2PUOB

Crystal srtucture of the nem modified ferredoxin:thioredoxin reductase
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
73
structure length
73
Chain Sequence
b'MNVGDRVRVTSSVVVYHHPEHKKTAFDLQGMEGEVAAVLTEWQGRPISANLPVLVKFEQRFKAHFRPDEVTLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-thioredoxin reductase, catalytic chain
publication title Structural snapshots along the reaction pathway of ferredoxin-thioredoxin reductase.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Electron transport
total genus 11
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02941 FeThRed_A Ferredoxin thioredoxin reductase variable alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2puoB00
4OB1B 3QZ9B 3X26B 3HHTB 2ZCFB 4XK8E 3WVEB 4OB2B 3X25B 4KT0E 1AHJB 2CYZB 3A8OB 2CZ7B 2ZPEB 3VYGA 2PUOB 3QZ5B 2DD4A 5L8RE 1V29B 2DXCA 3WVDB 2PVDB 2DXBA 2O01E 4Y28E 2DD5A 2ZPFB 2QDYB 1UGSB 2CZ1B 2WSEE 3QXEB 2ZPGB 3X28B 1PSFA 3X24B 1UGPB 3A8HB 2D0QB 1UGRB 2ZZDA 4OB3B 1QP2A 4FM4B 2WSFE 2ZPHB 2CZ6B 1JB0E 3A8GB 3X20B 2WSCE 4ZGEB 1PSEA 3A8LB 4L6V5 2CZ0B 2ZPIB 2PVGB 2PVOB 1GXIE 2PUKB 3VYHB 1IREB 4OB0B 3QYHB 2AHJB 3A8MB 2DPPB 4ZGJB 3QYGB 4ZGDB 3LW5E 2ZPBB 1QP3A 1UGQB 1DJ7B 2PU9B 4RKUE
chains in the Genus database with same CATH superfamily
5J3BA 1HK9A 5IHIA 1Y71A 4C92A 5HY6A 8ATCB 1VQMT 2XK0A 4C92F 2COWA 4AT1B 2MI6A 4J83A 4M7AA 1PM3A 2P4TA 2AT1B 1E6HA 3H0HA 2CYZB 4M7AF 1RAAB 4E7KA 1LNXA 4LN2A 3JCMh 4JRKA 3CCJT 3VS0A 1G3WA 2KNBB 1RACB 5L8RE 3VS3A 5GMKm 2FRWA 3G71Q 1KQSS 3TQ7P 3REBB 1G2BA 2D6FA 1MMNA 4R0KA 4HVUA 5GAMh 1PRMC 3QIIA 1RAHB 2QQRA 1X6OA 4J5YA 2CREA 2DXUA 2RNAA 1I0CA 2E12A 5FU6B 4BUGA 2KSSA 1D0XA 4M7DG 1OPLA 1YJWQ 3URGA 4C92C 5CKDA 3FEOA 1W2BS 3L42A 4M7AC 3ULRB 3OYAA 2HEQA 2JXBA 3PNWC 3I55Q 2YSQA 5LJ3f 1QCOA 3NFCA 1E7OA 4OF1A 1H3ZA 3I9QA 1C0MA 1LJOA 1OU8A 4XAXB 1RL2A 3C94A 5GANf 1VQPQ 1WIEA 2KY9A 4HCKA 5D6XA 3PGGA 4CC4B 2KRNA 1GXIE 3VYHB 1VQ7Q 6AT1B 2B8AA 5LJ3d 5C6SA 1CKAA 1Q7YC 2K5IA 3M0TA 1GFCA 2NUTA 3PTAA 1EZZB 2DEUA 1VQ8T 4EIKA 2E6ZA 3LW5E 3TCJA 2FZKB 3GBQA 3BFMA 5GANd 1B3QA 1QKXA 2DETA 2BZ8A 3HRSA 2VKNA 3SHWA 1KD1R 3ASKA 1ZLMA 4XK8E 4M7DF 4C0FA 2QEXA 3M0QA 1QVPA 1M4ZA 3CCSQ 3KFVA 5GAOp 4M78B 1NJIC 2PQWA 1UJ0A 4JJDA 1YJNA 5GJVB 3MP6A 4XTVA 2QYZA 3SB2A 2QQBA 1YWOA 3WVDB 1KQ2A 2LZ6B 3QKJA 2XG8D 4CC7A 2DXBA 4AFUC 2BIVA 1W6XA 3UT1A 3FRNA 5GMKh 1SSHA 1VQNA 3OBWA 1BIAA 1WHLA 4RMOA 3A98A 4LDYA 4ATOA 5CK9A 2DJQA 1M90C 2GGRA 1YIJT 3AHUA 2JT4A 1Y07A 1GRIA 2X3XD 2BUDA 4A4FA 4XU0A 3CXCA 4Z88A 1PSFA 4M7DC 1WNLA 3EG0A 3RKYA 3VS5A 2Y4XA 2EQKA 2QA4A 1TUGB 1MMDA 1ZHIA 2WSFE 4OP0A 3I56Q 1PNJA 5GAOn 1M1GA 2QGGA 2CP2A 2KXDA 1OV3A 4BI3A 4PJOD 1G3TA 1XNIA 4ME7A 3QG1A 2XDDA 3EGXB 4C8QG 2HQHA 3CMAQ 4BD3A 1JU5C 2C0TA 3VUZA 2YUQA 1P92A 1VYTA 3E2UA 2MWPA 2CT3A 3OYJA 3QYHB 2M51A 1X6BA 1SRLA 2V8IA 2IPOB 3RR6A 2L5QA 1Q86C 2ROTA 4DBQA 1UJYA 2RH2A 4EMKB 2CGHA 1VQMQ 1BCOA 2DL4A 2OTJA 3EG3A 2CP6A 5IHNA 2X4WA 2EYXA 1UG1A 1YCYA 1BK2A 3BW1A 4FW2A 2DIQA 3CCJQ 2B86A 1QVFS 3G6EA 2HCKA 4GLKA 5IXBA 1SPKA 3X25B 3VU3C 1O75A 2FEIA 3CMEA 3FLGA 4HCZA 3QWXX 2E10A 2DD4A 4IUUA 4E47A 2DXCA 3RMQA 1K9MU 2GTOA 1NYFA 3HL8A 3CC7A 1AOJA 2HKQB 5EG2A 2KYMA 1O9SA 2NUPB 3OSVA 1WYXA 2SEMA 3EHRA 4RUGA 4C8QA 1KK7A 2KGTA 4C8QF 1M1KU 1SKUB 5LJ5d 1MV3A 4M75B 3QXEB 1TTHB 1WA7A 2BZYA 4ESRA 1VQKQ 2O88A 1WXBA 4A53A 2DIGA 4FT2A 3JCMf 1PWTA 3CC4T 4KRTA 5A2QE 1IHVA 2RHYA 1LCKA 2JTEA 1JJ2S 1VYUA 1WHMA 1LVKA 1UHCA 2RD1A 4IUVA 2EIFA 2QTVA 1X01A 1Y0MA 3JCMP 3A8GB 4L6V5 5FU7C 1K8AC 5EC7A 3CC2T 3OYYA 4C8QC 5HK3A 2E64A 2OTLQ 2XKOC 1Q81R 1N9RA 2FZCB 3JCMd 1VQNT 3JCMb 1IREB 2DEQA 1AVZC 1X75C 4PJOE 4M77E 2ED1A 2F2WA 1M8VA 2L3RA 4IURA 1W1FA 2CP7A 1NEBA 2PU9B 4FYVB 4KGXB 4ANJA 3PE0A 2KQWA 1WHKA 3QZ9B 4WTOB 1X2QA 2RA2A 5KYNA 1BI3A 4M78D 2XD0A 1VQ5T 5KYUB 3TSZA 5M9OA 2A36A 4KGVB 3GNGA 2GTJA 2EYYA 3VYGA 2KT8A 3CCQA 1XJWB 3RDVA 3REAB 3G4ST 2HQEA 2KR3A 3PMIA 3VRZA 2EW3A 1YIJQ 2EGAA 2DILA 2K7AA 3VS1A 1M3CA 1WXUA 4C92B 2IIMA 2DYIA 2RHZA 3VS7A 4QVCA 4XTWA 4M7AB 2DJZA 2M02A 3OW2S 3MCAB 1BI2A 4Z02A 1KHCA 2K4YA 4KGZB 2F5KA 2DZCA 3OBYA 4E7JA 1SHGA 1G5VA 4FM4B 4BE0A 5FRMA 1KIKA 2CH4W 4QQGA 1S72A 1E6GA 3H9NA 2HL5C 5DM7R 2GF7A 4QVZA 1VOMA 3G6ET 1D1AA 1YP5A 3ZBDA 3EFSA 1VUBA 3JV3A 2GFAA 1G3YA 2F2XA 2DM1A 1A0NB 3EGXA 1QMCA 2K3XA 4C0ZA 2DERA 2I2LA 5IHKA 3BY7A 3V7SA 3I5RA 2X35A 2PVGB 4M75G 2FO0A 2KROA 3MEAA 5IN1A 4BDYA 2LDMA 1NEGA 3NHNA 4XU3A 2K57A 5GMKl 1NE8A 2K3BA 1YITT 2JOYA 1K73C 1B07A 1WXTA 2DTOA 1X69A 4EMKA 2QXFA 1G8XA 2HSEB 1QP3A 3H0IA 3EGDA 1YI2A 2JN0A 1VQOA 1OZ3A 3WVEB 3RERA 1AZGB 4DBRA 4N0AA 1SRMA 2A28A 3DB3A 2IVWA 4X34A 1N8RU 1LPLA 1QCFA 2KDSA 1RAGB 5LJ5e 3OYNA 1Y96B 2EPDA 1NG2A 1OX8A 3EGUA 3UF4A 2VXEA 1RAFB 3BDLA 4M78E 4ZNXA 3HP9A 5J39A 4Y28E 2QAZA 3CBOA 4M7DB 1ZX6A 1H92A 1U3OA 3OYIA 2LTOA 5IT9E 3QSUA 5D6WA 4M75A 2RJDA 2RJFA 5ECAA 4YTLA 3INZA 2K5LA 1MNEA 2KYBA 1ACMB 2H8HA 1Q82U 3CC4Q 1BBZA 2D8JA 3GNFB 4OMQA 1H641 2E41A 1W2BA 1VQLA 1FYNA 4BY6C 1Z9QA 2R58A 4A4KA 3THKA 3CC2Q 2HSPA 2EKOA 5GAN4 4JZ4A 1Y7XA 1VQNQ 1LOJA 1M1FA 3SWNC 4PLLA 2AZSA 1AWXA 2RQUA 2XICA 1UTIA 2RQTA 1M3BA 3LYIA 1SEMA 1JO8A 2M0YA 4JJNK 2DVJA 3DB4A 2NUZA 4GBQA 2L2PA 2EGCA 2ZPBB 2M9UA 3EG2A 3A1PA 5LJ5h 2MF2A 1MUZA 1KC8U 1SF9A 1XOVA 2QQ9A 1WZOA 1RAEB 1FMKA 4KH0B 5KYUA 4E6RA 2FRYA 2EVRA 2LQKA 1WHGA 4JZ3A 1R77A 3G4SQ 4IUQA 2YLCA 2CZ7B 2ZPEB 2J6OA 5A0DA 3CCVA 3CQTA 1B7TA 2BKDN 1VA7A 2AKKA 4F04B 4C92D 1VQ4T 5LJ3g 1CKBA 2G3RA 2EQIA 4M7AD 1NYGA 3PMTA 1KQ1A 3RKWA 1GBRA 2EQUA 1YHQA 3FC3A 1YNZA 2WSEE 3OYMA 1NJIU 5GANg 4RTXA 4D8KA 1K9MR 3S3OA 3D7SB 3MP1A 3G6EQ 4WF2A 4QVDA 5HCKA 4Z89A 3CMEQ 5IAYA 2ZPHB 1OZ2A 2EQMA 5FU7B 1M1KR 1M90U 4C8QB 2Y4YA 4IKFA 2AK5A 3V7RA 3CPWP 1OX9A 2BE7D 2WSCE 4DQ2A 4IIOA 1GCPA 1OQKA 2IG0A 1QVGP 1YN8A 5DLQE 1R0BG 2A08A 5GMKe 4IUPA 1YITQ 1M2OA 3H0FA 1VQKT 3NMZC 4FL6A 4D6WA 4XU2A 1RADB 4ZTJA 2QK0A 2RI5A 1FXXA 4IUTA 1VQ9T 2LQ8A 4PJNA 2P0QA 3TU4K 4N4GA 3HHTB 4A63B 2ZCFB 1F1BB 2VWFA 1VQLT 3OMGA 3OMCA 3HRTA 1X27A 4OMLA 3A8OB 2VXFA 4NL3A 1HXDA 2OTLT 1QVFA 1AZEA 3ER0A 1Q86U 5CQYA 1EX4A 1Y96A 1HSQA 1ZBJA 4LNPA 4RTWA 1I5LA 1V76A 4B9XA 3JB9D 1VQ6A 5GAN6 2K3YA 3O8VA 3HPWA 4M7DA 4AMCA 1JQQA 1AT1B 2JTFA 3C95A 1OEBA 4NL2A 2O2OA 4DOVA 5LJ3j 1ZSGA 4II1A 4HVWA 4C5HA 2RMOA 2X9HA 5J26A 1SG5A 3LH5A 4OGCA 1TXQA 1C1AA 5GANj 2ATCB 4M77G 3CCRA 4F14A 3CPFA 4A4EA 3J7AF 3QDRB 2EJ9A 3R6OA 1JJ2A 2L8DA 2CUBA 1PRLC 2E3HA 4BE1A 2HD0A 4B9WA 3MJXA 1RAIB 1AEYA 2RPNA 1I1JA 2D8HA 4WCIA 5CO7A 5DLOA 3ME9A 2EWNA 4MZMA 1D09B 2QQAA 3E9FA 5FLXE 2E65A 2H3JA 2XMFA 3HSBA 4FYYB 3QYGB 3OYCA 2DLPA 2ENMA 1YJ9A 5GAOm 1UE9A 1YCSB 1K8AU 3CCEA 4RG2A 4BACA 1ZBXA 1WQ7A 4C5IA 1I4K1 3PFSA 2KMTA 1RLQC 2LNVA 2AZVA 1VQ4Q 1RI9A 2MOXA 2HAXA 1N9SA 1JXMA 4MZTA 1X43A 3CCUA 4X9DA 4PJOF 3U23A 4M77F 2K2MA 3HKSA 2KT1A 3JCMg 4K11A 1BU1A 3F70A 4QKUA 4EPCA 3EGDB 1G83A 3KUFA 3TEEA 2GCXA 2XI9A 3GIBA 3CD6A 5GAMg 2VUBA 4Y92A 1G3SA 1GCQA 5LJ5f 1N8RR 1WJRA 4ZN1A 1C6VX 1TG0A 1YBYA 3X28B 1BCMA 4PFZA 4BY6B 3PIPA 1TOVA 3G71A 3V8KA 3OW2A 1IXDA 2FPDA 1H3HA 2P4RA 4C8QD 2LMJA 2LT1A 1WLPB 2DL3A 2RQRA 3JB9H 2ECZA 3SWNB 4HKEA 4RCBA 4O6JA 1WPYA 4M77C 4PJOC 3OSSC 3M56A 2CSQA 5CKEA 3MHXA 2JUFA 1Q82R 2HDAA 2AKLA 1PSEA 3A8LB 5FW9A 1PG5B 1AWOA 1YJWA 1NBEB 1UUEA 4J9EA 3RUXA 3L1AA 4LDUA 1W4SA 1ARKA 1GCQC 1N27A 1B34B 2X51A 4XTXA 1EFNA 2EBPA 2QEXT 1VQ9Q 3OS0A 3M0PA 2KI7A 4A4GA 3I55A 2EYQA 2L0AA 3M59A 4AFQC 4LUDA 4X9CA 4JDSA 3EH2A 1YJNT 4F7UG 5GAN8 3LWHA 1VQLQ 4RKUE 1KJWA 1TWBA 2QI2A 4OB1B 4MDWA 2RQVA 2EYWA 1VQPA 1IHWA 1S1NA 2CDTA 4J9GA 3CXCP 2KE9A 2XIDA 3SEMA 2C0OA 5IH2A 4KT0E 1U1TA 4XU1A 1VQ7A 5I2SA 1K73U 3L2ZA 5GJWB 2JZ2A 1KC8R 4BI8B 2EKHA 3VV0A 2J7IA 1H8KA 4OMOA 4F16A 2QA4T 1ABOA 3OY9A 3CCLA 1U1SA 2GBQA 3GLXA 4JS4A 2A0FB 1TUCA 1WX6A 2KRSA 4C0DC 2FVUA 3OB9A 4P5NA 3FIFA 3CCSA 2ZPGB 4GY5A 1UGPB 3X24B 5D6YA 2X4JA 4PJJA 3RMSA 2CP3A 1FWZA 5DY9A 3CCMA 2KBTA 2DNUA 1WHJA 5GAMj 3JCMX 2DTHA 2LX9A 4F7UA 4BDZA 5AYFA 2JVVA 4F7UF 1JB0E 1NJIR 2EYZA 2HBWA 1K9MC 2L3QA 3X20B 1WJSA 2FYKA 3JAME 3QUIA 2LCSA 5GMKi 4FIBA 2OTJT 2YXYA 4C8QE 1VIEA 2DAQA 1IGQA 1GBQA 2PUKB 1OYXA 3HRUA 3NTIA 1M1KC 5KE3A 3I56A 3DLLA 4OGEA 3META 2GFUA 3CMET 4AFSC 4QW2A 1UB4A 2DZ9A 4IIMA 4TVRA 4MZPA 3X26B 5FWBA 2YRVA 4QT7A 4F17A 3CC7T 3CMAA 1QWEA 2K5FA 4BB7A 2QTXA 3MEWA 4JJCA 3MP8A 3FB9A 2O31A 2PUOB 3VUBA 4E7IA 2H3EB 2DL8A 3M54A 2FL7A 2RJCA 3KBGA 2QDLA 3LX7A 5GAN7 3P8BB 1VQMA 3QPHA 2EJGA 2M16A 3G7ZA 3N5BB 4E7HA 2K9GA 2DYBA 2LC4A 4BE2A 2QG9B 3CCJA 1ZQ1A 4AG1C 3NTKA 3QDFA 3E1SA 1Q86R 4RCCA 2LJ3A 4J7IA 4E7LA 3HTRA 2J06A 2MWOA 4L59A 2XDBA 1ZUUA 2PNIA 4OMPA 1UDLA 2JJ9A 1WDXA 1KD1C 3OYEA 3OYHA 4XTZA 3GOXA 3QJ6A 1YWPA 3SWNA 4M75D 2EJFA 5CKFA 2RM4A 2MYSA 1KG1A 1IO6A 2OX7A 3E19A 1AWWA 1QWFA 2RI2A 4JPBW 2R5AA 3OYBA 2CP5A 1FX7A 2RI3A 3M57A 3RESA 4J9HA 3PVLA 1EIFA 4GLMA 2QEXQ 2MPXC 3LGFA 2DA9A 2GQIA 2PVOB 3QBYA 3M4YA 1B34A 3PIOA 3CCLT 1I81A 1YJNQ 4FYXB 1KHIA 3KXTA 3EFRA 2HNIA 4J9DA 2ZAEA 3CCQT 2KK4A 1UHFA 4HT9A 1SHFA 3ZFJA 2L3SA 1QW1A 3UA7A 1T0JA 1OOTA 3FJ5A 3MEUA 4C5EA 2RHUA 3H6ZA 3QO3A 1ZUKA 1UECA 4OB2B 1UGVA 5KYXA 4JUVA 3JCMc 1VQ8A 2RJEA 5I21A 1I8FA 2QA4Q 1MNDA 1U8RA 3S3MA 3OS5A 1M9SA 4E2FB 2E1HA 3SD4A 4HCBA 2FPFA 1FMVA 4OMNA 3HFNA 3V7CA 1S72T 1ZA1B 3H8ZA 2V26A 2QDYB 2VYTA 4OMFB 1UGSB 1Q7YU 5GAN5 2CZ1B 4N4IA 3OS1A 4D8DA 3A8HB 2GNCA 3JCMW 4PJOB 4M77B 4OB3B 3TVTA 3L2UA 3NGPA 3QWYA 1FMWA 3OYGA 2C0IA 1BI1A 4JRIA 1YIJA 4L5GA 2JW4A 5I2MA 1N8RC 2YDLA 4ORZA 2OTJQ 3CEYA 2CUDA 2ZGWA 5GAOl 2NLUA 3J80E 2LT4A 4ZGEB 1ZSZC 1VIFA 2E6NA 1D1CA 2LCCA 4JRPA 1ZUYA 2O9SA 1QLYA 3M0UA 3CD6Q 4PJLA 2EQJA 4M75E 2HZYA 3JCMJ 1YI2T 1VQOT 2DBMA 2X4XA 2OAUA 4RTVA 2RB6A 4Q5WA 1D0YA 1MGQA 1TUDA 1M2VB 1NPRA 1KQSP 4PL6A 1BB9A 2PTKA 1Q82C 1RLPC 3CPWS 1IRXA 3CC7Q 1UGQB 3SDZA 2SRCA 1QVGS 1NLOC 3AT1B 3CBPA 4ZN3A 5FRNA 1K9AA 4HXJA 1U5SA 2VV5A 1X2KA 3JB9G 1K0XA 1OI1A 1W2BP 1BYMA 3MKDA 4KULA 4RG8A 3ZL7C 1OPKA 2ROLA 3L2RA 1R8OB 3I35A 2O4XB 4C0DB 4DOWA 4J6WA 2DKGA 2L89A 4DEXA 5L23A 1NZ9A 1PKTA 1Q81C 2KAFA 4LD9K 3Q1JA 3EG9B 4DBHA 2COYA 1IZ6A 2MAMA 3P8HA 2YUNA 2O9VA 1K4US 2V1QA 3H41A 1K73R 2V1RA 3JSCA 3EH1A 1AWJA 1KC8C 4M7DD 1TSFA 2ED0A 3C4SA 2CSIA 4KH1B 5LL6S 3GPLA 5CAIA 3S3NA 4LD6A 5GAOr 2NYSA 4JRQA 2QQSA 2J6KA 4Z8AA 4C92E 1U06A 1JBMA 3CCLQ 2FG0A 4JJBA 3LGLA 2K2VA 5KYWB 4RTTA 4M7AE 4J9BA 3E9GA 3CC4A 3MPUB 3VS4A 3JB9F 4F7UB 3CCQQ 4PJOG 2CKKA 1N5ZA 2V8JA 7AT1B 2JM8A 3CCMQ 1X6GA 2RHXA 2DF6A 1MV0B 2OAWA 3CCVT 5GAN2 1DJ7B 3CC2A 3HFOA 4XTUA 3JRZA 2A7YA 1YFNA 1TH7A 2DTIA 1UEBA 2FZGB 3SFMA 4M4ZA 2YHTA 3UWNA 1PKSA 5LJ5g 4NOYA 3DKMA 1V1CA 3UA6A 2HMAA 5CKBA 2D0NA 5CIUA 1PC0A 2BTTA 1YHQT 2LQWA 3QZ5B 1T3LA 1NPPA 1V29B 4PK4A 1RI0A 1S72Q 5CQXA 2E5QA 1WHHA 1K1ZA 5HKCA 2J05A 2P0PA 2KRMA 1VQ5A 4J9FA 2X3WD 3PT9A 2DD5A 2ZPFB 1R0CB 2DE0X 4XQ3A 4JLGA 2QGFB 1UFFA 4M77D 2Y90A 3UDCA 3G4SA 1TU0B 4QQDA 4A4HA 2DBKA 4E7ZA 2VASA 2DL7A 2EAYA 3DLMA 2E70A 4PJOA 4M77A 2FB7A 5KCOA 4AFZC 1WGSA 5KH6A 2KEAA 2C06A 2RHIA 2VVKA 2W10A 4DEYA 1RUWA 1D3BB 2CZ6B 3UPUA 4RTZA 2DO3A 3OA6A 2VGNA 4HT8A 4O5VA 3L2WA 2LX7A 1YI2Q 4M7DE 1VQOQ 2ESWA 2JNGA 3OQ5A 2EGEA 2WACA 2DFUA 1JXOA 1QVFP 3UATA 1SSFA 5GAN3 2P0KA 2RK1A 1K76A 2LRQA 2DRMA 5A0LA 2DX1A 5FROA 1M2VA 2F1LA 3OS2A 4R55A 2YRCA 1VYVA 5CVIA 3M0RA 5CCAA 4KUDK 1RABB 2RF0A 4C0GA 3BDUA 1XQHA 3P8DA 2K6DA 4OVAA 1VQ6T 3JB9I 4MMKA 4LDVA 5CKHA 1YITA 2DL5A 4FW1A 4DA4A 2CP0A 2E5KA 1IB8A 2O4XA 5LJ5j 4M78G 2OI3A 2PVDB 3M0SA 1XTDA 4A54A 1WJQA 1JJ2P 3OYLA 3EG9A 2PZ1A 2F2VA 2LJ0A 3CXCS 4FCYA 3VRYA 2BZXA 2EFIA 1Z9ZA 3M5AA 3M58A 4PKCC 2G6FX 2Z0WA 3CCRT 2COZA 5LJ3e 5KYXB 4E7SA 5GAMf 4J6YA 5I11A 1UGRB 3M55A 4Y91A 5KYYB 3M9QA 1QP2A 5FU6C 4B6MA 4FSSA 4J8OA 5GANe 2M0OA 1ZSZB 4LE9A 1VQ8Q 3RBBB 2LCLA 2FHDA 3EAEA 3EFOB 1Q7YR 4J9CA 3VS2A 4KUIA 4LDXA 1M30A 1OULA 3NTHA 5IXFA 4EMGA 5GAMd 4FU6A 1TS9A 1T0HA 4RTUA 2ABLA 1YJ9T 4NS5A 5KYWA 3CCET 2DRKA 1KD1U 3GP8A 2OJ2A 2BE9B 3VKIA 3CCVQ 4M78A 4HVVA 4M78F 1JEGA 2LVMA 3M4GA 3J81E 4XTYA 2HQXA 4PNOA 1PD0A 3LH0A 3CCUT 2AIRB 2XDPA 2JMCA 2D9TA 4FT4A 2JM9A 3TSWA 3C0CA 4PFPA 1YHQQ 1NM7A 1HJDA 2HL3A 5FWCA 3V8LA 2L3PA 3NPFA 1M90R 3R6NA 5GAOq 4QQ6A 4KBMB 3OW2P 3CD6T 5LJ3h 4J7FA 2M1HA 4MDXA 2FPEA 2W0ZA 1D0ZA 2JTMA 2LQNA 3CBMA 2A3LA 4CRIA 4N4HA 1M27C 4M78C 2YUPA 2RK2A 3RIRA 1BI0A 1PD1A 3G71T 2DXTA 1BKBA 5GANh 4C5GA 3FDRA 4V2SA 3G1JA 2R57A 1WFWA 2YLBA 2JS2A 2I0NA 3S6WA 1QQJA 3RKXA 2LJ1A 2CT4A 2P84A 4LUEA 1AD5A 2R5MA 2VGMA 4ZTFA 4CI0C 1VQ4A 2D0QB 2JS0A 2ZZDA 5D7UA 4FSXA 2GQVA 1YJWT 2XU8A 3EHQA 3OYFA 1D3BA 3MO8A 3PVQA 2MCNA 1MHNA 4HA8A 4EDUA 1D1BA 3OYKA 3OYDA 1CSKA 3M53A 2HBPA 3I55T 5KCHA 8AT1B 2E3IA 2DVEA 3VS6A 2XHCA 2VC8A 2ZPIB 2V8KA 1QCNA 5GMKj 2F5TX 4R56A 1GFDA 2RN8A 1VQPT 2AHJB 3T9NA 3I5SA 1QKWA 3A8MB 5HK0A 4DBFA 1NLPC 2NUTB 2DPPB 1M3AA 1VQ7T 4ZGJB 1VQ6Q 4ZGDB 4VUBA 4CC2A 4F7UE 1JRIA 1I07A 1KQSA 4LXCA 5A0GA 2K79A 2NUPA 2YT6A 4X1VA 1Y57A 3CPWA 2X4YA 3JCMV 1HD3A 5AT1B 1J3TA 1VQKA 1WI7A 4EMKC 3TREA 4J6XA 1QVGA 3FJPA 3BE3A 1WQWA 1AHJB 2YUOA 2E4HA 4HCCA 4M75F 1ABQA 2LNHB 2HKNA 3GF5A 1VQ9A 3CCST 3L2QA 3LWIA 2F69A 1GL5A 2O01E 1PCXA 2J6FA 4N0AC 1ZA2B 3CCMT 3CCRQ 2MIOA 1KSWA 3IQLA 4J9IA 1PHTA 2OTLA 3JCMe 1KFZA 1M8MA 2MMPA 4AG2C 4C92G 2VB6A 1T3SA 2NWMA 9ATCB 3EG1A 1MMAA 2JMAA 3V8JA 3WXMB 3JCMQ 4JLIA 2DK3A 3ZEHA 5KYYA 4M7AG 4EMHA 3C12A 1K8AR 4CC3A 4ELYC 3O5ZA 5GAMe 3MEVA 2D1XA 1Q95G 4M75C 1Q81U 1ZSZA 1IGUA 3QJYA 1W70A 1I5OB 3EFOA 1N6AA 1MMGA 2KVQG 3VJPA 3L2VA 3I56T 1K0SA 1YJ9Q 2QASA 2A37A 2RQWA 3A5ZB 3CCEQ 4FYWB 4PFOA 1VQ5Q 2LP5A 4OMMA 4ELZC 3QHSA 2CZ0B 2KXCA 4BI4A 4LDWA 1OU9A 5CR2A 1HYOA 4JS5A 3JB9J 1M5Q1 5C0MA 4OB0B 2CS7A 2CH4A 3CMAT 3CCUQ 2DMOA 2YRDA 2MK5A 4RTYA 4PLIA 3LLRA 2RO0A 5KE2A 1BIBA 4MMLA 4UC4A 5I22A 3RNJA 2YWWA 4PJMA
chains in the Genus database with same CATH topology
5J3BA 3JRZA 2QI2A 4OB1B 2A7YA 2DTIA 1TH7A 4MDWA 1HK9A 1UEBA 3SFMA 1Y71A 1YI2A 4C92A 2JN0A 5HY6A 1VQMT 1VQOA 2XK0A 4C92F 1OZ3A 3WVEB 1VQPA 2YHTA 3UWNA 3RERA 5LJ5g 4NOYA 2XIDA 3DKMA 2MI6A 4J83A 5CKBA 4M7AA 2P4TA 5CIUA 4KT0E 4M7AF 2CYZB 4E7KA 4N0AA 1LNXA 3JCMh 1U1TA 4XU1A 3LWHA 1VQ7A 3DB3A 4JRKA 5I2SA 3CCJT 1G3WA 2IVWA 4X34A 1YHQT 1K73U 3QZ5B 1N8RU 5GMKm 5L8RE 2KDSA 1KQSS 3L2ZA 1NPPA 1V29B 1RI0A 5LJ5e 2JZ2A 1Y96B 3OYNA 1JJ2A 5CQXA 2E5QA 4BI8B 2D6FA 3VV0A 2VXEA 3BDLA 4M78E 5HKCA 2P0PA 1VQ5A 3HP9A 5J39A 5GAMh 4Y28E 2QA4T 3QIIA 3PT9A 3CBOA 3OY9A 3CCLA 4M7DB 2QQRA 2DD5A 1X6OA 2ZPFB 1U1SA 3GLXA 4JS4A 4J5YA 3OYIA 2LTOA 4XQ3A 2DXUA 5IT9E 4JLGA 4C0DC 3QSUA 2E12A 2FVUA 3OB9A 4P5NA 3FIFA 5D6WA 4M75A 2KSSA 5FU6B 4BUGA 2RJDA 4M77D 3CCSA 4M7DG 2RJFA 2Y90A 3UDCA 4YTLA 2ZPGB 3INZA 2K5LA 3G4SA 4GY5A 4QQDA 4A4HA 3URGA 4C92C 1UGPB 3FEOA 2EAYA 3DLMA 5D6YA 3L42A 3X24B 2E70A 5CKDA 4PJOA 1Q82U 2X4JA 4M77A 2FB7A 3GNFB 3RMSA 5KCOA 1FWZA 5DY9A 3CCMA 1H641 4M7AC 1WGSA 5KH6A 2E41A 5GAMj 1W2BA 3JCMX 2DTHA 2LX9A 3OYAA 1VQLA 2RHIA 2C06A 4F7UA 4BDZA 3PNWC 5AYFA 1D3BB 2JVVA 4F7UF 5LJ3f 2CZ6B 3UPUA 4BY6C 3NFCA 2R58A 2DO3A 3OA6A 1JB0E 4A4KA 4OF1A 1H3ZA 2VGNA 4HT8A 1LJOA 2EKOA 1K9MC 4XAXB 3X20B 1RL2A 5GAN4 1Y7XA 1WJSA 2FYKA 4O5VA 3L2WA 4M7DE 3JAME 1LOJA 3C94A 3QUIA 1M1FA 5GANf 2JNGA 3OQ5A 2KY9A 3SWNC 5GMKi 4FIBA 4PLLA 2OTJT 5D6XA 4C8QE 2WACA 1VIEA 2DAQA 3PGGA 1SSFA 1GXIE 2PUKB 5GAN3 2P0KA 1OYXA 3VYHB 2RK1A 2XICA 2B8AA 3HRUA 3NTIA 5LJ3d 5C6SA 1M1KC 2LRQA 5A0LA 1Q7YC 2K5IA 5FROA 5KE3A 3LYIA 3I56A 3DLLA 4OGEA 3META 3OS2A 4R55A 3PTAA 4JJNK 2GFUA 3DB4A 3CMET 5CVIA 1VQ8T 2E6ZA 3LW5E 2ZPBB 4QW2A 3TCJA 5CCAA 3BFMA 2M9UA 1UB4A 2DZ9A 4KUDK 5LJ5h 5GANd 4C0GA 3BDUA 2MF2A 1XQHA 3P8DA 4TVRA 4OVAA 3HRSA 4MZPA 1XOVA 2QQ9A 3X26B 1KC8U 1VQ6T 2YRVA 3ASKA 4XK8E 3CC7T 4M7DF 3JB9I 3CMAA 4C0FA 4MMKA 2QEXA 2K5FA 4LDVA 1QVPA 1M4ZA 2LQKA 5CKHA 2QTXA 4BB7A 1YITA 5GAOp 3MEWA 4IUQA 2YLCA 4M78B 2CZ7B 3MP8A 3FB9A 1NJIC 2PQWA 2ZPEB 5A0DA 4DA4A 1YJNA 3CCVA 2PUOB 3MP6A 3VUBA 4E7IA 4XTVA 3SB2A 2QQBA 2BKDN 3M54A 4RKUE 2FL7A 2O4XA 2RJCA 3KBGA 3WVDB 1KQ2A 5LJ5j 4M78G 3LX7A 3QKJA 4C92D 5GAN7 3P8BB 1VQ4T 2XG8D 2PVDB 1VQMA 2DXBA 5LJ3g 2G3RA 2BIVA 3QPHA 3UT1A 2EJGA 3FRNA 5GMKh 1XTDA 2M16A 3G7ZA 3N5BB 4A54A 3OBWA 4E7HA 1VQNA 1BIAA 4M7AD 1WJQA 4RMOA 4LDYA 3OYLA 3PMTA 4ATOA 5CK9A 1M90C 1KQ1A 2LC4A 3CXCS 4BE2A 3RKWA 1YIJT 3AHUA 3CCJA 2EQUA 2EFIA 1ZQ1A 3M5AA 4PKCC 3M58A 1YHQA 3NTKA 3FC3A 3CCRT 2WSEE 3E1SA 1Y07A 5LJ3e 5GANg 3OYMA 1NJIU 4RCCA 2BUDA 4A4FA 4J7IA 4XU0A 4E7LA 3CXCA 5GAMf 4M7DC 1PSFA 2MWOA 4J6YA 4L59A 1WNLA 2XDBA 3S3OA 1UGRB 3M55A 3MP1A 4Y91A 3RKYA 3M9QA 1QP2A 2Y4XA 2EQKA 2QA4A 4WF2A 4QVDA 5FU6C 1KD1C 4J8OA 1ZHIA 2WSFE 4OP0A 5GANe 4XTZA 3OYEA 3OYHA 2M0OA 5IAYA 2ZPHB 3GOXA 1OZ2A 3QJ6A 2LCLA 2EQMA 2FHDA 5FU7B 3EAEA 3SWNA 4M75D 5GAOn 2EJFA 1M1GA 5CKFA 1M90U 2RM4A 4C8QB 2Y4YA 4IKFA 1KG1A 4KUIA 3E19A 4LDXA 3V7RA 4BI3A 3NTHA 4PJOD 2RI2A 4EMGA 2R5AA 3OYBA 1G3TA 5GAMd 1XNIA 2WSCE 4FU6A 4ME7A 4DQ2A 1FX7A 3QG1A 2XDDA 2RI3A 3M57A 3RESA 4C8QG 2IG0A 5DLQE 4BD3A 1EIFA 1YJ9T 4NS5A 3LGFA 5GMKe 3CCET 4IUPA 3VUZA 1KD1U 2PVOB 1P92A 3QBYA 3M4YA 1B34A 3GP8A 2MWPA 3PIOA 3OYJA 3CCLT 1I81A 3QYHB 3VKIA 4M78A 1VQKT 4FL6A 4M78F 4D6WA 1KHIA 2V8IA 2LVMA 3M4GA 2L5QA 4XU2A 1Q86C 3KXTA 3EFRA 3J81E 4XTYA 2RH2A 2HNIA 4ZTJA 2HQXA 4EMKB 2CGHA 3CCQT 2KK4A 4HT9A 2RI5A 1FXXA 3ZFJA 4PNOA 3LH0A 4IUTA 1QW1A 1VQ9T 3CCUT 2LQ8A 2OTJA 2XDPA 2X4WA 2D9TA 4FT4A 2P0QA 3TU4K 4N4GA 1YCYA 3HHTB 3MEUA 4C5EA 2ZCFB 3BW1A 2RHUA 2DIQA 3H6ZA 3QO3A 1VQLT 1QVFS 3OMGA 3V8LA 3G6EA 3OMCA 3HRTA 4OB2B 4GLKA 3X25B 3VU3C 5GAOq 1O75A 3A8OB 2VXFA 4QQ6A 4NL3A 4KBMB 1HXDA 3FLGA 3CMEA 4HCZA 4JUVA 3JCMc 2OTLT 1QVFA 1VQ8A 3CD6T 2RJEA 5I21A 5LJ3h 2E10A 4J7FA 2DD4A 2M1HA 1I8FA 3ER0A 4IUUA 1Q86U 4MDXA 3CBMA 2JTMA 4CRIA 4E47A 2A3LA 5CQYA 2DXCA 3RMQA 4N4HA 1Y96A 1K9MU 1U8RA 3S3MA 3OS5A 1M9SA 1I5LA 4B9XA 2E1HA 3SD4A 3JB9D 3HL8A 4HCBA 1VQ6A 4M78C 3CC7A 2RK2A 3RIRA 1BI0A 5GAN6 5EG2A 3G71T 2K3YA 3O8VA 1O9SA 3HPWA 2DXTA 4M7DA 3V7CA 1BKBA 3HFNA 3OSVA 4C5GA 3FDRA 5GANh 1S72T 3H8ZA 4V2SA 3I55T 2R57A 2QDYB 2VYTA 4C8QA 2YLBA 4OMFB 4C8QF 2JTFA 3C95A 3S6WA 1UGSB 1W2BS 1M1KU 4NL2A 5LJ5d 1Q7YU 3RKXA 5GAN5 2CZ1B 4DOVA 4N4IA 4M75B 5LJ3j 3QXEB 4II1A 3OS1A 2R5MA 2VGMA 4C5HA 4ZTFA 3A8HB 4CI0C 2D0QB 3JCMW 1VQ4A 4PJOB 2ZZDA 4M77B 4OB3B 5J26A 3L2UA 4FSXA 4OGCA 2GQVA 4A53A 1YJWT 2DIGA 4FT2A 3OYGA 2XU8A 1BI1A 3JCMf 5GANj 3OYFA 1D3BA 3MO8A 4JRIA 3CC4T 1YIJA 5A2QE 1MHNA 4M77G 2RHYA 4HA8A 4L5GA 1JJ2S 4EDUA 3CCRA 3CPFA 5I2MA 2RD1A 4IUVA 4A4EA 3OYKA 3OYDA 3QDRB 1N8RC 3J7AF 2EIFA 3CEYA 3M53A 2EJ9A 1X01A 2HBPA 2L8DA 3R6OA 2ZGWA 5KCHA 5GAOl 3A8GB 2NLUA 3J80E 3JCMP 2LT4A 4ZGEB 2DVEA 2XHCA 1VIFA 2E6NA 4L6V5 2LCCA 2VC8A 2HD0A 5FU7C 4JRPA 4BE1A 1K8AC 3CC2T 3OYYA 2ZPIB 4B9WA 4C8QC 5HK3A 2V8KA 2E64A 2XKOC 1N9RA 2F5TX 5GMKj 4R56A 2EQJA 3JCMd 1VQNT 4M75E 1YI2T 3JCMJ 5CO7A 1VQOT 3JCMb 5DLOA 1IREB 2X4XA 1VQPT 2DEQA 3ME9A 2OAUA 2AHJB 2EWNA 3T9NA 2RB6A 4MZMA 4Q5WA 2QQAA 3A8MB 1MGQA 3E9FA 1X75C 5FLXE 5HK0A 4PJOE 1NPRA 2E65A 4M77E 2H3JA 3HSBA 1M8VA 2DPPB 2L3RA 4PL6A 1VQ7T 4ZGJB 4IURA 3QYGB 1Q82C 4ZGDB 3OYCA 3CPWS 1UGQB 2PU9B 3SDZA 4VUBA 4F7UE 1YJ9A 1JRIA 5GAOm 1K8AU 3CCEA 4RG2A 2KQWA 3QZ9B 1QVGS 1KQSA 4BACA 2RA2A 5A0GA 3CPWA 1BI3A 1ZBXA 2X4YA 4M78D 2XD0A 3JCMV 1WQ7A 4C5IA 1VQ5T 1I4K1 3CBPA 3PFSA 1VQKA 4EMKC 4ZN3A 3TREA 2KMTA 4J6XA 1QVGA 3FJPA 5FRNA 5M9OA 1WQWA 1AHJB 3GNGA 2LNVA 4HCCA 2VV5A 4M75F 3VYGA 3CCQA 1N9SA 3JB9G 2HAXA 1OI1A 4MZTA 1BYMA 3GF5A 1VQ9A 4KULA 4RG8A 4X9DA 3L2QA 3L2RA 3CCST 1R8OB 3CCUA 3G4ST 2HQEA 2O4XB 4PJOF 4M77F 3HKSA 3PMIA 3JCMg 4C0DB 3LWIA 4DOWA 2F69A 4J6WA 2DKGA 2L89A 1NZ9A 2O01E 3F70A 4N0AC 3CCMT 1Q81C 4EPCA 4C92B 2KAFA 4LD9K 3Q1JA 2RHZA 3KUFA 3TEEA 2GCXA 2XI9A 4QVCA 1IZ6A 2MAMA 2OTLA 3P8HA 3JCMe 4XTWA 4M7AB 3CD6A 5GAMg 3GIBA 2VUBA 1G3SA 2DJZA 5LJ5f 3JSCA 2MMPA 1WJRA 4ZN1A 4C92G 3OW2S 1YBYA 3MCAB 1BI2A 4Z02A 1KHCA 2K4YA 3X28B 3PIPA 3V8JA 3WXMB 4BY6B 3JCMQ 4JLIA 2DK3A 2DZCA 2F5KA 3OBYA 3ZEHA 4E7JA 4EMHA 3C12A 1KC8C 4M7AG 1G5VA 4ELYC 4FM4B 3G71A 3V8KA 4BE0A 4M7DD 5FRMA 3OW2A 4QQGA 5GAMe 3MEVA 1S72A 4M75C 4C8QD 5DM7R 2LT1A 1Q81U 2GF7A 4QVZA 3JB9H 3C4SA 3QJYA 3G6ET 3SWNB 1N6AA 4HKEA 4O6JA 1WPYA 4M77C 4RCBA 5LL6S 4PJOC 3OSSC 3GPLA 3ZBDA 3EFSA 1VUBA 2KVQG 3VJPA 3L2VA 3I56T 2GFAA 5CAIA 3A5ZB 3S3NA 3M56A 1G3YA 4LD6A 5CKEA 5GAOr 3MHXA 2JUFA 2QQSA 4JRQA 4C92E 1PSEA 2K3XA 3A8LB 3QHSA 4C0ZA 4ELZC 1JBMA 2CZ0B 2I2LA 3BY7A 1YJWA 3LGLA 3V7SA 2K2VA 4BI4A 5GAN2 4LDWA 2X35A 2PVGB 4M75G 3RUXA 5CR2A 3L1AA 4M7AE 3E9GA 4LDUA 3CC4A 1W4SA 3MEAA 5IN1A 4BDYA 2LDMA 3JB9F 1N27A 4JS5A 1B34B 3JB9J 1M5Q1 4XTUA 4OB0B 2CS7A 5C0MA 4XTXA 4F7UB 3CMAT 4PJOG 2CKKA 4XU3A 2QEXT 2K57A 5GMKl 1NE8A 3OS0A 1YITT 2JOYA 4A4GA 4PLIA 3I55A 1K73C 2EYQA 3LLRA 2RO0A 2DTOA 2V8JA 3M59A 5KE2A 2RHXA 1BIBA 4EMKA 4X9CA 4JDSA 2QXFA 1YJNT 4MMLA 4UC4A 4F7UG 3CCVT 1QP3A 5GAN8 1DJ7B 3CC2A 3HFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OB1 B;  3QZ9 B;  3X26 B;  3HHT B;  2ZCF B;  4XK8 E;  3WVE B;  4OB2 B;  3X25 B;  4KT0 E;  1AHJ B;  2CYZ B;  3A8O B;  2CZ7 B;  2ZPE B;  3VYG A;  2PUO B;  3QZ5 B;  2DD4 A;  5L8R E;  1V29 B;  2DXC A;  3WVD B;  2PVD B;  2DXB A;  2O01 E;  4Y28 E;  2DD5 A;  2ZPF B;  2QDY B;  1UGS B;  2CZ1 B;  2WSE E;  3QXE B;  2ZPG B;  3X28 B;  1PSF A;  3X24 B;  1UGP B;  3A8H B;  2D0Q B;  1UGR B;  2ZZD A;  4OB3 B;  1QP2 A;  4FM4 B;  2WSF E;  2ZPH B;  2CZ6 B;  1JB0 E;  3A8G B;  3X20 B;  2WSC E;  4ZGE B;  1PSE A;  3A8L B;  4L6V 5;  2CZ0 B;  2ZPI B;  2PVG B;  2PVO B;  1GXI E;  2PUK B;  3VYH B;  1IRE B;  4OB0 B;  3QYH B;  2AHJ B;  3A8M B;  2DPP B;  4ZGJ B;  3QYG B;  4ZGD B;  3LW5 E;  2ZPB B;  1QP3 A;  1UGQ B;  1DJ7 B;  2PU9 B;  4RKU E; 
#chains in the Genus database with same CATH topology
 5J3B A;  1HK9 A;  5IHI A;  1Y71 A;  4C92 A;  5HY6 A;  8ATC B;  1VQM T;  2XK0 A;  4C92 F;  2COW A;  4AT1 B;  2MI6 A;  4J83 A;  4M7A A;  1PM3 A;  2P4T A;  2AT1 B;  1E6H A;  3H0H A;  2CYZ B;  4M7A F;  1RAA B;  4E7K A;  1LNX A;  4LN2 A;  3JCM h;  4JRK A;  3CCJ T;  3VS0 A;  1G3W A;  2KNB B;  1RAC B;  5L8R E;  3VS3 A;  5GMK m;  2FRW A;  3G71 Q;  1KQS S;  3TQ7 P;  3REB B;  1G2B A;  2D6F A;  1MMN A;  4R0K A;  4HVU A;  5GAM h;  1PRM C;  3QII A;  1RAH B;  2QQR A;  1X6O A;  4J5Y A;  2CRE A;  2DXU A;  2RNA A;  1I0C A;  2E12 A;  5FU6 B;  4BUG A;  2KSS A;  1D0X A;  4M7D G;  1OPL A;  1YJW Q;  3URG A;  4C92 C;  5CKD A;  3FEO A;  1W2B S;  3L42 A;  4M7A C;  3ULR B;  3OYA A;  2HEQ A;  2JXB A;  3PNW C;  3I55 Q;  2YSQ A;  5LJ3 f;  1QCO A;  3NFC A;  1E7O A;  4OF1 A;  1H3Z A;  3I9Q A;  1C0M A;  1LJO A;  1OU8 A;  4XAX B;  1RL2 A;  3C94 A;  5GAN f;  1VQP Q;  1WIE A;  2KY9 A;  4HCK A;  5D6X A;  3PGG A;  4CC4 B;  2KRN A;  1GXI E;  3VYH B;  1VQ7 Q;  6AT1 B;  2B8A A;  5LJ3 d;  5C6S A;  1CKA A;  1Q7Y C;  2K5I A;  3M0T A;  1GFC A;  2NUT A;  3PTA A;  1EZZ B;  2DEU A;  1VQ8 T;  4EIK A;  2E6Z A;  3LW5 E;  3TCJ A;  2FZK B;  3GBQ A;  3BFM A;  5GAN d;  1B3Q A;  1QKX A;  2DET A;  2BZ8 A;  3HRS A;  2VKN A;  3SHW A;  1KD1 R;  3ASK A;  1ZLM A;  4XK8 E;  4M7D F;  4C0F A;  2QEX A;  3M0Q A;  1QVP A;  1M4Z A;  3CCS Q;  3KFV A;  5GAO p;  4M78 B;  1NJI C;  2PQW A;  1UJ0 A;  4JJD A;  1YJN A;  5GJV B;  3MP6 A;  4XTV A;  2QYZ A;  3SB2 A;  2QQB A;  1YWO A;  3WVD B;  1KQ2 A;  2LZ6 B;  3QKJ A;  2XG8 D;  4CC7 A;  2DXB A;  4AFU C;  2BIV A;  1W6X A;  3UT1 A;  3FRN A;  5GMK h;  1SSH A;  1VQN A;  3OBW A;  1BIA A;  1WHL A;  4RMO A;  3A98 A;  4LDY A;  4ATO A;  5CK9 A;  2DJQ A;  1M90 C;  2GGR A;  1YIJ T;  3AHU A;  2JT4 A;  1Y07 A;  1GRI A;  2X3X D;  2BUD A;  4A4F A;  4XU0 A;  3CXC A;  4Z88 A;  1PSF A;  4M7D C;  1WNL A;  3EG0 A;  3RKY A;  3VS5 A;  2Y4X A;  2EQK A;  2QA4 A;  1TUG B;  1MMD A;  1ZHI A;  2WSF E;  4OP0 A;  3I56 Q;  1PNJ A;  5GAO n;  1M1G A;  2QGG A;  2CP2 A;  2KXD A;  1OV3 A;  4BI3 A;  4PJO D;  1G3T A;  1XNI A;  4ME7 A;  3QG1 A;  2XDD A;  3EGX B;  4C8Q G;  2HQH A;  3CMA Q;  4BD3 A;  1JU5 C;  2C0T A;  3VUZ A;  2YUQ A;  1P92 A;  1VYT A;  3E2U A;  2MWP A;  2CT3 A;  3OYJ A;  3QYH B;  2M51 A;  1X6B A;  1SRL A;  2V8I A;  2IPO B;  3RR6 A;  2L5Q A;  1Q86 C;  2ROT A;  4DBQ A;  1UJY A;  2RH2 A;  4EMK B;  2CGH A;  1VQM Q;  1BCO A;  2DL4 A;  2OTJ A;  3EG3 A;  2CP6 A;  5IHN A;  2X4W A;  2EYX A;  1UG1 A;  1YCY A;  1BK2 A;  3BW1 A;  4FW2 A;  2DIQ A;  3CCJ Q;  2B86 A;  1QVF S;  3G6E A;  2HCK A;  4GLK A;  5IXB A;  1SPK A;  3X25 B;  3VU3 C;  1O75 A;  2FEI A;  3CME A;  3FLG A;  4HCZ A;  3QWX X;  2E10 A;  2DD4 A;  4IUU A;  4E47 A;  2DXC A;  3RMQ A;  1K9M U;  2GTO A;  1NYF A;  3HL8 A;  3CC7 A;  1AOJ A;  2HKQ B;  5EG2 A;  2KYM A;  1O9S A;  2NUP B;  3OSV A;  1WYX A;  2SEM A;  3EHR A;  4RUG A;  4C8Q A;  1KK7 A;  2KGT A;  4C8Q F;  1M1K U;  1SKU B;  5LJ5 d;  1MV3 A;  4M75 B;  3QXE B;  1TTH B;  1WA7 A;  2BZY A;  4ESR A;  1VQK Q;  2O88 A;  1WXB A;  4A53 A;  2DIG A;  4FT2 A;  3JCM f;  1PWT A;  3CC4 T;  4KRT A;  5A2Q E;  1IHV A;  2RHY A;  1LCK A;  2JTE A;  1JJ2 S;  1VYU A;  1WHM A;  1LVK A;  1UHC A;  2RD1 A;  4IUV A;  2EIF A;  2QTV A;  1X01 A;  1Y0M A;  3JCM P;  3A8G B;  4L6V 5;  5FU7 C;  1K8A C;  5EC7 A;  3CC2 T;  3OYY A;  4C8Q C;  5HK3 A;  2E64 A;  2OTL Q;  2XKO C;  1Q81 R;  1N9R A;  2FZC B;  3JCM d;  1VQN T;  3JCM b;  1IRE B;  2DEQ A;  1AVZ C;  1X75 C;  4PJO E;  4M77 E;  2ED1 A;  2F2W A;  1M8V A;  2L3R A;  4IUR A;  1W1F A;  2CP7 A;  1NEB A;  2PU9 B;  4FYV B;  4KGX B;  4ANJ A;  3PE0 A;  2KQW A;  1WHK A;  3QZ9 B;  4WTO B;  1X2Q A;  2RA2 A;  5KYN A;  1BI3 A;  4M78 D;  2XD0 A;  1VQ5 T;  5KYU B;  3TSZ A;  5M9O A;  2A36 A;  4KGV B;  3GNG A;  2GTJ A;  2EYY A;  3VYG A;  2KT8 A;  3CCQ A;  1XJW B;  3RDV A;  3REA B;  3G4S T;  2HQE A;  2KR3 A;  3PMI A;  3VRZ A;  2EW3 A;  1YIJ Q;  2EGA A;  2DIL A;  2K7A A;  3VS1 A;  1M3C A;  1WXU A;  4C92 B;  2IIM A;  2DYI A;  2RHZ A;  3VS7 A;  4QVC A;  4XTW A;  4M7A B;  2DJZ A;  2M02 A;  3OW2 S;  3MCA B;  1BI2 A;  4Z02 A;  1KHC A;  2K4Y A;  4KGZ B;  2F5K A;  2DZC A;  3OBY A;  4E7J A;  1SHG A;  1G5V A;  4FM4 B;  4BE0 A;  5FRM A;  1KIK A;  2CH4 W;  4QQG A;  1S72 A;  1E6G A;  3H9N A;  2HL5 C;  5DM7 R;  2GF7 A;  4QVZ A;  1VOM A;  3G6E T;  1D1A A;  1YP5 A;  3ZBD A;  3EFS A;  1VUB A;  3JV3 A;  2GFA A;  1G3Y A;  2F2X A;  2DM1 A;  1A0N B;  3EGX A;  1QMC A;  2K3X A;  4C0Z A;  2DER A;  2I2L A;  5IHK A;  3BY7 A;  3V7S A;  3I5R A;  2X35 A;  2PVG B;  4M75 G;  2FO0 A;  2KRO A;  3MEA A;  5IN1 A;  4BDY A;  2LDM A;  1NEG A;  3NHN A;  4XU3 A;  2K57 A;  5GMK l;  1NE8 A;  2K3B A;  1YIT T;  2JOY A;  1K73 C;  1B07 A;  1WXT A;  2DTO A;  1X69 A;  4EMK A;  2QXF A;  1G8X A;  2HSE B;  1QP3 A;  3H0I A;  3EGD A;  1YI2 A;  2JN0 A;  1VQO A;  1OZ3 A;  3WVE B;  3RER A;  1AZG B;  4DBR A;  4N0A A;  1SRM A;  2A28 A;  3DB3 A;  2IVW A;  4X34 A;  1N8R U;  1LPL A;  1QCF A;  2KDS A;  1RAG B;  5LJ5 e;  3OYN A;  1Y96 B;  2EPD A;  1NG2 A;  1OX8 A;  3EGU A;  3UF4 A;  2VXE A;  1RAF B;  3BDL A;  4M78 E;  4ZNX A;  3HP9 A;  5J39 A;  4Y28 E;  2QAZ A;  3CBO A;  4M7D B;  1ZX6 A;  1H92 A;  1U3O A;  3OYI A;  2LTO A;  5IT9 E;  3QSU A;  5D6W A;  4M75 A;  2RJD A;  2RJF A;  5ECA A;  4YTL A;  3INZ A;  2K5L A;  1MNE A;  2KYB A;  1ACM B;  2H8H A;  1Q82 U;  3CC4 Q;  1BBZ A;  2D8J A;  3GNF B;  4OMQ A;  1H64 1;  2E41 A;  1W2B A;  1VQL A;  1FYN A;  4BY6 C;  1Z9Q A;  2R58 A;  4A4K A;  3THK A;  3CC2 Q;  2HSP A;  2EKO A;  5GAN 4;  4JZ4 A;  1Y7X A;  1VQN Q;  1LOJ A;  1M1F A;  3SWN C;  4PLL A;  2AZS A;  1AWX A;  2RQU A;  2XIC A;  1UTI A;  2RQT A;  1M3B A;  3LYI A;  1SEM A;  1JO8 A;  2M0Y A;  4JJN K;  2DVJ A;  3DB4 A;  2NUZ A;  4GBQ A;  2L2P A;  2EGC A;  2ZPB B;  2M9U A;  3EG2 A;  3A1P A;  5LJ5 h;  2MF2 A;  1MUZ A;  1KC8 U;  1SF9 A;  1XOV A;  2QQ9 A;  1WZO A;  1RAE B;  1FMK A;  4KH0 B;  5KYU A;  4E6R A;  2FRY A;  2EVR A;  2LQK A;  1WHG A;  4JZ3 A;  1R77 A;  3G4S Q;  4IUQ A;  2YLC A;  2CZ7 B;  2ZPE B;  2J6O A;  5A0D A;  3CCV A;  3CQT A;  1B7T A;  2BKD N;  1VA7 A;  2AKK A;  4F04 B;  4C92 D;  1VQ4 T;  5LJ3 g;  1CKB A;  2G3R A;  2EQI A;  4M7A D;  1NYG A;  3PMT A;  1KQ1 A;  3RKW A;  1GBR A;  2EQU A;  1YHQ A;  3FC3 A;  1YNZ A;  2WSE E;  3OYM A;  1NJI U;  5GAN g;  4RTX A;  4D8K A;  1K9M R;  3S3O A;  3D7S B;  3MP1 A;  3G6E Q;  4WF2 A;  4QVD A;  5HCK A;  4Z89 A;  3CME Q;  5IAY A;  2ZPH B;  1OZ2 A;  2EQM A;  5FU7 B;  1M1K R;  1M90 U;  4C8Q B;  2Y4Y A;  4IKF A;  2AK5 A;  3V7R A;  3CPW P;  1OX9 A;  2BE7 D;  2WSC E;  4DQ2 A;  4IIO A;  1GCP A;  1OQK A;  2IG0 A;  1QVG P;  1YN8 A;  5DLQ E;  1R0B G;  2A08 A;  5GMK e;  4IUP A;  1YIT Q;  1M2O A;  3H0F A;  1VQK T;  3NMZ C;  4FL6 A;  4D6W A;  4XU2 A;  1RAD B;  4ZTJ A;  2QK0 A;  2RI5 A;  1FXX A;  4IUT A;  1VQ9 T;  2LQ8 A;  4PJN A;  2P0Q A;  3TU4 K;  4N4G A;  3HHT B;  4A63 B;  2ZCF B;  1F1B B;  2VWF A;  1VQL T;  3OMG A;  3OMC A;  3HRT A;  1X27 A;  4OML A;  3A8O B;  2VXF A;  4NL3 A;  1HXD A;  2OTL T;  1QVF A;  1AZE A;  3ER0 A;  1Q86 U;  5CQY A;  1EX4 A;  1Y96 A;  1HSQ A;  1ZBJ A;  4LNP A;  4RTW A;  1I5L A;  1V76 A;  4B9X A;  3JB9 D;  1VQ6 A;  5GAN 6;  2K3Y A;  3O8V A;  3HPW A;  4M7D A;  4AMC A;  1JQQ A;  1AT1 B;  2JTF A;  3C95 A;  1OEB A;  4NL2 A;  2O2O A;  4DOV A;  5LJ3 j;  1ZSG A;  4II1 A;  4HVW A;  4C5H A;  2RMO A;  2X9H A;  5J26 A;  1SG5 A;  3LH5 A;  4OGC A;  1TXQ A;  1C1A A;  5GAN j;  2ATC B;  4M77 G;  3CCR A;  4F14 A;  3CPF A;  4A4E A;  3J7A F;  3QDR B;  2EJ9 A;  3R6O A;  1JJ2 A;  2L8D A;  2CUB A;  1PRL C;  2E3H A;  4BE1 A;  2HD0 A;  4B9W A;  3MJX A;  1RAI B;  1AEY A;  2RPN A;  1I1J A;  2D8H A;  4WCI A;  5CO7 A;  5DLO A;  3ME9 A;  2EWN A;  4MZM A;  1D09 B;  2QQA A;  3E9F A;  5FLX E;  2E65 A;  2H3J A;  2XMF A;  3HSB A;  4FYY B;  3QYG B;  3OYC A;  2DLP A;  2ENM A;  1YJ9 A;  5GAO m;  1UE9 A;  1YCS B;  1K8A U;  3CCE A;  4RG2 A;  4BAC A;  1ZBX A;  1WQ7 A;  4C5I A;  1I4K 1;  3PFS A;  2KMT A;  1RLQ C;  2LNV A;  2AZV A;  1VQ4 Q;  1RI9 A;  2MOX A;  2HAX A;  1N9S A;  1JXM A;  4MZT A;  1X43 A;  3CCU A;  4X9D A;  4PJO F;  3U23 A;  4M77 F;  2K2M A;  3HKS A;  2KT1 A;  3JCM g;  4K11 A;  1BU1 A;  3F70 A;  4QKU A;  4EPC A;  3EGD B;  1G83 A;  3KUF A;  3TEE A;  2GCX A;  2XI9 A;  3GIB A;  3CD6 A;  5GAM g;  2VUB A;  4Y92 A;  1G3S A;  1GCQ A;  5LJ5 f;  1N8R R;  1WJR A;  4ZN1 A;  1C6V X;  1TG0 A;  1YBY A;  3X28 B;  1BCM A;  4PFZ A;  4BY6 B;  3PIP A;  1TOV A;  3G71 A;  3V8K A;  3OW2 A;  1IXD A;  2FPD A;  1H3H A;  2P4R A;  4C8Q D;  2LMJ A;  2LT1 A;  1WLP B;  2DL3 A;  2RQR A;  3JB9 H;  2ECZ A;  3SWN B;  4HKE A;  4RCB A;  4O6J A;  1WPY A;  4M77 C;  4PJO C;  3OSS C;  3M56 A;  2CSQ A;  5CKE A;  3MHX A;  2JUF A;  1Q82 R;  2HDA A;  2AKL A;  1PSE A;  3A8L B;  5FW9 A;  1PG5 B;  1AWO A;  1YJW A;  1NBE B;  1UUE A;  4J9E A;  3RUX A;  3L1A A;  4LDU A;  1W4S A;  1ARK A;  1GCQ C;  1N27 A;  1B34 B;  2X51 A;  4XTX A;  1EFN A;  2EBP A;  2QEX T;  1VQ9 Q;  3OS0 A;  3M0P A;  2KI7 A;  4A4G A;  3I55 A;  2EYQ A;  2L0A A;  3M59 A;  4AFQ C;  4LUD A;  4X9C A;  4JDS A;  3EH2 A;  1YJN T;  4F7U G;  5GAN 8;  3LWH A;  1VQL Q;  4RKU E;  1KJW A;  1TWB A;  2QI2 A;  4OB1 B;  4MDW A;  2RQV A;  2EYW A;  1VQP A;  1IHW A;  1S1N A;  2CDT A;  4J9G A;  3CXC P;  2KE9 A;  2XID A;  3SEM A;  2C0O A;  5IH2 A;  4KT0 E;  1U1T A;  4XU1 A;  1VQ7 A;  5I2S A;  1K73 U;  3L2Z A;  5GJW B;  2JZ2 A;  1KC8 R;  4BI8 B;  2EKH A;  3VV0 A;  2J7I A;  1H8K A;  4OMO A;  4F16 A;  2QA4 T;  1ABO A;  3OY9 A;  3CCL A;  1U1S A;  2GBQ A;  3GLX A;  4JS4 A;  2A0F B;  1TUC A;  1WX6 A;  2KRS A;  4C0D C;  2FVU A;  3OB9 A;  4P5N A;  3FIF A;  3CCS A;  2ZPG B;  4GY5 A;  1UGP B;  3X24 B;  5D6Y A;  2X4J A;  4PJJ A;  3RMS A;  2CP3 A;  1FWZ A;  5DY9 A;  3CCM A;  2KBT A;  2DNU A;  1WHJ A;  5GAM j;  3JCM X;  2DTH A;  2LX9 A;  4F7U A;  4BDZ A;  5AYF A;  2JVV A;  4F7U F;  1JB0 E;  1NJI R;  2EYZ A;  2HBW A;  1K9M C;  2L3Q A;  3X20 B;  1WJS A;  2FYK A;  3JAM E;  3QUI A;  2LCS A;  5GMK i;  4FIB A;  2OTJ T;  2YXY A;  4C8Q E;  1VIE A;  2DAQ A;  1IGQ A;  1GBQ A;  2PUK B;  1OYX A;  3HRU A;  3NTI A;  1M1K C;  5KE3 A;  3I56 A;  3DLL A;  4OGE A;  3MET A;  2GFU A;  3CME T;  4AFS C;  4QW2 A;  1UB4 A;  2DZ9 A;  4IIM A;  4TVR A;  4MZP A;  3X26 B;  5FWB A;  2YRV A;  4QT7 A;  4F17 A;  3CC7 T;  3CMA A;  1QWE A;  2K5F A;  4BB7 A;  2QTX A;  3MEW A;  4JJC A;  3MP8 A;  3FB9 A;  2O31 A;  2PUO B;  3VUB A;  4E7I A;  2H3E B;  2DL8 A;  3M54 A;  2FL7 A;  2RJC A;  3KBG A;  2QDL A;  3LX7 A;  5GAN 7;  3P8B B;  1VQM A;  3QPH A;  2EJG A;  2M16 A;  3G7Z A;  3N5B B;  4E7H A;  2K9G A;  2DYB A;  2LC4 A;  4BE2 A;  2QG9 B;  3CCJ A;  1ZQ1 A;  4AG1 C;  3NTK A;  3QDF A;  3E1S A;  1Q86 R;  4RCC A;  2LJ3 A;  4J7I A;  4E7L A;  3HTR A;  2J06 A;  2MWO A;  4L59 A;  2XDB A;  1ZUU A;  2PNI A;  4OMP A;  1UDL A;  2JJ9 A;  1WDX A;  1KD1 C;  3OYE A;  3OYH A;  4XTZ A;  3GOX A;  3QJ6 A;  1YWP A;  3SWN A;  4M75 D;  2EJF A;  5CKF A;  2RM4 A;  2MYS A;  1KG1 A;  1IO6 A;  2OX7 A;  3E19 A;  1AWW A;  1QWF A;  2RI2 A;  4JPB W;  2R5A A;  3OYB A;  2CP5 A;  1FX7 A;  2RI3 A;  3M57 A;  3RES A;  4J9H A;  3PVL A;  1EIF A;  4GLM A;  2QEX Q;  2MPX C;  3LGF A;  2DA9 A;  2GQI A;  2PVO B;  3QBY A;  3M4Y A;  1B34 A;  3PIO A;  3CCL T;  1I81 A;  1YJN Q;  4FYX B;  1KHI A;  3KXT A;  3EFR A;  2HNI A;  4J9D A;  2ZAE A;  3CCQ T;  2KK4 A;  1UHF A;  4HT9 A;  1SHF A;  3ZFJ A;  2L3S A;  1QW1 A;  3UA7 A;  1T0J A;  1OOT A;  3FJ5 A;  3MEU A;  4C5E A;  2RHU A;  3H6Z A;  3QO3 A;  1ZUK A;  1UEC A;  4OB2 B;  1UGV A;  5KYX A;  4JUV A;  3JCM c;  1VQ8 A;  2RJE A;  5I21 A;  1I8F A;  2QA4 Q;  1MND A;  1U8R A;  3S3M A;  3OS5 A;  1M9S A;  4E2F B;  2E1H A;  3SD4 A;  4HCB A;  2FPF A;  1FMV A;  4OMN A;  3HFN A;  3V7C A;  1S72 T;  1ZA1 B;  3H8Z A;  2V26 A;  2QDY B;  2VYT A;  4OMF B;  1UGS B;  1Q7Y U;  5GAN 5;  2CZ1 B;  4N4I A;  3OS1 A;  4D8D A;  3A8H B;  2GNC A;  3JCM W;  4PJO B;  4M77 B;  4OB3 B;  3TVT A;  3L2U A;  3NGP A;  3QWY A;  1FMW A;  3OYG A;  2C0I A;  1BI1 A;  4JRI A;  1YIJ A;  4L5G A;  2JW4 A;  5I2M A;  1N8R C;  2YDL A;  4ORZ A;  2OTJ Q;  3CEY A;  2CUD A;  2ZGW A;  5GAO l;  2NLU A;  3J80 E;  2LT4 A;  4ZGE B;  1ZSZ C;  1VIF A;  2E6N A;  1D1C A;  2LCC A;  4JRP A;  1ZUY A;  2O9S A;  1QLY A;  3M0U A;  3CD6 Q;  4PJL A;  2EQJ A;  4M75 E;  2HZY A;  3JCM J;  1YI2 T;  1VQO T;  2DBM A;  2X4X A;  2OAU A;  4RTV A;  2RB6 A;  4Q5W A;  1D0Y A;  1MGQ A;  1TUD A;  1M2V B;  1NPR A;  1KQS P;  4PL6 A;  1BB9 A;  2PTK A;  1Q82 C;  1RLP C;  3CPW S;  1IRX A;  3CC7 Q;  1UGQ B;  3SDZ A;  2SRC A;  1QVG S;  1NLO C;  3AT1 B;  3CBP A;  4ZN3 A;  5FRN A;  1K9A A;  4HXJ A;  1U5S A;  2VV5 A;  1X2K A;  3JB9 G;  1K0X A;  1OI1 A;  1W2B P;  1BYM A;  3MKD A;  4KUL A;  4RG8 A;  3ZL7 C;  1OPK A;  2ROL A;  3L2R A;  1R8O B;  3I35 A;  2O4X B;  4C0D B;  4DOW A;  4J6W A;  2DKG A;  2L89 A;  4DEX A;  5L23 A;  1NZ9 A;  1PKT A;  1Q81 C;  2KAF A;  4LD9 K;  3Q1J A;  3EG9 B;  4DBH A;  2COY A;  1IZ6 A;  2MAM A;  3P8H A;  2YUN A;  2O9V A;  1K4U S;  2V1Q A;  3H41 A;  1K73 R;  2V1R A;  3JSC A;  3EH1 A;  1AWJ A;  1KC8 C;  4M7D D;  1TSF A;  2ED0 A;  3C4S A;  2CSI A;  4KH1 B;  5LL6 S;  3GPL A;  5CAI A;  3S3N A;  4LD6 A;  5GAO r;  2NYS A;  4JRQ A;  2QQS A;  2J6K A;  4Z8A A;  4C92 E;  1U06 A;  1JBM A;  3CCL Q;  2FG0 A;  4JJB A;  3LGL A;  2K2V A;  5KYW B;  4RTT A;  4M7A E;  4J9B A;  3E9G A;  3CC4 A;  3MPU B;  3VS4 A;  3JB9 F;  4F7U B;  3CCQ Q;  4PJO G;  2CKK A;  1N5Z A;  2V8J A;  7AT1 B;  2JM8 A;  3CCM Q;  1X6G A;  2RHX A;  2DF6 A;  1MV0 B;  2OAW A;  3CCV T;  5GAN 2;  1DJ7 B;  3CC2 A;  3HFO A;  4XTU A;  3JRZ A;  2A7Y A;  1YFN A;  1TH7 A;  2DTI A;  1UEB A;  2FZG B;  3SFM A;  4M4Z A;  2YHT A;  3UWN A;  1PKS A;  5LJ5 g;  4NOY A;  3DKM A;  1V1C A;  3UA6 A;  2HMA A;  5CKB A;  2D0N A;  5CIU A;  1PC0 A;  2BTT A;  1YHQ T;  2LQW A;  3QZ5 B;  1T3L A;  1NPP A;  1V29 B;  4PK4 A;  1RI0 A;  1S72 Q;  5CQX A;  2E5Q A;  1WHH A;  1K1Z A;  5HKC A;  2J05 A;  2P0P A;  2KRM A;  1VQ5 A;  4J9F A;  2X3W D;  3PT9 A;  2DD5 A;  2ZPF B;  1R0C B;  2DE0 X;  4XQ3 A;  4JLG A;  2QGF B;  1UFF A;  4M77 D;  2Y90 A;  3UDC A;  3G4S A;  1TU0 B;  4QQD A;  4A4H A;  2DBK A;  4E7Z A;  2VAS A;  2DL7 A;  2EAY A;  3DLM A;  2E70 A;  4PJO A;  4M77 A;  2FB7 A;  5KCO A;  4AFZ C;  1WGS A;  5KH6 A;  2KEA A;  2C06 A;  2RHI A;  2VVK A;  2W10 A;  4DEY A;  1RUW A;  1D3B B;  2CZ6 B;  3UPU A;  4RTZ A;  2DO3 A;  3OA6 A;  2VGN A;  4HT8 A;  4O5V A;  3L2W A;  2LX7 A;  1YI2 Q;  4M7D E;  1VQO Q;  2ESW A;  2JNG A;  3OQ5 A;  2EGE A;  2WAC A;  2DFU A;  1JXO A;  1QVF P;  3UAT A;  1SSF A;  5GAN 3;  2P0K A;  2RK1 A;  1K76 A;  2LRQ A;  2DRM A;  5A0L A;  2DX1 A;  5FRO A;  1M2V A;  2F1L A;  3OS2 A;  4R55 A;  2YRC A;  1VYV A;  5CVI A;  3M0R A;  5CCA A;  4KUD K;  1RAB B;  2RF0 A;  4C0G A;  3BDU A;  1XQH A;  3P8D A;  2K6D A;  4OVA A;  1VQ6 T;  3JB9 I;  4MMK A;  4LDV A;  5CKH A;  1YIT A;  2DL5 A;  4FW1 A;  4DA4 A;  2CP0 A;  2E5K A;  1IB8 A;  2O4X A;  5LJ5 j;  4M78 G;  2OI3 A;  2PVD B;  3M0S A;  1XTD A;  4A54 A;  1WJQ A;  1JJ2 P;  3OYL A;  3EG9 A;  2PZ1 A;  2F2V A;  2LJ0 A;  3CXC S;  4FCY A;  3VRY A;  2BZX A;  2EFI A;  1Z9Z A;  3M5A A;  3M58 A;  4PKC C;  2G6F X;  2Z0W A;  3CCR T;  2COZ A;  5LJ3 e;  5KYX B;  4E7S A;  5GAM f;  4J6Y A;  5I11 A;  1UGR B;  3M55 A;  4Y91 A;  5KYY B;  3M9Q A;  1QP2 A;  5FU6 C;  4B6M A;  4FSS A;  4J8O A;  5GAN e;  2M0O A;  1ZSZ B;  4LE9 A;  1VQ8 Q;  3RBB B;  2LCL A;  2FHD A;  3EAE A;  3EFO B;  1Q7Y R;  4J9C A;  3VS2 A;  4KUI A;  4LDX A;  1M30 A;  1OUL A;  3NTH A;  5IXF A;  4EMG A;  5GAM d;  4FU6 A;  1TS9 A;  1T0H A;  4RTU A;  2ABL A;  1YJ9 T;  4NS5 A;  5KYW A;  3CCE T;  2DRK A;  1KD1 U;  3GP8 A;  2OJ2 A;  2BE9 B;  3VKI A;  3CCV Q;  4M78 A;  4HVV A;  4M78 F;  1JEG A;  2LVM A;  3M4G A;  3J81 E;  4XTY A;  2HQX A;  4PNO A;  1PD0 A;  3LH0 A;  3CCU T;  2AIR B;  2XDP A;  2JMC A;  2D9T A;  4FT4 A;  2JM9 A;  3TSW A;  3C0C A;  4PFP A;  1YHQ Q;  1NM7 A;  1HJD A;  2HL3 A;  5FWC A;  3V8L A;  2L3P A;  3NPF A;  1M90 R;  3R6N A;  5GAO q;  4QQ6 A;  4KBM B;  3OW2 P;  3CD6 T;  5LJ3 h;  4J7F A;  2M1H A;  4MDX A;  2FPE A;  2W0Z A;  1D0Z A;  2JTM A;  2LQN A;  3CBM A;  2A3L A;  4CRI A;  4N4H A;  1M27 C;  4M78 C;  2YUP A;  2RK2 A;  3RIR A;  1BI0 A;  1PD1 A;  3G71 T;  2DXT A;  1BKB A;  5GAN h;  4C5G A;  3FDR A;  4V2S A;  3G1J A;  2R57 A;  1WFW A;  2YLB A;  2JS2 A;  2I0N A;  3S6W A;  1QQJ A;  3RKX A;  2LJ1 A;  2CT4 A;  2P84 A;  4LUE A;  1AD5 A;  2R5M A;  2VGM A;  4ZTF A;  4CI0 C;  1VQ4 A;  2D0Q B;  2JS0 A;  2ZZD A;  5D7U A;  4FSX A;  2GQV A;  1YJW T;  2XU8 A;  3EHQ A;  3OYF A;  1D3B A;  3MO8 A;  3PVQ A;  2MCN A;  1MHN A;  4HA8 A;  4EDU A;  1D1B A;  3OYK A;  3OYD A;  1CSK A;  3M53 A;  2HBP A;  3I55 T;  5KCH A;  8AT1 B;  2E3I A;  2DVE A;  3VS6 A;  2XHC A;  2VC8 A;  2ZPI B;  2V8K A;  1QCN A;  5GMK j;  2F5T X;  4R56 A;  1GFD A;  2RN8 A;  1VQP T;  2AHJ B;  3T9N A;  3I5S A;  1QKW A;  3A8M B;  5HK0 A;  4DBF A;  1NLP C;  2NUT B;  2DPP B;  1M3A A;  1VQ7 T;  4ZGJ B;  1VQ6 Q;  4ZGD B;  4VUB A;  4CC2 A;  4F7U E;  1JRI A;  1I07 A;  1KQS A;  4LXC A;  5A0G A;  2K79 A;  2NUP A;  2YT6 A;  4X1V A;  1Y57 A;  3CPW A;  2X4Y A;  3JCM V;  1HD3 A;  5AT1 B;  1J3T A;  1VQK A;  1WI7 A;  4EMK C;  3TRE A;  4J6X A;  1QVG A;  3FJP A;  3BE3 A;  1WQW A;  1AHJ B;  2YUO A;  2E4H A;  4HCC A;  4M75 F;  1ABQ A;  2LNH B;  2HKN A;  3GF5 A;  1VQ9 A;  3CCS T;  3L2Q A;  3LWI A;  2F69 A;  1GL5 A;  2O01 E;  1PCX A;  2J6F A;  4N0A C;  1ZA2 B;  3CCM T;  3CCR Q;  2MIO A;  1KSW A;  3IQL A;  4J9I A;  1PHT A;  2OTL A;  3JCM e;  1KFZ A;  1M8M A;  2MMP A;  4AG2 C;  4C92 G;  2VB6 A;  1T3S A;  2NWM A;  9ATC B;  3EG1 A;  1MMA A;  2JMA A;  3V8J A;  3WXM B;  3JCM Q;  4JLI A;  2DK3 A;  3ZEH A;  5KYY A;  4M7A G;  4EMH A;  3C12 A;  1K8A R;  4CC3 A;  4ELY C;  3O5Z A;  5GAM e;  3MEV A;  2D1X A;  1Q95 G;  4M75 C;  1Q81 U;  1ZSZ A;  1IGU A;  3QJY A;  1W70 A;  1I5O B;  3EFO A;  1N6A A;  1MMG A;  2KVQ G;  3VJP A;  3L2V A;  3I56 T;  1K0S A;  1YJ9 Q;  2QAS A;  2A37 A;  2RQW A;  3A5Z B;  3CCE Q;  4FYW B;  4PFO A;  1VQ5 Q;  2LP5 A;  4OMM A;  4ELZ C;  3QHS A;  2CZ0 B;  2KXC A;  4BI4 A;  4LDW A;  1OU9 A;  5CR2 A;  1HYO A;  4JS5 A;  3JB9 J;  1M5Q 1;  5C0M A;  4OB0 B;  2CS7 A;  2CH4 A;  3CMA T;  3CCU Q;  2DMO A;  2YRD A;  2MK5 A;  4RTY A;  4PLI A;  3LLR A;  2RO0 A;  5KE2 A;  1BIB A;  4MML A;  4UC4 A;  5I22 A;  3RNJ A;  2YWW A;  4PJM A; 
#chains in the Genus database with same CATH homology
 5J3B A;  3JRZ A;  2QI2 A;  4OB1 B;  2A7Y A;  2DTI A;  1TH7 A;  4MDW A;  1HK9 A;  1UEB A;  3SFM A;  1Y71 A;  1YI2 A;  4C92 A;  2JN0 A;  5HY6 A;  1VQM T;  1VQO A;  2XK0 A;  4C92 F;  1OZ3 A;  3WVE B;  1VQP A;  2YHT A;  3UWN A;  3RER A;  5LJ5 g;  4NOY A;  2XID A;  3DKM A;  2MI6 A;  4J83 A;  5CKB A;  4M7A A;  2P4T A;  5CIU A;  4KT0 E;  4M7A F;  2CYZ B;  4E7K A;  4N0A A;  1LNX A;  3JCM h;  1U1T A;  4XU1 A;  3LWH A;  1VQ7 A;  3DB3 A;  4JRK A;  5I2S A;  3CCJ T;  1G3W A;  2IVW A;  4X34 A;  1YHQ T;  1K73 U;  3QZ5 B;  1N8R U;  5GMK m;  5L8R E;  2KDS A;  1KQS S;  3L2Z A;  1NPP A;  1V29 B;  1RI0 A;  5LJ5 e;  2JZ2 A;  1Y96 B;  3OYN A;  1JJ2 A;  5CQX A;  2E5Q A;  4BI8 B;  2D6F A;  3VV0 A;  2VXE A;  3BDL A;  4M78 E;  5HKC A;  2P0P A;  1VQ5 A;  3HP9 A;  5J39 A;  5GAM h;  4Y28 E;  2QA4 T;  3QII A;  3PT9 A;  3CBO A;  3OY9 A;  3CCL A;  4M7D B;  2QQR A;  2DD5 A;  1X6O A;  2ZPF B;  1U1S A;  3GLX A;  4JS4 A;  4J5Y A;  3OYI A;  2LTO A;  4XQ3 A;  2DXU A;  5IT9 E;  4JLG A;  4C0D C;  3QSU A;  2E12 A;  2FVU A;  3OB9 A;  4P5N A;  3FIF A;  5D6W A;  4M75 A;  2KSS A;  5FU6 B;  4BUG A;  2RJD A;  4M77 D;  3CCS A;  4M7D G;  2RJF A;  2Y90 A;  3UDC A;  4YTL A;  2ZPG B;  3INZ A;  2K5L A;  3G4S A;  4GY5 A;  4QQD A;  4A4H A;  3URG A;  4C92 C;  1UGP B;  3FEO A;  2EAY A;  3DLM A;  5D6Y A;  3L42 A;  3X24 B;  2E70 A;  5CKD A;  4PJO A;  1Q82 U;  2X4J A;  4M77 A;  2FB7 A;  3GNF B;  3RMS A;  5KCO A;  1FWZ A;  5DY9 A;  3CCM A;  1H64 1;  4M7A C;  1WGS A;  5KH6 A;  2E41 A;  5GAM j;  1W2B A;  3JCM X;  2DTH A;  2LX9 A;  3OYA A;  1VQL A;  2RHI A;  2C06 A;  4F7U A;  4BDZ A;  3PNW C;  5AYF A;  1D3B B;  2JVV A;  4F7U F;  5LJ3 f;  2CZ6 B;  3UPU A;  4BY6 C;  3NFC A;  2R58 A;  2DO3 A;  3OA6 A;  1JB0 E;  4A4K A;  4OF1 A;  1H3Z A;  2VGN A;  4HT8 A;  1LJO A;  2EKO A;  1K9M C;  4XAX B;  3X20 B;  1RL2 A;  5GAN 4;  1Y7X A;  1WJS A;  2FYK A;  4O5V A;  3L2W A;  4M7D E;  3JAM E;  1LOJ A;  3C94 A;  3QUI A;  1M1F A;  5GAN f;  2JNG A;  3OQ5 A;  2KY9 A;  3SWN C;  5GMK i;  4FIB A;  4PLL A;  2OTJ T;  5D6X A;  4C8Q E;  2WAC A;  1VIE A;  2DAQ A;  3PGG A;  1SSF A;  1GXI E;  2PUK B;  5GAN 3;  2P0K A;  1OYX A;  3VYH B;  2RK1 A;  2XIC A;  2B8A A;  3HRU A;  3NTI A;  5LJ3 d;  5C6S A;  1M1K C;  2LRQ A;  5A0L A;  1Q7Y C;  2K5I A;  5FRO A;  5KE3 A;  3LYI A;  3I56 A;  3DLL A;  4OGE A;  3MET A;  3OS2 A;  4R55 A;  3PTA A;  4JJN K;  2GFU A;  3DB4 A;  3CME T;  5CVI A;  1VQ8 T;  2E6Z A;  3LW5 E;  2ZPB B;  4QW2 A;  3TCJ A;  5CCA A;  3BFM A;  2M9U A;  1UB4 A;  2DZ9 A;  4KUD K;  5LJ5 h;  5GAN d;  4C0G A;  3BDU A;  2MF2 A;  1XQH A;  3P8D A;  4TVR A;  4OVA A;  3HRS A;  4MZP A;  1XOV A;  2QQ9 A;  3X26 B;  1KC8 U;  1VQ6 T;  2YRV A;  3ASK A;  4XK8 E;  3CC7 T;  4M7D F;  3JB9 I;  3CMA A;  4C0F A;  4MMK A;  2QEX A;  2K5F A;  4LDV A;  1QVP A;  1M4Z A;  2LQK A;  5CKH A;  2QTX A;  4BB7 A;  1YIT A;  5GAO p;  3MEW A;  4IUQ A;  2YLC A;  4M78 B;  2CZ7 B;  3MP8 A;  3FB9 A;  1NJI C;  2PQW A;  2ZPE B;  5A0D A;  4DA4 A;  1YJN A;  3CCV A;  2PUO B;  3MP6 A;  3VUB A;  4E7I A;  4XTV A;  3SB2 A;  2QQB A;  2BKD N;  3M54 A;  4RKU E;  2FL7 A;  2O4X A;  2RJC A;  3KBG A;  3WVD B;  1KQ2 A;  5LJ5 j;  4M78 G;  3LX7 A;  3QKJ A;  4C92 D;  5GAN 7;  3P8B B;  1VQ4 T;  2XG8 D;  2PVD B;  1VQM A;  2DXB A;  5LJ3 g;  2G3R A;  2BIV A;  3QPH A;  3UT1 A;  2EJG A;  3FRN A;  5GMK h;  1XTD A;  2M16 A;  3G7Z A;  3N5B B;  4A54 A;  3OBW A;  4E7H A;  1VQN A;  1BIA A;  4M7A D;  1WJQ A;  4RMO A;  4LDY A;  3OYL A;  3PMT A;  4ATO A;  5CK9 A;  1M90 C;  1KQ1 A;  2LC4 A;  3CXC S;  4BE2 A;  3RKW A;  1YIJ T;  3AHU A;  3CCJ A;  2EQU A;  2EFI A;  1ZQ1 A;  3M5A A;  4PKC C;  3M58 A;  1YHQ A;  3NTK A;  3FC3 A;  3CCR T;  2WSE E;  3E1S A;  1Y07 A;  5LJ3 e;  5GAN g;  3OYM A;  1NJI U;  4RCC A;  2BUD A;  4A4F A;  4J7I A;  4XU0 A;  4E7L A;  3CXC A;  5GAM f;  4M7D C;  1PSF A;  2MWO A;  4J6Y A;  4L59 A;  1WNL A;  2XDB A;  3S3O A;  1UGR B;  3M55 A;  3MP1 A;  4Y91 A;  3RKY A;  3M9Q A;  1QP2 A;  2Y4X A;  2EQK A;  2QA4 A;  4WF2 A;  4QVD A;  5FU6 C;  1KD1 C;  4J8O A;  1ZHI A;  2WSF E;  4OP0 A;  5GAN e;  4XTZ A;  3OYE A;  3OYH A;  2M0O A;  5IAY A;  2ZPH B;  3GOX A;  1OZ2 A;  3QJ6 A;  2LCL A;  2EQM A;  2FHD A;  5FU7 B;  3EAE A;  3SWN A;  4M75 D;  5GAO n;  2EJF A;  1M1G A;  5CKF A;  1M90 U;  2RM4 A;  4C8Q B;  2Y4Y A;  4IKF A;  1KG1 A;  4KUI A;  3E19 A;  4LDX A;  3V7R A;  4BI3 A;  3NTH A;  4PJO D;  2RI2 A;  4EMG A;  2R5A A;  3OYB A;  1G3T A;  5GAM d;  1XNI A;  2WSC E;  4FU6 A;  4ME7 A;  4DQ2 A;  1FX7 A;  3QG1 A;  2XDD A;  2RI3 A;  3M57 A;  3RES A;  4C8Q G;  2IG0 A;  5DLQ E;  4BD3 A;  1EIF A;  1YJ9 T;  4NS5 A;  3LGF A;  5GMK e;  3CCE T;  4IUP A;  3VUZ A;  1KD1 U;  2PVO B;  1P92 A;  3QBY A;  3M4Y A;  1B34 A;  3GP8 A;  2MWP A;  3PIO A;  3OYJ A;  3CCL T;  1I81 A;  3QYH B;  3VKI A;  4M78 A;  1VQK T;  4FL6 A;  4M78 F;  4D6W A;  1KHI A;  2V8I A;  2LVM A;  3M4G A;  2L5Q A;  4XU2 A;  1Q86 C;  3KXT A;  3EFR A;  3J81 E;  4XTY A;  2RH2 A;  2HNI A;  4ZTJ A;  2HQX A;  4EMK B;  2CGH A;  3CCQ T;  2KK4 A;  4HT9 A;  2RI5 A;  1FXX A;  3ZFJ A;  4PNO A;  3LH0 A;  4IUT A;  1QW1 A;  1VQ9 T;  3CCU T;  2LQ8 A;  2OTJ A;  2XDP A;  2X4W A;  2D9T A;  4FT4 A;  2P0Q A;  3TU4 K;  4N4G A;  1YCY A;  3HHT B;  3MEU A;  4C5E A;  2ZCF B;  3BW1 A;  2RHU A;  2DIQ A;  3H6Z A;  3QO3 A;  1VQL T;  1QVF S;  3OMG A;  3V8L A;  3G6E A;  3OMC A;  3HRT A;  4OB2 B;  4GLK A;  3X25 B;  3VU3 C;  5GAO q;  1O75 A;  3A8O B;  2VXF A;  4QQ6 A;  4NL3 A;  4KBM B;  1HXD A;  3FLG A;  3CME A;  4HCZ A;  4JUV A;  3JCM c;  2OTL T;  1QVF A;  1VQ8 A;  3CD6 T;  2RJE A;  5I21 A;  5LJ3 h;  2E10 A;  4J7F A;  2DD4 A;  2M1H A;  1I8F A;  3ER0 A;  4IUU A;  1Q86 U;  4MDX A;  3CBM A;  2JTM A;  4CRI A;  4E47 A;  2A3L A;  5CQY A;  2DXC A;  3RMQ A;  4N4H A;  1Y96 A;  1K9M U;  1U8R A;  3S3M A;  3OS5 A;  1M9S A;  1I5L A;  4B9X A;  2E1H A;  3SD4 A;  3JB9 D;  3HL8 A;  4HCB A;  1VQ6 A;  4M78 C;  3CC7 A;  2RK2 A;  3RIR A;  1BI0 A;  5GAN 6;  5EG2 A;  3G71 T;  2K3Y A;  3O8V A;  1O9S A;  3HPW A;  2DXT A;  4M7D A;  3V7C A;  1BKB A;  3HFN A;  3OSV A;  4C5G A;  3FDR A;  5GAN h;  1S72 T;  3H8Z A;  4V2S A;  3I55 T;  2R57 A;  2QDY B;  2VYT A;  4C8Q A;  2YLB A;  4OMF B;  4C8Q F;  2JTF A;  3C95 A;  3S6W A;  1UGS B;  1W2B S;  1M1K U;  4NL2 A;  5LJ5 d;  1Q7Y U;  3RKX A;  5GAN 5;  2CZ1 B;  4DOV A;  4N4I A;  4M75 B;  5LJ3 j;  3QXE B;  4II1 A;  3OS1 A;  2R5M A;  2VGM A;  4C5H A;  4ZTF A;  3A8H B;  4CI0 C;  2D0Q B;  3JCM W;  1VQ4 A;  4PJO B;  2ZZD A;  4M77 B;  4OB3 B;  5J26 A;  3L2U A;  4FSX A;  4OGC A;  2GQV A;  4A53 A;  1YJW T;  2DIG A;  4FT2 A;  3OYG A;  2XU8 A;  1BI1 A;  3JCM f;  5GAN j;  3OYF A;  1D3B A;  3MO8 A;  4JRI A;  3CC4 T;  1YIJ A;  5A2Q E;  1MHN A;  4M77 G;  2RHY A;  4HA8 A;  4L5G A;  1JJ2 S;  4EDU A;  3CCR A;  3CPF A;  5I2M A;  2RD1 A;  4IUV A;  4A4E A;  3OYK A;  3OYD A;  3QDR B;  1N8R C;  3J7A F;  2EIF A;  3CEY A;  3M53 A;  2EJ9 A;  1X01 A;  2HBP A;  2L8D A;  3R6O A;  2ZGW A;  5KCH A;  5GAO l;  3A8G B;  2NLU A;  3J80 E;  3JCM P;  2LT4 A;  4ZGE B;  2DVE A;  2XHC A;  1VIF A;  2E6N A;  4L6V 5;  2LCC A;  2VC8 A;  2HD0 A;  5FU7 C;  4JRP A;  4BE1 A;  1K8A C;  3CC2 T;  3OYY A;  2ZPI B;  4B9W A;  4C8Q C;  5HK3 A;  2V8K A;  2E64 A;  2XKO C;  1N9R A;  2F5T X;  5GMK j;  4R56 A;  2EQJ A;  3JCM d;  1VQN T;  4M75 E;  1YI2 T;  3JCM J;  5CO7 A;  1VQO T;  3JCM b;  5DLO A;  1IRE B;  2X4X A;  1VQP T;  2DEQ A;  3ME9 A;  2OAU A;  2AHJ B;  2EWN A;  3T9N A;  2RB6 A;  4MZM A;  4Q5W A;  2QQA A;  3A8M B;  1MGQ A;  3E9F A;  1X75 C;  5FLX E;  5HK0 A;  4PJO E;  1NPR A;  2E65 A;  4M77 E;  2H3J A;  3HSB A;  1M8V A;  2DPP B;  2L3R A;  4PL6 A;  1VQ7 T;  4ZGJ B;  4IUR A;  3QYG B;  1Q82 C;  4ZGD B;  3OYC A;  3CPW S;  1UGQ B;  2PU9 B;  3SDZ A;  4VUB A;  4F7U E;  1YJ9 A;  1JRI A;  5GAO m;  1K8A U;  3CCE A;  4RG2 A;  2KQW A;  3QZ9 B;  1QVG S;  1KQS A;  4BAC A;  2RA2 A;  5A0G A;  3CPW A;  1BI3 A;  1ZBX A;  2X4Y A;  4M78 D;  2XD0 A;  3JCM V;  1WQ7 A;  4C5I A;  1VQ5 T;  1I4K 1;  3CBP A;  3PFS A;  1VQK A;  4EMK C;  4ZN3 A;  3TRE A;  2KMT A;  4J6X A;  1QVG A;  3FJP A;  5FRN A;  5M9O A;  1WQW A;  1AHJ B;  3GNG A;  2LNV A;  4HCC A;  2VV5 A;  4M75 F;  3VYG A;  3CCQ A;  1N9S A;  3JB9 G;  2HAX A;  1OI1 A;  4MZT A;  1BYM A;  3GF5 A;  1VQ9 A;  4KUL A;  4RG8 A;  4X9D A;  3L2Q A;  3L2R A;  3CCS T;  1R8O B;  3CCU A;  3G4S T;  2HQE A;  2O4X B;  4PJO F;  4M77 F;  3HKS A;  3PMI A;  3JCM g;  4C0D B;  3LWI A;  4DOW A;  2F69 A;  4J6W A;  2DKG A;  2L89 A;  1NZ9 A;  2O01 E;  3F70 A;  4N0A C;  3CCM T;  1Q81 C;  4EPC A;  4C92 B;  2KAF A;  4LD9 K;  3Q1J A;  2RHZ A;  3KUF A;  3TEE A;  2GCX A;  2XI9 A;  4QVC A;  1IZ6 A;  2MAM A;  2OTL A;  3P8H A;  3JCM e;  4XTW A;  4M7A B;  3CD6 A;  5GAM g;  3GIB A;  2VUB A;  1G3S A;  2DJZ A;  5LJ5 f;  3JSC A;  2MMP A;  1WJR A;  4ZN1 A;  4C92 G;  3OW2 S;  1YBY A;  3MCA B;  1BI2 A;  4Z02 A;  1KHC A;  2K4Y A;  3X28 B;  3PIP A;  3V8J A;  3WXM B;  4BY6 B;  3JCM Q;  4JLI A;  2DK3 A;  2DZC A;  2F5K A;  3OBY A;  3ZEH A;  4E7J A;  4EMH A;  3C12 A;  1KC8 C;  4M7A G;  1G5V A;  4ELY C;  4FM4 B;  3G71 A;  3V8K A;  4BE0 A;  4M7D D;  5FRM A;  3OW2 A;  4QQG A;  5GAM e;  3MEV A;  1S72 A;  4M75 C;  4C8Q D;  5DM7 R;  2LT1 A;  1Q81 U;  2GF7 A;  4QVZ A;  3JB9 H;  3C4S A;  3QJY A;  3G6E T;  3SWN B;  1N6A A;  4HKE A;  4O6J A;  1WPY A;  4M77 C;  4RCB A;  5LL6 S;  4PJO C;  3OSS C;  3GPL A;  3ZBD A;  3EFS A;  1VUB A;  2KVQ G;  3VJP A;  3L2V A;  3I56 T;  2GFA A;  5CAI A;  3A5Z B;  3S3N A;  3M56 A;  1G3Y A;  4LD6 A;  5CKE A;  5GAO r;  3MHX A;  2JUF A;  2QQS A;  4JRQ A;  4C92 E;  1PSE A;  2K3X A;  3A8L B;  3QHS A;  4C0Z A;  4ELZ C;  1JBM A;  2CZ0 B;  2I2L A;  3BY7 A;  1YJW A;  3LGL A;  3V7S A;  2K2V A;  4BI4 A;  5GAN 2;  4LDW A;  2X35 A;  2PVG B;  4M75 G;  3RUX A;  5CR2 A;  3L1A A;  4M7A E;  3E9G A;  4LDU A;  3CC4 A;  1W4S A;  3MEA A;  5IN1 A;  4BDY A;  2LDM A;  3JB9 F;  1N27 A;  4JS5 A;  1B34 B;  3JB9 J;  1M5Q 1;  4XTU A;  4OB0 B;  2CS7 A;  5C0M A;  4XTX A;  4F7U B;  3CMA T;  4PJO G;  2CKK A;  4XU3 A;  2QEX T;  2K57 A;  5GMK l;  1NE8 A;  3OS0 A;  1YIT T;  2JOY A;  4A4G A;  4PLI A;  3I55 A;  1K73 C;  2EYQ A;  3LLR A;  2RO0 A;  2DTO A;  2V8J A;  3M59 A;  5KE2 A;  2RHX A;  1BIB A;  4EMK A;  4X9C A;  4JDS A;  2QXF A;  1YJN T;  4MML A;  4UC4 A;  4F7U G;  3CCV T;  1QP3 A;  5GAN 8;  1DJ7 B;  3CC2 A;  3HFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...