2PUQL

Crystal structure of active site inhibited coagulation factor viia in complex with soluble tissue factor
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
94
structure length
94
Chain Sequence
QCASSPCQNGGSCKDQLQSYICFCLPAFEGRNCETHKDDQLICVNENGGCEQYCSDHTGTKRSCRCHEGYSLLADGVSCTPTVEYPCGKIPILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering the substrate and inhibitor specificities of human coagulation Factor VIIa
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Coagulation factor VII
total genus 17
structure length 94
sequence length 94
ec nomenclature ec 3.4.21.21: Coagulation factor VIIa.
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00008 EGF EGF-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 2puqL02
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 2puqL01
2G00L 2WPJE 1IQIL 3CS7L 2W2QE 2BOKL 4G1MB 1G1RA 4Y7BB 1JBUL 4CUFA 3M37L 1XKBA 1HREA 3BPSE 5FDQA 1TPGA 4Z6AL 4E1GA 4D90A 1TOZA 1IOEL 3KRKA 2PR3B 1B9WA 1ATAA 2H9EL 3H5CB 5E8DA 5JB9E 5IKQA 3V65B 4COXA 1J9CL 1KLOA 2P16L 1FE2A 4JYVL 3CA7A 1KSNB 4BDXA 1XKAL 2ADXA 2Y5FL 1PFXL 1F0SB 2P28B 2Y7ZB 2FD6A 4RS0A 1NT0A 2BMGA 2DDUA 3Q3KB 2M74A 5CKQA 4BXWA 2VWOL 2Y80B 4NG9L 2F9BL 2B7DL 1L5GB 3QCWA 3NTGA 1EQHA 3N8XA 2J4IB 1IGXA 2KL7A 4D0EA 4ZAEB 2VH6B 3TK5B 1XDTR 1IQLL 5IKRA 3NT1A 4ISIL 2P3FN 3SOVA 1LQDA 2JKHL 4CUDA 3POYA 3OLTA 1C5MF 2RNLA 1YO8A 3SW2A 2P26A 3IITB 2UWOB 2AYLA 3LC3B 2XBWL 2Y38A 2YGPA 1HT5A 4TGFA 5CKMA 3HPTA 1YUGA 3QMOA 1HCGB 1URKA 4OTJA 1IVOC 1UZPA 1G2LB 3KQDL 2NPRA 3TBDA 1P0SL 2VVCK 5CKNA 1EPJA 1BF9A 4JZDL 2W26B 4FM5A 3GCWE 1CCFA 1V3XB 3TZIA 2FLBL 1IOXA 4BXSA 4BTTA 2W2PE 1EAIC 2WYGB 1LMJA 1KLIL 2VVVL 1NPEB 2K2TA 3FFGL 2XC5L 4O1ZA 4LORA 4X8SL 3ZYGA 1DIYA 2MHPA 3N8ZA 2VWNL 4RUTA 3HO4A 2K2SB 1G1SA 3K9XA 1YUKB 3N8WA 2XBYL 2Q1JB 1LPKA 6COXA 5COXA 3F6UL 5K0HB 3TK6B 5JVZA 3P5BL 1CEJA 5I46L 1IQML 4ZHAB 3GCXE 1IQGL 1ATEA 3U73A 3CENL 1ATBA 2OYUP 2Y5GL 2EI8B 5JBCE 4RRXA 4Y71B 1MOXC 4BTUA 2XC4L 5L30L 4C16A 4RRWA 1WHFA 3ENSA 1OB1C 3LTFB 2UWPB 1Q4GA 1UZQA 2I9AA 3FCSB 3OLUA 1CVWL 2TGFA 4Z0LA 1HT8A 4Y6DB 1UZJA 2P3FL 1ADXA 5L2ZL 5F1AA 3MDLA 1APQA 5JB8E 3IJEB 1TLEA 2WFXB 1F0RB 4YZUB 1EPGA 4X8VL 1NFYB 1DX5I 3F1SB 4D0FA 2WPME 2Y81B 1A3PA 2WG4B 3HO5A 2FLRL 2VWLL 4X8UL 3FBYA 2W2OE 3N8WB 1GK5A 4MMZB 1FF7A 1O5DL 4ZXYL 5JBBE 3TGFA 1WU1B 5EGMB 3RR3A 3TH3L 5IKTA 4BDWA 3QH0A 3V64C 3BT2A 4CSYA 1IQKL 1NFUB 3KL6B 3LIWB 4BTIA 2BOXA 1G2MB 1NFXB 1G1TA 2WFTA 2Y7XB 3NJPC 2BQWA 1EMNA 2BO2A 1IQNL 2BOHA 3LAQA 5KIRA 1HJ7A 5CISA 4Y7AB 1W7XL 1P9JA 1AUTL 1LPZA 2BQ6A 2BQ7A 1DVAL 4NA9L 1IQJL 4JYUL 2BOUA 4XBMA 5KN5C 1CX2A 1EPIA 2P3TA 1M1XB 1CVUA 3C9AC 2J34B 1KIGL 3LC5B 2BZ6L 1FSBA 5JVYA 2EI6B 2VJ3A 4ISHL 5JW1A 1NFWB 2CJIB 1N1IA 3SOBB 2WPKE 1F7MA 2J94B 3KCGL 1NQLB 4CUEA 1K36A 2MGPA 3PGHA 2XBXL 2Y5HL 4Y79B 2W3KB 4ZH8B 1MQ6L 1ZAQA 3GISX 5L2YL 3DEMA 2D1JB 1JL9A 2FZZL 5F19A 3Q7DA 1G1QA 1F7EA 1HRFA 1DQBA 2KB9A 1HAFA 2W3IB 1CQEA 1IP0A 1N7DA 2MGRA 4JZFL 1EPHA 1JV2B 3HS7A 3N8YB 1PXXA 2GD4A 3HO3A 1IGZA 2J38B 2EI7B 1IJQA 1EBVA 3KQEL 4ZXXL 3R05A 1EQGA 1Z6CA 2PUQL 4MMXB 1APOA 2XC0L 3HS6A 4YT7L 4Z0KB 2WPLE 1ATDA 1HAEA 1K37A 2RHPA 1YUFA 2YGOA 4AQTA 1W8BL 3ELAL 1COUA 2WYJB 1LPGA 4YT6L 2OYEP 1EMOA 3KQBL 1PTHA 2VVUL 2J95B 2RA0L 4M10A 3NTBA 4LMFA 2FLGA 4O02B 3LN1A 1HX2A 1UZKA 4NGAL 1RFNB 2P95L 4RRZA 1IQHL 3MQEA 1I0UA 1FFMA 1PRHA 1PGEA 1NZIA 3SOQA 1U67A 3KQCL 3KK6A 2WPHE 1SZBA 4Y76B 4PH9A 4X8TL 1MQ5L 2W86A 2XBVL 4M11A 2W2ME 1YGCL 1FJSL 1KLJL 2W2NE 1XFEA 3LN0A 2UWLB 3EGFA 1Z6EL 3ZYJB 2Y82B 2PHBB 4JZEL 1EGFA 5JBAE 1CCVA 2WPIE 4RRYA 4XL1A 1EZQB 1U8CB 3BT1A 1X7AL 2I9BA 2P94L 2VH0B 1IQFL 3N8VA 3M36L 1HZ8A 4A7IA 1FAXL 4OTYA 2P3UA 3LTGD 2P93L 3ZYIB 2J2UB 3ASIA 2VWMK 5IKVA 3N8YA 4XLWA 4MMYB 3HS5A 2WG3C 1QFKL 2KV4A 1L3YA 3CFWA 1IQEL 1DDXA 1FAKL 3U7UG 1WHEA
chains in the Genus database with same CATH superfamily
2G00L 2WPJE 1IQIL 3CS7L 2W2QE 2BOKL 4G1MB 1G1RA 4Y7BB 2BSFA 1JBUL 4CUFA 3M37L 1XKBA 1HREA 3BPSE 5FDQA 1TPGA 4Z6AL 4E1GA 2BT7A 4D90A 1TOZA 1IOEL 3KRKA 2PR3B 1B9WA 1ATAA 2H9EL 3H5CB 5E8DA 5JB9E 5IKQA 3V65B 4COXA 1J9CL 1KLOA 2P16L 1FE2A 4JYVL 3CA7A 1KSNB 4BDXA 1XKAL 2ADXA 2Y5FL 1PFXL 1F0SB 2P28B 2Y7ZB 2FD6A 4RS0A 1NT0A 2BMGA 2DDUA 1KKEA 3Q3KB 2M74A 5CKQA 4BXWA 2VWOL 3S6XA 2Y80B 4NG9L 2F9BL 2B7DL 1L5GB 3QCWA 3NTGA 1EQHA 3N8XA 2J4IB 1IGXA 2KL7A 4D0EA 4ZAEB 2VH6B 3TK5B 1XDTR 1IQLL 5IKRA 3NT1A 4ISIL 2P3FN 3SOVA 1LQDA 2JKHL 4CUDA 3POYA 3OLTA 1C5MF 2RNLA 1YO8A 3SW2A 2P26A 3IITB 2UWOB 2AYLA 3LC3B 2XBWL 2Y38A 2YGPA 1HT5A 4TGFA 5CKMA 3HPTA 1YUGA 3QMOA 1HCGB 1URKA 4OTJA 1IVOC 1UZPA 1G2LB 3KQDL 2NPRA 3TBDA 1P0SL 2VVCK 5CKNA 1EPJA 1BF9A 4JZDL 2W26B 4FM5A 3GCWE 1CCFA 1V3XB 3TZIA 2FLBL 1IOXA 4BXSA 4BTTA 2W2PE 1EAIC 2WYGB 1LMJA 1KLIL 2VVVL 1NPEB 2K2TA 3FFGL 2XC5L 4O1ZA 4LORA 4X8SL 3ZYGA 1DIYA 2MHPA 3N8ZA 2VWNL 4RUTA 3HO4A 2K2SB 2HOXA 1G1SA 3K9XA 1YUKB 3N8WA 1LK9A 2XBYL 2Q1JB 1LPKA 6COXA 1LMMA 5COXA 3F6UL 5K0HB 3TK6B 5JVZA 3P5BL 1CEJA 5I46L 1IQML 2H9EC 4ZHAB 2VRSA 3GCXE 1IQGL 1ATEA 3U73A 3CENL 1ATBA 2OYUP 2Y5GL 2YGQA 2EI8B 5JBCE 4RRXA 4Y71B 1MOXC 4BTUA 2XC4L 5L30L 4C16A 4RRWA 2KNIA 1WHFA 3ENSA 1OB1C 3LTFB 2UWPB 1Q4GA 1UZQA 2I9AA 3FCSB 3OLUA 1CVWL 2TGFA 4Z0LA 1HT8A 4Y6DB 1UZJA 1V1HA 2P3FL 1ADXA 5L2ZL 5F1AA 3MDLA 1APQA 5JB8E 3IJEB 1TLEA 2WFXB 1F0RB 4YZUB 1EPGA 4X8VL 1NFYB 1DX5I 3F1SB 4D0FA 2WPME 2Y81B 1A3PA 2WG4B 3HO5A 2FLRL 2VWLL 4X8UL 3FBYA 2W2OE 3N8WB 1GK5A 4MMZB 1FF7A 1O5DL 4ZXYL 5JBBE 3TGFA 1WU1B 5EGMB 3RR3A 3TH3L 5IKTA 4BDWA 3QH0A 3V64C 3BT2A 4CSYA 1IQKL 1NFUB 3KL6B 3LIWB 4BTIA 2BOXA 1G2MB 1NFXB 1G1TA 2WFTA 2Y7XB 3NJPC 2BQWA 1EMNA 2BO2A 1IQNL 2BOHA 3LAQA 5KIRA 1HJ7A 5CISA 4Y7AB 1W7XL 1P9JA 1AUTL 1LPZA 2BQ6A 2BQ7A 1DVAL 4NA9L 1IQJL 4JYUL 2BOUA 2BT8A 4XBMA 5KN5C 1CX2A 1EPIA 2P3TA 1M1XB 1CVUA 3C9AC 2WZPP 2J34B 1KIGL 3LC5B 2BZ6L 1FSBA 5JVYA 2EI6B 2VJ3A 4ISHL 5JW1A 1NFWB 2CJIB 1N1IA 4GU4A 3SOBB 2WPKE 1F7MA 2JJLA 2J94B 3KCGL 1NQLB 4CUEA 1K36A 2MGPA 3PGHA 2XBXL 2Y5HL 4Y79B 2W3KB 4ZH8B 1MQ6L 1ZAQA 3GISX 5L2YL 3DEMA 2D1JB 1JL9A 2FZZL 5F19A 3Q7DA 1G1QA 1F7EA 1HRFA 1DQBA 2KB9A 1HAFA 2W3IB 1CQEA 1IP0A 1N7DA 2MGRA 4JZFL 1EPHA 1JV2B 3HS7A 3N8YB 1PXXA 2GD4A 3HO3A 1IGZA 2J38B 2EI7B 1IJQA 1EBVA 3KQEL 4ZXXL 3R05A 1EQGA 1Z6CA 2PUQL 4MMXB 1APOA 2XC0L 3HS6A 4YT7L 4Z0KB 2WPLE 1ATDA 1HAEA 1K37A 2RHPA 4GU3A 1YUFA 2YGOA 4AQTA 1W8BL 3ELAL 1COUA 2WYJB 1LPGA 4YT6L 2OYEP 1EMOA 3KQBL 1PTHA 2VVUL 1V1IA 2HORA 2J95B 2RA0L 4M10A 3NTBA 4LMFA 2FLGA 4O02B 3LN1A 1HX2A 1UZKA 4NGAL 1RFNB 2P95L 4RRZA 1IQHL 3MQEA 1I0UA 1FFMA 1PRHA 1PGEA 1NZIA 3SOQA 1U67A 3KQCL 3KK6A 2WPHE 1SZBA 4Y76B 4PH9A 4X8TL 1MQ5L 2W86A 2XBVL 4M11A 2W2ME 1YGCL 1FJSL 1KLJL 2W2NE 1XFEA 3LN0A 2UWLB 3EGFA 1Z6EL 3ZYJB 2Y82B 2PHBB 4JZEL 1EGFA 5JBAE 1CCVA 2WPIE 4RRYA 4XL1A 1EZQB 1U8CB 3BT1A 1X7AL 2I9BA 2P94L 4A94C 2VH0B 1IQFL 3N8VA 3M36L 1HZ8A 4A7IA 1FAXL 4OTYA 2P3UA 3LTGD 2P93L 3ZYIB 2J2UB 1QIUA 3ASIA 2VWMK 5IKVA 3N8YA 4XLWA 4MMYB 3HS5A 2WG3C 1QFKL 2KV4A 1L3YA 3CFWA 1IQEL 1DDXA 1FAKL 3U7UG 1WHEA
chains in the Genus database with same CATH topology
2G00L 2WPJE 1IQIL 3CS7L 2W2QE 2BOKL 4G1MB 1G1RA 4Y7BB 1JBUL 4CUFA 3M37L 1XKBA 1HREA 3BPSE 5FDQA 1TPGA 4Z6AL 4E1GA 4D90A 1TOZA 1IOEL 3KRKA 2PR3B 1B9WA 1ATAA 2H9EL 3H5CB 5E8DA 5JB9E 5IKQA 3V65B 4COXA 1J9CL 1KLOA 2P16L 1FE2A 4JYVL 3CA7A 1KSNB 4BDXA 1XKAL 2ADXA 2Y5FL 1PFXL 1F0SB 2P28B 2Y7ZB 2FD6A 4RS0A 1NT0A 2BMGA 2DDUA 3Q3KB 2M74A 5CKQA 4BXWA 2VWOL 3S6XA 2Y80B 4NG9L 2F9BL 2B7DL 1L5GB 3QCWA 3NTGA 1EQHA 3N8XA 2J4IB 1IGXA 2KL7A 4D0EA 4ZAEB 2VH6B 3TK5B 1XDTR 1IQLL 5IKRA 3NT1A 4ISIL 2P3FN 3SOVA 1LQDA 2JKHL 4CUDA 3POYA 3OLTA 1C5MF 2RNLA 1YO8A 3SW2A 2P26A 3IITB 2UWOB 2AYLA 3LC3B 2XBWL 2Y38A 2YGPA 1HT5A 4TGFA 5CKMA 3HPTA 1YUGA 3QMOA 1HCGB 1URKA 4OTJA 1IVOC 1UZPA 1G2LB 3KQDL 2NPRA 3TBDA 1P0SL 2VVCK 5CKNA 1EPJA 1BF9A 4JZDL 2W26B 4FM5A 3GCWE 1CCFA 1V3XB 3TZIA 2FLBL 1IOXA 4BXSA 4BTTA 2W2PE 1EAIC 2WYGB 1LMJA 1KLIL 2VVVL 1NPEB 2K2TA 3FFGL 2XC5L 4O1ZA 4LORA 4X8SL 3ZYGA 1DIYA 2MHPA 3N8ZA 2VWNL 4RUTA 3HO4A 2K2SB 1G1SA 3K9XA 1YUKB 3N8WA 2XBYL 2Q1JB 1LPKA 6COXA 1LMMA 5COXA 3F6UL 5K0HB 3TK6B 5JVZA 3P5BL 1CEJA 5I46L 1IQML 2H9EC 4ZHAB 3GCXE 1IQGL 1ATEA 3U73A 3CENL 1ATBA 2OYUP 2Y5GL 2YGQA 2EI8B 5JBCE 4RRXA 4Y71B 1MOXC 4BTUA 2XC4L 5L30L 4C16A 4RRWA 2KNIA 1WHFA 3ENSA 1OB1C 3LTFB 2UWPB 1Q4GA 1UZQA 2I9AA 3FCSB 3OLUA 1CVWL 2TGFA 4Z0LA 1HT8A 4Y6DB 1UZJA 2P3FL 1ADXA 5L2ZL 5F1AA 3MDLA 1APQA 5JB8E 3IJEB 1TLEA 2WFXB 1F0RB 4YZUB 1EPGA 4X8VL 1NFYB 1DX5I 3F1SB 4D0FA 2WPME 2Y81B 1A3PA 2WG4B 3HO5A 2FLRL 2VWLL 4X8UL 3FBYA 2W2OE 3N8WB 1GK5A 4MMZB 1FF7A 1O5DL 4ZXYL 5JBBE 3TGFA 1WU1B 5EGMB 3RR3A 3TH3L 5IKTA 4BDWA 3QH0A 3V64C 3BT2A 4CSYA 1IQKL 1NFUB 3KL6B 3LIWB 4BTIA 2BOXA 1G2MB 1NFXB 1G1TA 2WFTA 2Y7XB 3NJPC 2BQWA 1EMNA 2BO2A 1IQNL 2BOHA 3LAQA 5KIRA 1HJ7A 5CISA 4Y7AB 1W7XL 1P9JA 1AUTL 1LPZA 2BQ6A 2BQ7A 1DVAL 4NA9L 1IQJL 4JYUL 2BOUA 4XBMA 5KN5C 1CX2A 1EPIA 2P3TA 1M1XB 1CVUA 3C9AC 2WZPP 2J34B 1KIGL 3LC5B 2BZ6L 1FSBA 5JVYA 2EI6B 2VJ3A 4ISHL 5JW1A 1NFWB 2CJIB 1N1IA 3SOBB 2WPKE 1F7MA 2J94B 3KCGL 1NQLB 4CUEA 1K36A 2MGPA 3PGHA 2XBXL 2Y5HL 4Y79B 2W3KB 4ZH8B 1MQ6L 1ZAQA 3GISX 5L2YL 3DEMA 2D1JB 1JL9A 2FZZL 5F19A 3Q7DA 1G1QA 1F7EA 1HRFA 1DQBA 2KB9A 1HAFA 2W3IB 1CQEA 1IP0A 1N7DA 2MGRA 4JZFL 1EPHA 1JV2B 3HS7A 3N8YB 1PXXA 2GD4A 3HO3A 1IGZA 2J38B 2EI7B 1IJQA 1EBVA 3KQEL 4ZXXL 3R05A 1EQGA 1Z6CA 2PUQL 4MMXB 1APOA 2XC0L 3HS6A 4YT7L 4Z0KB 2WPLE 1ATDA 1HAEA 1K37A 2RHPA 1YUFA 2YGOA 4AQTA 1W8BL 3ELAL 1COUA 2WYJB 1LPGA 4YT6L 2OYEP 1EMOA 3KQBL 1PTHA 2VVUL 2J95B 2RA0L 4M10A 3NTBA 4LMFA 2FLGA 4O02B 3LN1A 1HX2A 1UZKA 4NGAL 1RFNB 2P95L 4RRZA 1IQHL 3MQEA 1I0UA 1FFMA 1PRHA 1PGEA 1NZIA 3SOQA 1U67A 3KQCL 3KK6A 2WPHE 1SZBA 4Y76B 4PH9A 4X8TL 1MQ5L 2W86A 2XBVL 4M11A 2W2ME 1YGCL 1FJSL 1KLJL 2W2NE 1XFEA 3LN0A 2UWLB 3EGFA 1Z6EL 3ZYJB 2Y82B 2PHBB 4JZEL 1EGFA 5JBAE 1CCVA 2WPIE 4RRYA 4XL1A 1EZQB 1U8CB 3BT1A 1X7AL 2I9BA 2P94L 4A94C 2VH0B 1IQFL 3N8VA 3M36L 1HZ8A 4A7IA 1FAXL 4OTYA 2P3UA 3LTGD 2P93L 3ZYIB 2J2UB 3ASIA 2VWMK 5IKVA 3N8YA 4XLWA 4MMYB 3HS5A 2WG3C 1QFKL 2KV4A 1L3YA 3CFWA 1IQEL 1DDXA 1FAKL 3U7UG 1WHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G00 L;  2WPJ E;  1IQI L;  3CS7 L;  2W2Q E;  2BOK L;  4G1M B;  1G1R A;  4Y7B B;  1JBU L;  4CUF A;  3M37 L;  1XKB A;  1HRE A;  3BPS E;  5FDQ A;  1TPG A;  4Z6A L;  4E1G A;  4D90 A;  1TOZ A;  1IOE L;  3KRK A;  2PR3 B;  1B9W A;  1ATA A;  2H9E L;  3H5C B;  5E8D A;  5JB9 E;  5IKQ A;  3V65 B;  4COX A;  1J9C L;  1KLO A;  2P16 L;  1FE2 A;  4JYV L;  3CA7 A;  1KSN B;  4BDX A;  1XKA L;  2ADX A;  2Y5F L;  1PFX L;  1F0S B;  2P28 B;  2Y7Z B;  2FD6 A;  4RS0 A;  1NT0 A;  2BMG A;  2DDU A;  3Q3K B;  2M74 A;  5CKQ A;  4BXW A;  2VWO L;  2Y80 B;  4NG9 L;  2F9B L;  2B7D L;  1L5G B;  3QCW A;  3NTG A;  1EQH A;  3N8X A;  2J4I B;  1IGX A;  2KL7 A;  4D0E A;  4ZAE B;  2VH6 B;  3TK5 B;  1XDT R;  1IQL L;  5IKR A;  3NT1 A;  4ISI L;  2P3F N;  3SOV A;  1LQD A;  2JKH L;  4CUD A;  3POY A;  3OLT A;  1C5M F;  2RNL A;  1YO8 A;  3SW2 A;  2P26 A;  3IIT B;  2UWO B;  2AYL A;  3LC3 B;  2XBW L;  2Y38 A;  2YGP A;  1HT5 A;  4TGF A;  5CKM A;  3HPT A;  1YUG A;  3QMO A;  1HCG B;  1URK A;  4OTJ A;  1IVO C;  1UZP A;  1G2L B;  3KQD L;  2NPR A;  3TBD A;  1P0S L;  2VVC K;  5CKN A;  1EPJ A;  1BF9 A;  4JZD L;  2W26 B;  4FM5 A;  3GCW E;  1CCF A;  1V3X B;  3TZI A;  2FLB L;  1IOX A;  4BXS A;  4BTT A;  2W2P E;  1EAI C;  2WYG B;  1LMJ A;  1KLI L;  2VVV L;  1NPE B;  2K2T A;  3FFG L;  2XC5 L;  4O1Z A;  4LOR A;  4X8S L;  3ZYG A;  1DIY A;  2MHP A;  3N8Z A;  2VWN L;  4RUT A;  3HO4 A;  2K2S B;  1G1S A;  3K9X A;  1YUK B;  3N8W A;  2XBY L;  2Q1J B;  1LPK A;  6COX A;  5COX A;  3F6U L;  5K0H B;  3TK6 B;  5JVZ A;  3P5B L;  1CEJ A;  5I46 L;  1IQM L;  4ZHA B;  3GCX E;  1IQG L;  1ATE A;  3U73 A;  3CEN L;  1ATB A;  2OYU P;  2Y5G L;  2EI8 B;  5JBC E;  4RRX A;  4Y71 B;  1MOX C;  4BTU A;  2XC4 L;  5L30 L;  4C16 A;  4RRW A;  1WHF A;  3ENS A;  1OB1 C;  3LTF B;  2UWP B;  1Q4G A;  1UZQ A;  2I9A A;  3FCS B;  3OLU A;  1CVW L;  2TGF A;  4Z0L A;  1HT8 A;  4Y6D B;  1UZJ A;  2P3F L;  1ADX A;  5L2Z L;  5F1A A;  3MDL A;  1APQ A;  5JB8 E;  3IJE B;  1TLE A;  2WFX B;  1F0R B;  4YZU B;  1EPG A;  4X8V L;  1NFY B;  1DX5 I;  3F1S B;  4D0F A;  2WPM E;  2Y81 B;  1A3P A;  2WG4 B;  3HO5 A;  2FLR L;  2VWL L;  4X8U L;  3FBY A;  2W2O E;  3N8W B;  1GK5 A;  4MMZ B;  1FF7 A;  1O5D L;  4ZXY L;  5JBB E;  3TGF A;  1WU1 B;  5EGM B;  3RR3 A;  3TH3 L;  5IKT A;  4BDW A;  3QH0 A;  3V64 C;  3BT2 A;  4CSY A;  1IQK L;  1NFU B;  3KL6 B;  3LIW B;  4BTI A;  2BOX A;  1G2M B;  1NFX B;  1G1T A;  2WFT A;  2Y7X B;  3NJP C;  2BQW A;  1EMN A;  2BO2 A;  1IQN L;  2BOH A;  3LAQ A;  5KIR A;  1HJ7 A;  5CIS A;  4Y7A B;  1W7X L;  1P9J A;  1AUT L;  1LPZ A;  2BQ6 A;  2BQ7 A;  1DVA L;  4NA9 L;  1IQJ L;  4JYU L;  2BOU A;  4XBM A;  5KN5 C;  1CX2 A;  1EPI A;  2P3T A;  1M1X B;  1CVU A;  3C9A C;  2J34 B;  1KIG L;  3LC5 B;  2BZ6 L;  1FSB A;  5JVY A;  2EI6 B;  2VJ3 A;  4ISH L;  5JW1 A;  1NFW B;  2CJI B;  1N1I A;  3SOB B;  2WPK E;  1F7M A;  2J94 B;  3KCG L;  1NQL B;  4CUE A;  1K36 A;  2MGP A;  3PGH A;  2XBX L;  2Y5H L;  4Y79 B;  2W3K B;  4ZH8 B;  1MQ6 L;  1ZAQ A;  3GIS X;  5L2Y L;  3DEM A;  2D1J B;  1JL9 A;  2FZZ L;  5F19 A;  3Q7D A;  1G1Q A;  1F7E A;  1HRF A;  1DQB A;  2KB9 A;  1HAF A;  2W3I B;  1CQE A;  1IP0 A;  1N7D A;  2MGR A;  4JZF L;  1EPH A;  1JV2 B;  3HS7 A;  3N8Y B;  1PXX A;  2GD4 A;  3HO3 A;  1IGZ A;  2J38 B;  2EI7 B;  1IJQ A;  1EBV A;  3KQE L;  4ZXX L;  3R05 A;  1EQG A;  1Z6C A;  2PUQ L;  4MMX B;  1APO A;  2XC0 L;  3HS6 A;  4YT7 L;  4Z0K B;  2WPL E;  1ATD A;  1HAE A;  1K37 A;  2RHP A;  1YUF A;  2YGO A;  4AQT A;  1W8B L;  3ELA L;  1COU A;  2WYJ B;  1LPG A;  4YT6 L;  2OYE P;  1EMO A;  3KQB L;  1PTH A;  2VVU L;  2J95 B;  2RA0 L;  4M10 A;  3NTB A;  4LMF A;  2FLG A;  4O02 B;  3LN1 A;  1HX2 A;  1UZK A;  4NGA L;  1RFN B;  2P95 L;  4RRZ A;  1IQH L;  3MQE A;  1I0U A;  1FFM A;  1PRH A;  1PGE A;  1NZI A;  3SOQ A;  1U67 A;  3KQC L;  3KK6 A;  2WPH E;  1SZB A;  4Y76 B;  4PH9 A;  4X8T L;  1MQ5 L;  2W86 A;  2XBV L;  4M11 A;  2W2M E;  1YGC L;  1FJS L;  1KLJ L;  2W2N E;  1XFE A;  3LN0 A;  2UWL B;  3EGF A;  1Z6E L;  3ZYJ B;  2Y82 B;  2PHB B;  4JZE L;  1EGF A;  5JBA E;  1CCV A;  2WPI E;  4RRY A;  4XL1 A;  1EZQ B;  1U8C B;  3BT1 A;  1X7A L;  2I9B A;  2P94 L;  2VH0 B;  1IQF L;  3N8V A;  3M36 L;  1HZ8 A;  4A7I A;  1FAX L;  4OTY A;  2P3U A;  3LTG D;  2P93 L;  3ZYI B;  2J2U B;  3ASI A;  2VWM K;  5IKV A;  3N8Y A;  4XLW A;  4MMY B;  3HS5 A;  2WG3 C;  1QFK L;  2KV4 A;  1L3Y A;  3CFW A;  1IQE L;  1DDX A;  1FAK L;  3U7U G;  1WHE A; 
#chains in the Genus database with same CATH topology
 2G00 L;  2WPJ E;  1IQI L;  3CS7 L;  2W2Q E;  2BOK L;  4G1M B;  1G1R A;  4Y7B B;  2BSF A;  1JBU L;  4CUF A;  3M37 L;  1XKB A;  1HRE A;  3BPS E;  5FDQ A;  1TPG A;  4Z6A L;  4E1G A;  2BT7 A;  4D90 A;  1TOZ A;  1IOE L;  3KRK A;  2PR3 B;  1B9W A;  1ATA A;  2H9E L;  3H5C B;  5E8D A;  5JB9 E;  5IKQ A;  3V65 B;  4COX A;  1J9C L;  1KLO A;  2P16 L;  1FE2 A;  4JYV L;  3CA7 A;  1KSN B;  4BDX A;  1XKA L;  2ADX A;  2Y5F L;  1PFX L;  1F0S B;  2P28 B;  2Y7Z B;  2FD6 A;  4RS0 A;  1NT0 A;  2BMG A;  2DDU A;  1KKE A;  3Q3K B;  2M74 A;  5CKQ A;  4BXW A;  2VWO L;  3S6X A;  2Y80 B;  4NG9 L;  2F9B L;  2B7D L;  1L5G B;  3QCW A;  3NTG A;  1EQH A;  3N8X A;  2J4I B;  1IGX A;  2KL7 A;  4D0E A;  4ZAE B;  2VH6 B;  3TK5 B;  1XDT R;  1IQL L;  5IKR A;  3NT1 A;  4ISI L;  2P3F N;  3SOV A;  1LQD A;  2JKH L;  4CUD A;  3POY A;  3OLT A;  1C5M F;  2RNL A;  1YO8 A;  3SW2 A;  2P26 A;  3IIT B;  2UWO B;  2AYL A;  3LC3 B;  2XBW L;  2Y38 A;  2YGP A;  1HT5 A;  4TGF A;  5CKM A;  3HPT A;  1YUG A;  3QMO A;  1HCG B;  1URK A;  4OTJ A;  1IVO C;  1UZP A;  1G2L B;  3KQD L;  2NPR A;  3TBD A;  1P0S L;  2VVC K;  5CKN A;  1EPJ A;  1BF9 A;  4JZD L;  2W26 B;  4FM5 A;  3GCW E;  1CCF A;  1V3X B;  3TZI A;  2FLB L;  1IOX A;  4BXS A;  4BTT A;  2W2P E;  1EAI C;  2WYG B;  1LMJ A;  1KLI L;  2VVV L;  1NPE B;  2K2T A;  3FFG L;  2XC5 L;  4O1Z A;  4LOR A;  4X8S L;  3ZYG A;  1DIY A;  2MHP A;  3N8Z A;  2VWN L;  4RUT A;  3HO4 A;  2K2S B;  2HOX A;  1G1S A;  3K9X A;  1YUK B;  3N8W A;  1LK9 A;  2XBY L;  2Q1J B;  1LPK A;  6COX A;  1LMM A;  5COX A;  3F6U L;  5K0H B;  3TK6 B;  5JVZ A;  3P5B L;  1CEJ A;  5I46 L;  1IQM L;  2H9E C;  4ZHA B;  2VRS A;  3GCX E;  1IQG L;  1ATE A;  3U73 A;  3CEN L;  1ATB A;  2OYU P;  2Y5G L;  2YGQ A;  2EI8 B;  5JBC E;  4RRX A;  4Y71 B;  1MOX C;  4BTU A;  2XC4 L;  5L30 L;  4C16 A;  4RRW A;  2KNI A;  1WHF A;  3ENS A;  1OB1 C;  3LTF B;  2UWP B;  1Q4G A;  1UZQ A;  2I9A A;  3FCS B;  3OLU A;  1CVW L;  2TGF A;  4Z0L A;  1HT8 A;  4Y6D B;  1UZJ A;  1V1H A;  2P3F L;  1ADX A;  5L2Z L;  5F1A A;  3MDL A;  1APQ A;  5JB8 E;  3IJE B;  1TLE A;  2WFX B;  1F0R B;  4YZU B;  1EPG A;  4X8V L;  1NFY B;  1DX5 I;  3F1S B;  4D0F A;  2WPM E;  2Y81 B;  1A3P A;  2WG4 B;  3HO5 A;  2FLR L;  2VWL L;  4X8U L;  3FBY A;  2W2O E;  3N8W B;  1GK5 A;  4MMZ B;  1FF7 A;  1O5D L;  4ZXY L;  5JBB E;  3TGF A;  1WU1 B;  5EGM B;  3RR3 A;  3TH3 L;  5IKT A;  4BDW A;  3QH0 A;  3V64 C;  3BT2 A;  4CSY A;  1IQK L;  1NFU B;  3KL6 B;  3LIW B;  4BTI A;  2BOX A;  1G2M B;  1NFX B;  1G1T A;  2WFT A;  2Y7X B;  3NJP C;  2BQW A;  1EMN A;  2BO2 A;  1IQN L;  2BOH A;  3LAQ A;  5KIR A;  1HJ7 A;  5CIS A;  4Y7A B;  1W7X L;  1P9J A;  1AUT L;  1LPZ A;  2BQ6 A;  2BQ7 A;  1DVA L;  4NA9 L;  1IQJ L;  4JYU L;  2BOU A;  2BT8 A;  4XBM A;  5KN5 C;  1CX2 A;  1EPI A;  2P3T A;  1M1X B;  1CVU A;  3C9A C;  2WZP P;  2J34 B;  1KIG L;  3LC5 B;  2BZ6 L;  1FSB A;  5JVY A;  2EI6 B;  2VJ3 A;  4ISH L;  5JW1 A;  1NFW B;  2CJI B;  1N1I A;  4GU4 A;  3SOB B;  2WPK E;  1F7M A;  2JJL A;  2J94 B;  3KCG L;  1NQL B;  4CUE A;  1K36 A;  2MGP A;  3PGH A;  2XBX L;  2Y5H L;  4Y79 B;  2W3K B;  4ZH8 B;  1MQ6 L;  1ZAQ A;  3GIS X;  5L2Y L;  3DEM A;  2D1J B;  1JL9 A;  2FZZ L;  5F19 A;  3Q7D A;  1G1Q A;  1F7E A;  1HRF A;  1DQB A;  2KB9 A;  1HAF A;  2W3I B;  1CQE A;  1IP0 A;  1N7D A;  2MGR A;  4JZF L;  1EPH A;  1JV2 B;  3HS7 A;  3N8Y B;  1PXX A;  2GD4 A;  3HO3 A;  1IGZ A;  2J38 B;  2EI7 B;  1IJQ A;  1EBV A;  3KQE L;  4ZXX L;  3R05 A;  1EQG A;  1Z6C A;  2PUQ L;  4MMX B;  1APO A;  2XC0 L;  3HS6 A;  4YT7 L;  4Z0K B;  2WPL E;  1ATD A;  1HAE A;  1K37 A;  2RHP A;  4GU3 A;  1YUF A;  2YGO A;  4AQT A;  1W8B L;  3ELA L;  1COU A;  2WYJ B;  1LPG A;  4YT6 L;  2OYE P;  1EMO A;  3KQB L;  1PTH A;  2VVU L;  1V1I A;  2HOR A;  2J95 B;  2RA0 L;  4M10 A;  3NTB A;  4LMF A;  2FLG A;  4O02 B;  3LN1 A;  1HX2 A;  1UZK A;  4NGA L;  1RFN B;  2P95 L;  4RRZ A;  1IQH L;  3MQE A;  1I0U A;  1FFM A;  1PRH A;  1PGE A;  1NZI A;  3SOQ A;  1U67 A;  3KQC L;  3KK6 A;  2WPH E;  1SZB A;  4Y76 B;  4PH9 A;  4X8T L;  1MQ5 L;  2W86 A;  2XBV L;  4M11 A;  2W2M E;  1YGC L;  1FJS L;  1KLJ L;  2W2N E;  1XFE A;  3LN0 A;  2UWL B;  3EGF A;  1Z6E L;  3ZYJ B;  2Y82 B;  2PHB B;  4JZE L;  1EGF A;  5JBA E;  1CCV A;  2WPI E;  4RRY A;  4XL1 A;  1EZQ B;  1U8C B;  3BT1 A;  1X7A L;  2I9B A;  2P94 L;  4A94 C;  2VH0 B;  1IQF L;  3N8V A;  3M36 L;  1HZ8 A;  4A7I A;  1FAX L;  4OTY A;  2P3U A;  3LTG D;  2P93 L;  3ZYI B;  2J2U B;  1QIU A;  3ASI A;  2VWM K;  5IKV A;  3N8Y A;  4XLW A;  4MMY B;  3HS5 A;  2WG3 C;  1QFK L;  2KV4 A;  1L3Y A;  3CFW A;  1IQE L;  1DDX A;  1FAK L;  3U7U G;  1WHE A; 
#chains in the Genus database with same CATH homology
 2G00 L;  2WPJ E;  1IQI L;  3CS7 L;  2W2Q E;  2BOK L;  4G1M B;  1G1R A;  4Y7B B;  1JBU L;  4CUF A;  3M37 L;  1XKB A;  1HRE A;  3BPS E;  5FDQ A;  1TPG A;  4Z6A L;  4E1G A;  4D90 A;  1TOZ A;  1IOE L;  3KRK A;  2PR3 B;  1B9W A;  1ATA A;  2H9E L;  3H5C B;  5E8D A;  5JB9 E;  5IKQ A;  3V65 B;  4COX A;  1J9C L;  1KLO A;  2P16 L;  1FE2 A;  4JYV L;  3CA7 A;  1KSN B;  4BDX A;  1XKA L;  2ADX A;  2Y5F L;  1PFX L;  1F0S B;  2P28 B;  2Y7Z B;  2FD6 A;  4RS0 A;  1NT0 A;  2BMG A;  2DDU A;  3Q3K B;  2M74 A;  5CKQ A;  4BXW A;  2VWO L;  3S6X A;  2Y80 B;  4NG9 L;  2F9B L;  2B7D L;  1L5G B;  3QCW A;  3NTG A;  1EQH A;  3N8X A;  2J4I B;  1IGX A;  2KL7 A;  4D0E A;  4ZAE B;  2VH6 B;  3TK5 B;  1XDT R;  1IQL L;  5IKR A;  3NT1 A;  4ISI L;  2P3F N;  3SOV A;  1LQD A;  2JKH L;  4CUD A;  3POY A;  3OLT A;  1C5M F;  2RNL A;  1YO8 A;  3SW2 A;  2P26 A;  3IIT B;  2UWO B;  2AYL A;  3LC3 B;  2XBW L;  2Y38 A;  2YGP A;  1HT5 A;  4TGF A;  5CKM A;  3HPT A;  1YUG A;  3QMO A;  1HCG B;  1URK A;  4OTJ A;  1IVO C;  1UZP A;  1G2L B;  3KQD L;  2NPR A;  3TBD A;  1P0S L;  2VVC K;  5CKN A;  1EPJ A;  1BF9 A;  4JZD L;  2W26 B;  4FM5 A;  3GCW E;  1CCF A;  1V3X B;  3TZI A;  2FLB L;  1IOX A;  4BXS A;  4BTT A;  2W2P E;  1EAI C;  2WYG B;  1LMJ A;  1KLI L;  2VVV L;  1NPE B;  2K2T A;  3FFG L;  2XC5 L;  4O1Z A;  4LOR A;  4X8S L;  3ZYG A;  1DIY A;  2MHP A;  3N8Z A;  2VWN L;  4RUT A;  3HO4 A;  2K2S B;  1G1S A;  3K9X A;  1YUK B;  3N8W A;  2XBY L;  2Q1J B;  1LPK A;  6COX A;  1LMM A;  5COX A;  3F6U L;  5K0H B;  3TK6 B;  5JVZ A;  3P5B L;  1CEJ A;  5I46 L;  1IQM L;  2H9E C;  4ZHA B;  3GCX E;  1IQG L;  1ATE A;  3U73 A;  3CEN L;  1ATB A;  2OYU P;  2Y5G L;  2YGQ A;  2EI8 B;  5JBC E;  4RRX A;  4Y71 B;  1MOX C;  4BTU A;  2XC4 L;  5L30 L;  4C16 A;  4RRW A;  2KNI A;  1WHF A;  3ENS A;  1OB1 C;  3LTF B;  2UWP B;  1Q4G A;  1UZQ A;  2I9A A;  3FCS B;  3OLU A;  1CVW L;  2TGF A;  4Z0L A;  1HT8 A;  4Y6D B;  1UZJ A;  2P3F L;  1ADX A;  5L2Z L;  5F1A A;  3MDL A;  1APQ A;  5JB8 E;  3IJE B;  1TLE A;  2WFX B;  1F0R B;  4YZU B;  1EPG A;  4X8V L;  1NFY B;  1DX5 I;  3F1S B;  4D0F A;  2WPM E;  2Y81 B;  1A3P A;  2WG4 B;  3HO5 A;  2FLR L;  2VWL L;  4X8U L;  3FBY A;  2W2O E;  3N8W B;  1GK5 A;  4MMZ B;  1FF7 A;  1O5D L;  4ZXY L;  5JBB E;  3TGF A;  1WU1 B;  5EGM B;  3RR3 A;  3TH3 L;  5IKT A;  4BDW A;  3QH0 A;  3V64 C;  3BT2 A;  4CSY A;  1IQK L;  1NFU B;  3KL6 B;  3LIW B;  4BTI A;  2BOX A;  1G2M B;  1NFX B;  1G1T A;  2WFT A;  2Y7X B;  3NJP C;  2BQW A;  1EMN A;  2BO2 A;  1IQN L;  2BOH A;  3LAQ A;  5KIR A;  1HJ7 A;  5CIS A;  4Y7A B;  1W7X L;  1P9J A;  1AUT L;  1LPZ A;  2BQ6 A;  2BQ7 A;  1DVA L;  4NA9 L;  1IQJ L;  4JYU L;  2BOU A;  4XBM A;  5KN5 C;  1CX2 A;  1EPI A;  2P3T A;  1M1X B;  1CVU A;  3C9A C;  2WZP P;  2J34 B;  1KIG L;  3LC5 B;  2BZ6 L;  1FSB A;  5JVY A;  2EI6 B;  2VJ3 A;  4ISH L;  5JW1 A;  1NFW B;  2CJI B;  1N1I A;  3SOB B;  2WPK E;  1F7M A;  2J94 B;  3KCG L;  1NQL B;  4CUE A;  1K36 A;  2MGP A;  3PGH A;  2XBX L;  2Y5H L;  4Y79 B;  2W3K B;  4ZH8 B;  1MQ6 L;  1ZAQ A;  3GIS X;  5L2Y L;  3DEM A;  2D1J B;  1JL9 A;  2FZZ L;  5F19 A;  3Q7D A;  1G1Q A;  1F7E A;  1HRF A;  1DQB A;  2KB9 A;  1HAF A;  2W3I B;  1CQE A;  1IP0 A;  1N7D A;  2MGR A;  4JZF L;  1EPH A;  1JV2 B;  3HS7 A;  3N8Y B;  1PXX A;  2GD4 A;  3HO3 A;  1IGZ A;  2J38 B;  2EI7 B;  1IJQ A;  1EBV A;  3KQE L;  4ZXX L;  3R05 A;  1EQG A;  1Z6C A;  2PUQ L;  4MMX B;  1APO A;  2XC0 L;  3HS6 A;  4YT7 L;  4Z0K B;  2WPL E;  1ATD A;  1HAE A;  1K37 A;  2RHP A;  1YUF A;  2YGO A;  4AQT A;  1W8B L;  3ELA L;  1COU A;  2WYJ B;  1LPG A;  4YT6 L;  2OYE P;  1EMO A;  3KQB L;  1PTH A;  2VVU L;  2J95 B;  2RA0 L;  4M10 A;  3NTB A;  4LMF A;  2FLG A;  4O02 B;  3LN1 A;  1HX2 A;  1UZK A;  4NGA L;  1RFN B;  2P95 L;  4RRZ A;  1IQH L;  3MQE A;  1I0U A;  1FFM A;  1PRH A;  1PGE A;  1NZI A;  3SOQ A;  1U67 A;  3KQC L;  3KK6 A;  2WPH E;  1SZB A;  4Y76 B;  4PH9 A;  4X8T L;  1MQ5 L;  2W86 A;  2XBV L;  4M11 A;  2W2M E;  1YGC L;  1FJS L;  1KLJ L;  2W2N E;  1XFE A;  3LN0 A;  2UWL B;  3EGF A;  1Z6E L;  3ZYJ B;  2Y82 B;  2PHB B;  4JZE L;  1EGF A;  5JBA E;  1CCV A;  2WPI E;  4RRY A;  4XL1 A;  1EZQ B;  1U8C B;  3BT1 A;  1X7A L;  2I9B A;  2P94 L;  4A94 C;  2VH0 B;  1IQF L;  3N8V A;  3M36 L;  1HZ8 A;  4A7I A;  1FAX L;  4OTY A;  2P3U A;  3LTG D;  2P93 L;  3ZYI B;  2J2U B;  3ASI A;  2VWM K;  5IKV A;  3N8Y A;  4XLW A;  4MMY B;  3HS5 A;  2WG3 C;  1QFK L;  2KV4 A;  1L3Y A;  3CFW A;  1IQE L;  1DDX A;  1FAK L;  3U7U G;  1WHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...