;  2DVE A;  2XDP A;  3LX7 A;  4JLG A;  5FU6 B;  2DPP B;  2RHZ A;  1XNI A;  4M7A A;  3OQ5 A;  4C92 C;  4MML A;  3M55 A;  2ZPE B;  4M7A G;  4M77 D;  1VQL T;  4M78 F;  1VIF A;  2DXC A;  5CKE A;  5CK9 A;  2K5L A;  2FVU A;  2R57 A;  2RH2 A;  3P8B B;  1VQK T;  3ER0 A;  1LNX A;  2G3R A;  2H3J A;  4M78 C;  3TU4 K;  1KHC A;  2X4J A;  2CYZ B;  3CBO A;  3QG1 A;  4FSX A;  4M75 A;  1YIT T;  1D3B A;  2LNV A;  1Q81 C;  3NTH A;  3OY9 A;  4M7A C;  2E6N A;  4M75 E;  2QQA A;  2BUD A;  2DD5 A;  4CRI A;  3UPU A;  4M7A D;  3OYL A;  1VQ7 T;  4JRK A;  1W4S A;  1WJR A;  2QQB A;  5I2M A;  1BI1 A;  1QVF A;  1YJW A;  2E10 A;  3OBY A;  4N4H A;  1K73 C;  3MEA A;  5GAN 7;  1YJ9 T;  1QW1 A;  4C92 A;  1VQ5 T;  5J39 A;  1VQ8 T;  3VKI A;  4BAC A;  3JB9 H;  2L5Q A;  2CGH A;  3CCQ A;  5A0G A;  4ATO A;  3URG A;  3CCE A;  4FM4 B;  2AHJ B;  2YLB A;  3M4Y A;  4ZGE B;  2X4X A;  3SB2 A;  5M9O A;  3JCM b;  4RMO A;  4IKF A;  2OTL T;  2M0O A;  5A0L A;  4JDS A;  4M75 B;  3L2Q A;  3LW5 E;  1D3B B;  2QI2 A;  3KUF A;  3JCM e;  4J83 A;  3OB9 A;  5KE3 A;  1I5L A;  3CC4 A;  2RK1 A;  5IAY A;  1KQ1 A;  2CZ1 B;  4E7J A;  3JCM J;  2XD0 A;  1SSF A;  1IRE B;  4E7H A;  4M77 B;  3QYG B;  3MHX A;  3EFR A;  4MDW A;  3DLL A;  2DEQ A;  2K4Y A;  1BI3 A;  3L42 A;  3MET A;  3I55 T;  1N6A A;  1NJI U;  1H64 1;  3QJ6 A;  1HXD A;  1XOV A;  2XKO C;  5LJ3 e;  2WSE E;  4PNO A;  5LJ5 f;  2Y4Y A;  3QHS A;  2QA4 T;  4C8Q C;  3CC2 A;  5LJ3 j;  2HQE A;  2JOY A;  4IUR A;  4JUV A;  4C92 B;  5GAM d;  2KY9 A;  3J80 E;  5CO7 A;  3OYN A;  2GFA A;  1Q7Y U;  4PL6 A;  3INZ A;  4ME7 A;  3M58 A;  5IN1 A;  4JRQ A;  2FHD A;  2E65 A;  3JB9 J;  4L59 A;  3OYE A;  1I81 A;  3ASK A;  2E12 A;  1VIE A;  3JRZ A;  3S3M A;  3SD4 A;  4LD9 K;  4BE1 A;  5AYF A;  1YHQ A;  5LL6 S;  1QVG A;  3E19 A;  1KQS S;  2MWO A;  4XTV A;  4XU1 A;  4M7A E;  2HBP A;  2LCL A;  4QVC A;  4BDY A;  3FRN A;  1YI2 T;  1KG1 A;  1JB0 E;  1OZ3 A;  2M16 A;  4C92 D;  2DXB A;  3L1A A;  3FIF A;  4MZT A;  4EMK C;  5CQX A;  2RD1 A;  3OYY A;  3RMS A;  2VC8 A;  3OYD A;  3TRE A;  2BIV A;  4DA4 A;  3CD6 T;  1K73 U;  3A8H B;  3VJP A;  1LJO A;  1QP3 A;  1ZBX A;  2A7Y A;  1KC8 C;  1G3T A;  3FEO A;  5GAN 2;  4XU3 A;  3CC4 T;  2Y90 A;  4ELZ C;  1OYX A;  2RJF A;  2ZPH B;  3FC3 A;  3E1S A;  4C5I A;  3M5A A;  4XU2 A;  4C92 G;  4C8Q A;  4JS5 A;  1S72 T;  1WGS A;  3PIO A;  1LOJ A;  1NZ9 A;  4BY6 C;  3JCM P;  3LWI A;  1VQ9 A;  3CCU A;  4V2S A;  1G3S A;  4UC4 A;  4C8Q E;  1YJN A;  1WQ7 A;  5C0M A;  1FX7 A;  4XTZ A;  4E7L A;  1VQM A;  3MO8 A;  4BE2 A;  5FRO A;  2Y4X A;  3LYI A;  3OS5 A;  3I56 T;  5I2S A;  3C95 A;  3V8J A;  3CXC A;  3AHU A;  4HA8 A;  1Q82 C;  4NOY A;  3G71 T;  2XIC A;  3S3O A;  1R8O B;  1UEB A;  2VXF A;  4A4H A;  2FL7 A;  3F70 A;  5GAO q;  1Y71 A;  3MCA B;  5HKC A;  2RK2 A;  2XK0 A;  2V8J A;  3QII A;  4RCB A;  3FB9 A;  4M7A F;  1X01 A;  4PJO A;  5GAN 8;  2VGN A;  3VUZ A;  3H8Z A;  2F5K A;  4FL6 A;  4LDY A;  1DJ7 B;  1YI2 A;  3VU3 C;  5GAN 5;  5CR2 A;  1Q86 U;  3NTK A;  4LDW A;  4B9W A;  5DLO A;  4A4F A;  2KQW A;  5GAN j;  2D6F A;  2M1H A;  3CBM A;  3QBY A;  4PJO F;  5GAN g;  3OYI A;  1KD1 C;  3CCL A;  4E7I A;  4M7D E;  3DB4 A;  1K8A C;  4RKU E;  2E64 A;  5D6X A;  1VQK A;  4GLK A;  2HAX A;  4BDZ A;  2O01 E;  5LJ3 h;  1VQO T;  3HFO A;  4JLI A;  3N5B B;  5GAM g;  4FT4 A;  4XAX B;  2JNG A;  3PTA A;  5GMK e;  3OBW A;  3CC2 T;  1VQ9 T;  2QXF A;  4KBM B;  3CME T;  1Y07 A;  4HKE A;  3HL8 A;  4X9D A;  1YIJ A;  2OAU A;  5HY6 A;  3SFM A;  4F7U A;  1GXI E;  4BI4 A;  4PJO B;  1O9S A;  4F7U G;  3PIP A;  2ZCF B;  1M1G A;  5CVI A;  3L2R A;  1M1K U;  4ZTF A;  2HD0 A;  3JCM V;  3OYM A;  4C5E A;  1M9S A;  4OB0 B;  1M90 U;  2OTJ T;  1KQS A;  3KBG A;  5I21 A;  2LQ8 A;  1X75 C;  3HSB A;  3X25 B;  1K9M C;  1B34 A;  1WNL A;  2RM4 A;  3GLX A;  3M56 A;  3OYF A;  3QJY A;  2E1H A;  5GAO l;  4A54 A;  5GMK h;  2EJ9 A;  4XTW A;  1I4K 1;  4E47 A;  3DKM A;  4XU0 A;  4QQD A;  1JBM A;  5GAO m;  2EIF A;  1N9S A;  3MP8 A;  3G7Z A;  3RMQ A;  1KHI A;  3LLR A;  5FRM A;  2QEX A;  2JTF A;  4PJO D;  2LQK A;  4HT8 A;  3PMI A;  3LGL A;  2YRV A;  2R5A A;  2DD4 A;  2RJC A;  4A4E A;  4EMG A;  4C5H A;  5CKD A;  2EWN A;  4M7D C;  1P92 A;  4J6W A;  4J7I A;  3C4S A;  2DO3 A;  1N8R U;  1EIF A;  1JRI A;  2DXT A;  2ZPB B;  3DLM A;  3M57 A;  3PNW C;  4L6V 5;  1K8A U;  2K2V A;  1VQN T;  2DZC A;  2RHY A;  3JB9 F;  3EFS A;  4JRI A;  1YCY A;  3CCS T;  2RB6 A;  4PJO G;  4ZN1 A;  2BKD N;  4YTL A;  4C0Z A;  2RJE A;  2O4X A;  2ZPI B;  3BDU A;  2KMT A;  3BY7 A;  1Y7X A;  1QP2 A;  4BI8 B;  1N8R C;  2MMP A;  4OGC A;  2I2L A;  4C0D C;  5GAN 3;  2DTH A;  3BFM A;  3OW2 A;  2A3L A;  2L89 A;  4BB7 A;  4M7D G;  3ZEH A;  5GAM j;  4QQ6 A;  1Q82 U;  1BI0 A;  3CPF A;  5CQY A;  4ELY C;  3L2U A;  2E5Q A;  2HNI A;  3GNF B;  2YHT A;  3WVE B;  1TH7 A;  2VUB A;  3QZ5 B;  1BIA A;  5J26 A;  2CZ6 B;  3CMA A;  2FB7 A;  4DOV A;  5DY9 A;  2YLC A;  2LCC A;  3V7S A;  5LJ5 g;  2P0Q A;  4DOW A;  5GAN h;  4IUT A;  3JCM f;  2QEX T;  4KUI A;  4RG2 A;  1QVP A;  4M75 F;  1U1T A;  2XI9 A;  3V7R A;  4M7D B;  3QKJ A;  5LJ5 h;  2JVV A;  4N4G A;  1YIT A;  2V8I A;  4M75 C;  2EYQ A;  2X35 A;  4M78 A;  2QDY B;  1NE8 A;  3OYK A;  3S3N A;  1NJI C;  1K9M U;  3JCM h;  3QDR B;  4C92 F;  2ZPF B;  2GF7 A;  1YJN T;  3SWN C;  1O75 A;  2R5M A;  3CCR A;  1VQN A;  1QVF S;  4ZGJ B;  3PT9 A;  3OMC A;  2D0Q B;  4R56 A;  1VQ7 A;  4PLL A;  4ZN3 A;  2R58 A;  1M4Z A;  3E9F A;  1NPR A;  4M77 F;  2CZ0 B;  2E70 A;  3PMT A;  2RHX A;  4II1 A;  4N0A A;  5GAN e;  3A8G B;  1UGR B;  2RI3 A;  2CZ7 B;  3QO3 A;  4LD6 A;  3SWN A;  1VQ4 T;  2WSF E;  3CCM A;  3FDR A;  3GOX A;  3CCE T;  5GAM e;  2DTO A;  3MP1 A;  3RER A;  4B9X A;  4EDU A;  1W2B S;  4M7D A;  4F7U F;  1UGQ B;  2NLU A;  4M7A B;  3RIR A;  3GIB A;  5GMK j;  1Q86 C;  3VYG A;  4DQ2 A;  3OS2 A;  4FT2 A;  2XDB A;  4M78 B;  1H3Z A;  4P5N A;  2K3X A;  3JB9 G;  1WQW A;  4OMF B;  3JCM d;  5HK0 A;  1VQ5 A;  1I8F A;  4BI3 A;  1HK9 A;  1W2B A;  1U1S A;  1BI2 A;  3CPW S;  4QQG A;  2PVD B;  3J7A F;  4QVZ A;  2DJZ A;  5LJ5 d;  2EQK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...