2PUQT

Crystal structure of active site inhibited coagulation factor viia in complex with soluble tissue factor
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
204
structure length
190
Chain Sequence
TVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYKTAKTNTNEFLIDVCFSVQAVIPSRTVNRKSTDSPVEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coagulation factor VII
publication title Engineering the substrate and inhibitor specificities of human coagulation Factor VIIa
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 38
structure length 190
sequence length 204
ec nomenclature
pdb deposition date 2007-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2puqT01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2puqT02
3SGJC 1BD2E 5GRJL 2L7JA 3KJ6L 2J5LC 3AUVA 4DW2L 3OXRA 5FHAL 5FB8B 3HC0B 1K4CB 4LVEA 1UKQA 4M5YH 5KSUA 5DD0H 3NMEA 1HQ4A 2YPKA 5IV2B 3M17B 4P4RB 4YC2C 2AABL 2I24N 1CE1H 1N59B 5DMGD 4BZ2L 4L3ED 4L4TD 2WBJC 3QCTH 1XF3A 1FRGH 1N5YL 3JWDC 1F00I 1BFVH 3PABB 3BZEA 5D70H 1TZHB 4UT9L 3IDJA 4L4VE 4ZO6A 5AUMA 4Z7VE 3BRDA 4G3YL 1PY4A 4JO4H 5A2LH 4Y4HD 5GISL 3UPCA 3GJFH 4D0BA 3HB3C 1C16B 4M93C 5DFVC 1BP3B 3VI4F 2CRIA 4D9RE 3ZKMC 4J3WA 3SDDD 5DLML 2NXYC 1ZWIA 5C0RL 1MFBL 1GPOL 5HVHC 5JUEL 4XX1E 1SJHA 4OUUB 3ZHKA 2DIJA 4HT1H 3U0WH 1ETZB 4TULL 1CLYH 3Q6GH 3BRFA 4MB5A 1V3JA 1N7ML 1N3NA 5TDNB 4IHOB 1E27B 1CIUA 4J4PC 4FG6C 5AAWA 1BFSA 5F70A 4OCXL 2BNRB 1YN7A 2FO4A 4GRWH 1FP5A 4UQ2B 5HYSG 3RFZC 3G5XA 2ERJC 1EHLH 4PRHA 2XQYK 3QEGH 2F54B 1BQLH 4PJCA 4OLWL 5FM5O 4N5UA 4PJIA 5DURB 2VLRD 4QOKD 2A77L 3R0NA 3ULUF 1AO7E 1OD9A 3KPPA 4PJBB 4R7DB 2B4CC 1PKQA 5FV2A 4EIGB 3VD5A 2CDFA 3PGFH 3CX5K 4X98B 2YBRB 4DVBA 2R69H 2H26A 2VR5A 3OAUL 4E41B 2WINB 3NIFE 3T1FA 2ED9A 4TSCH 3MJGX 1WLHA 3QXWA 4GAGH 3CD4A 1I7TA 1FGNH 2P43B 4PRNB 5ECJE 5F6HJ 1H3VA 2ZOKB 4AEHL 4PJ5B 5C09A 1VADA 3VWKA 4PTTB 1ZHNB 2P24B 4JZOB 4EI5A 5I0DA 1RSFA 5FM8A 4GBXB 4MDIA 5SWZD 2X05A 3KPRE 1B90A 3GRWH 3HAEA 1WCBB 3ARBD 4LASL 1QHOA 3BMVA 3MRHB 2CKBH 4WUUA 5DMKB 4CN1A 3FOLA 5D2NB 5ACLA 1FL3A 2ZG1A 3ARQA 4S0TD 1KCUL 1U8OA 4JEGB 1UM6L 3P77A 1N64H 4E42A 5D6DC 4DKAA 2ZOLB 2NX5B 1YNLL 2ATKA 3ARGC 5C07E 4ZSOB 5D7SH 1IGCL 1FAKT 4JFFA 2R23A 1OTUC 5JXEC 3G08A 3FN0L 4HKBA 1W0VA 5I8KH 1HH9B 2XPGB 3MOBH 1AJ7L 3QJFB 2HTLD 1XR8B 1C5CL 4OIAA 5DJDA 5DQ9A 1GGTA 2OJZL 4XNUH 4HKJB 4XPGL 1P53A 1CD8A 2CRZA 2HKFL 2HG5A 4LCCC 3SDAD 4DGYH 4TNVF 4RRPG 2W60B 1EDQA 1QSZA 3OKOA 3I9GH 3SDCD 2PR4L 4LVHC 2P8MB 2P42B 1S7SA 1BVZA 1UYWL 4WW2A 3OKLA 2A6KA 4Y1AD 1NBZB 4C58B 1RJLB 2A1WH 5DRNA 2A6IA 5FAAA 2EDTA 4WHTB 1AHWC 5CEXA 4WW1A 1B0RA 3QUKA 1H0DA 2FBJH 2VDLL 3MLRH 1CGSH 3E2HC 5IJVB 3PP4L 3DLQR 1ZANH 1AGEA 4OB5L 1PG7L 4WFEE 4MMXC 4FQPA 3RGVC 1JGLL 3DX6B 4JY6A 2J6EA 3DYMA 2UZIH 2YKLL 4U1SA 1CBVL 4GQ9L 4KJPD 2VLLB 4P2RA 1J12A 4RQQA 3VFUB 5D2LF 1KIPA 9CGTA 1LEIA 3NA9H 3W2DH 2J3SA 4QTIL 3L6FB 3ARDB 2A9NH 4MB3A 2MSPA 4ELME 1BM3L 3VFNA 1NC4D 4Y16A 4LF3A 4EBQH 1I75A 1L9NA 2W9DL 3BP4A 4BYHA 5JDJA 5KSBB 4XPHL 4OQTA 3BVNB 1TJHH 1MI5A 1G1CA 3FT2B 4O4YL 3OR7B 3QISA 4NO5A 2BVUA 4G9FA 4Y4KB 1AI1H 3W0WD 3GEWB 3NACH 3VG0L 3QFDB 3RAJL 2X5PA 5HHPB 1V7NL 1QLFA 3VFRB 1CGWA 1KN2L 4P5KB 5L8KB 1QLRB 3WN5A 3E6HB 2PO6D 5FXCH 1TJIL 3VXRB 3MYZA 3RPKA 1JRHH 4LDEB 3MJ9H 4QNPF 4H8WH 2XZAH 3TBWB 5HHOD 3TBVA 2G60L 2EDQA 5DMGC 4X99B 5B38B 1IILE 4HUVA 1SYVA 4OZIF 1C08B 4ZFGH 5KJRH 1KT2A 2N7BA 3O6MH 2FSEB 1H5BB 1NCDL 1U3HD 4M00A 1JF1A 3GZKA 4K23L 4DQOL 2AEWA 5ADPH 2LQRA 4HW6A 4MD5A 3FRPG 1U8HB 4UV4L 4UI2A 1KTLA 2CK2A 3FZUD 1GXEA 3LKOB 4R4FL 4Y4HC 3SDXA 1A7QH 3RWFA 5KVEL 1FAIH 3TVMA 4M4RA 4PBWD 4C4KT 3ZYOA 3MRPB 5I1EL 1U58A 3QHFH 3SDDC 2XTJB 1TETH 3S36H 5K59F 3VFVA 2Q3AA 2F19H 3MYJB 4R96B 1DDHA 1A3RH 4HIHA 1M71A 4UOJA 1R6VA 2GUOB 4YR6A 4CW1A 3FOMA 4ZQKA 5GGUA 4NNPH 3GSQA 4JPIA 1I85C 4X6CF 4MDJB 1EV2E 1S9XA 3VXPB 4Y8DC 3ULVD 4DN3H 4PB9H 2JB6B 4CVXB 1EEUA 3O0RL 1KCSL 5GGTA 3I2CL 4NUGL 5F72S 1SY6H 4UDTA 3WFHB 3B9VA 1S7RB 4X9GA 5GHWH 1U93B 2FNBA 3HMWH 3T0AA 4X9IA 3KR3L 5IHZA 1Q94A 4HMCA 4UT6L 1KFAL 1ZS8A 1NL0L 1GOGA 2D7TH 2Q8BL 1XGTB 2EDRA 3X13A 1KG0B 3SE4A 3EFDL 5CJXC 3CFBB 1X5AA 1I9IH 4U6YA 5HDLA 1MQKL 4N90D 4RFNB 4MAYB 1PDKA 4XHJD 3OG6B 3QDJE 3WFDH 3GNMH 1QSEB 5F89A 3SCMA 3ARPA 4XC1L 1I4FA 2GI7A 3IJSB 2YD5A 4UILL 3U30C 1W0WA 1KXQE 2JTDA 2FECI 1S8DA 3QIBA 4JKPH 3BWAB 4M7ZC 5D1QB 3ARBC 1CDUA 4V1DA 2CGRL 4HHAA 1MREL 4Q6IA 3QXVA 1FGVL 3BH8A 3E8UH 2H32H 2R0ZH 4JG0H 4MA7H 3WSQH 4U1NA 2H9GB 4CJ1A 1DQDL 4N1CA 4LLVB 4NZUH 1ZTXH 3QWQB 5IM7A 4GRLD 3D18B 3UYOD 4P49A 5EU5B 3OAYK 1MJ8L 1CE6A 4XCNA 2V7NB 3G5ZA 3H6JA 3BUYB 5HPMB 2JCCE 1N0LA 1HYSD 4NRXA 5E8PB 5EOCL 3UBXA 4NM8H 3FFCB 4OZIE 4DTGL 2HTLC 5HGDA 4Z0XB 1X4ZA 2HJLB 5GGVL 2CO7B 4G6MH 5C6TL 4F58H 4NKOB 3EOTH 4JFDB 3SDAC 4CGTA 3JV4A 3LS5H 1WJ3A 1QZ1A 1P7KA 1TVHB 5CKAA 3WJLA 3SDCC 1RUML 5TJWK 3B3IB 3U0TB 3HRZB 4J8RA 2P45B 3RTQB 3T0ED 3E1F1 2VJXA 3T3PE 5JPNB 1KULA 1WUNT 3ALWA 3NH7L 1HXYA 3T2NL 5B3JF 3UTZB 5IB3B 1SMOA 5IQ9B 3RDTA 1CD1A 4HF5L 4OLVH 1GSMA 2VLKE 5FUZH 5HPOA 1F4YH 5GS1C 1X5YA 2FEEI 2X2YA 3H9ZA 3BUTA 2ITDA 4U7KA 1Z3GL 5DC9B 4IS6A 4KJPC 4K8RD 4WVRA 3U82B 1DBAH 4WV1B 5ESAB 3LZFL 4XCFH 4MA1C 4CBPA 1JTPA 5CCKL 2I25N 5KG9B 3PQYD 1PYWB 1WZ1L 3TO2B 1I1RA 5CBEA 2VDML 4W70A 1T1ZA 4C56B 1SEQL 2XQYG 4F9PC 2FD6H 4PV8B 1HHGB 4JGMA 2DBLH 2BSSA 3TIEB 1BWWA 3IDIB 3S96A 2LAAA 3IF1B 4MGXA 3TA3D 4OLZL 1K4CA 4JKLA 5FGBC 2R56H 1MFNA 3VFMB 1I7ZB 2X44D 3O4LB 3M17A 5KVFL 4W6YB 1KN4L 3WIHA 5EC1B 1P4IH 4OGYL 3I3EA 4GRMA 3ESVF 2PO6C 4Y4FA 1N59A 3Q6FB 5TE7H 4J2XA 1D5XB 4RGOH 4MQSB 2R2BB 1EO5A 4MNQE 3PABA 4I77H 1TZHA 3CSBA 5C0BE 3NCBB 5B8CC 2FYYB 1DTUA 3KYKH 1E28B 3S34H 1WBYA 5LQBL 4MQXD 4P4KA 3KPMA 4PJ9A 4Q9RH 3EOBB 4KQ4L 4LLAA 4CMMB 2DB8A 1R0AH 4LQFL 1C16A 4Q2ZB 3FZUC 4QRPD 5FKPB 4FZEL 4FNLL 4LARH 4LSPL 1BECA 5JDSB 3FQWA 3S5LA 3N1QC 3F7QA 1F4AA 1IT9L 1F90L 3KPSB 1T0MB 1S3KH 5T3XL 4H0GA 4OUUA 4ZYKB 4L9DA 3T3MF 1A1NA 1KLGB 3QCUL 1E6OH 3CFEB 4TQEL 3QDGB 1ETZA 5DMIH 1BFOB 2CXGA 4WTZG 5TQ0H 3HG1B 4JY5L 3ARZA 1U3ZA 5T1LD 5TDNA 3QEHB 1MNUH 1E27A 1JF5A 4OFDA 4OJFL 3TH2T 3ULVC 4UQ2A 4AZ8A 4ZD3H 4NRYB 4J23A 3BGFC 2F54A 5B3JE 2ADGB 1A6VH 3TZVA 5C0CB 4OD3H 2BSTB 1YEJH 4PJFF 3RIAK 35C8L 4FQLL 1J9CT 5JNYB 1MJ7H 5GJTL 3GO1L 3MC0A 3R4DA 3KPQB 3Q48A 4P23B 5C0IB 3TO4D 3TP4A 2IGFH 3D2UD 4R97B 4PJBA 4DGVH 4Z77B 1WF5A 3B8YA 4WFGE 1YEGL 4JN2A 5D7JD 4GSDH 3DXAD 1RJZB 2CH8A 4X98A 3LEYH 1YJDL 1VFBA 2YBRA 1YEHL 5I1JL 1HXMA 3P30H 5CGYD 4E41A 4GG6E 4XP1H 2WINA 4GAYB 4L1HA 5HGGS 5BS0D 5FDWB 1S7UA 5DGRA 1EO8L 2V5TA 1MAML 3H9SA 3MODH 1QOKA 3GJFK 3HC3L 4PRNA 5DJ2B 4RMUA 3IDXL 1R3HB 1LK2B 2ZOKA 4KTEL 1F02I 4NUJB 1TVBB 4XHJC 4PTTA 3BPNB 1JGVL 1ZHNA 2P24A 5TF0A 2XA8H 4DGIH 4POZD 3EYSH 2FHFA 3U46B 3VDAA 3L3GB 1JBJA 4XNYL 2HRPL 2YR3A 1FFPA 3MRRA 1WCBA 2WBWB 2K1MA 5E2UL 5AZ2L 1S7XB 1CTOA 4R4BB 3MRHA 3SKJL 5DMKA 5IVZA 4NBYB 1EJOL 3DMMD 3EYQD 2DQTL 5D2NA 2VITB 4MNGE 3D5OF 2CDEA 4Z7UF 1PAMA 4XNZC 4TOYH 4LP4A 4LRIA 4JFEE 4P2CG 3UZEA 1M4KA 1FPTH 3GMRB 5DJ8A 2BVEA 1A7BA 3K80A 4K7PL 4ODSL 2NX5A 3EO9H 3WKMH 1ADQA 1Q0XH 4GRLC 5FA4B 2JK5B 3RNKA 4PLKD 3OKMB 1HH9A 2BNUB 2XPGA 2YC1B 1INEH 3L3IA 5C7XH 3QJFA 3GMMB 1DBKL 1XR8A 4AL8L 5FHBL 1HYSC 1QFWI 3NFNA 1B0WA 4LEXL 1MF2L 1ZK9A 3IFPB 3F7YB 4HIJB 1ZLVK 4HV8B 3RWJB 5ADOL 1J1OL 2WMPA 5DEGB 2B1HH 3MXWL 3PV6B 2W60A 5ESVB 4HH9A 2DKUA 2P8MA 4I3SL 1MLCA 1GGIH 4ZOCA 1YMMD 1BQHB 1LDPL 1NBZA 3GSVB 1RJLA 1OGAD 5LAXA 5T3XE 2CUHA 4HCRA 3T0EC 2F5BH 3QDAA 4OI8A 4OF6A 4GMTL 1KLFA 1U8LA 5JLZA 4PJGE 4YXHH 4YHOH 2QL1A 3MR9B 4RMQA 4S1QH 3SPVA 4QHMB 2FL5B 5C0DB 2VLLA 4JFYB 4UTAL 3KPTA 3O11A 3W5NA 4PFEA 3S37X 1MCKA 3WO3B 3ARDA 4Z5RB 3CLFH 2HH0H 4K8RC 5F1KC 4NHUB 4JVWA 1Y18B 1UXSA 4DKFL 4F33B 5BZWB 5KSBA 4S10A 3S7GA 4GKZB 4QXUH 4N1EA 1A7RL 3P2TA 5DK2B 5C2BH 1WZLA 4XPAL 2RCSH 3FT2A 4ZAKB 3D85D 3JWDL 3NPZB 4EUPB 4ZS6D 3CDGB 5GRUL 4Y4KA 3F58L 4JCMA 2OL3L 1KCKA 1NGQL 2AERT 4JZNB 3UTTB 4X6DE 3QFDA 4PJ7A 4WO4A 1U2CA 2AXGB 1X5FA 1CDYA 4DZBB 1K6QL 2XFXA 1CG9A 3L5XH 4KKNA 3PXJA 2QSCL 4D3CH 3TA3C 3E6HA 2IC2A 3M45A 3FJTA 5GSVB 2Z8RA 3VXRA 1T83C 4PGBA 2EXWD 1K9TA 1M7DB 3T0VA 4YBLC 1XGRA 1RUQH 3KXFE 4PJHB 1MAKA 4X99A 5B38A 4RX4D 5FECB 2CRYA 1X44A 1QSFA 5E03A 4OZ4A 1XIWA 3QNXB 1C08A 5J9PB 1FNHA 3D3VB 1OPGH 2FSEA 3AGVA 1IL1B 5GS2H 3STBA 3JV5A 4G6JH 3K1KC 4JDTH 4M6NL 3VRJB 1A1OB 4O2EA 4TSBL 2AQ3A 4PG2C 1AQKH 3TFKD 5EU7C 1U8HA 4NQXB 2B5IC 4MQXC 3SKOA 4OCYH 4RFEB 3HMXL 4IDJH 1N0XH 3VA6A 4YQXL 3LKOA 3LS4H 3ZE1F 3V4VH 4F2MB 3F6LA 3V7AE 3MLTB 5IHUL 3I3DA 2ENYA 2R4RH 3MRPA 5I1CH 1ZT4B 4TSAH 3TNMB 1KSRA 4XMKH 3MYJA 4NQED 4R96A 4HIXL 1NANI 1Z9OA 1YQ2A 4XBGA 2GUOA 1Q9WB 1GGBH 2ZCHL 4KJYB 4BQBA 2FBOJ 2CLRA 2M2DA 2VABB 4MDJA 5FYLD 5H94B 3VXPA 1TLKA 1FV1B 3TWCL 1T5XB 4KWUA 1FFRA 1GIGL 3B9KA 2JB6A 4CVXA 2COQA 1RK0B 4F9LA 4G7YL 4DAGL 3MACH 5M94B 5ISZE 3V0WH 2HN7B 3NVQA 3DI3B 2DQCL 2ARWA 4HXBH 1DEDA 4HMEA 1S7RA 2V5YA 3FB6A 5FYKU 4F15C 4BFGA 4WY7L 5E70A 1U93A 1A6UH 4I3RH 4ZXBA 3SE3C 1YECL 3EYUL 4JPVH 2ICEB 3TO4C 3QUXD 4P5MB 1J1XH 1MCIA 1MCBA 2A38A 1XGTA 4HPOH 1QFHA 3VXUE 1KG0A 3ILPB 2G75A 4JRYE 4YDIL 5CLWA 5D7JC 3MV9D 1AY1H 1IGIL 1EH9A 3U48A 3FTGB 4OCLC 1BLNB 1JV5A 3KJ4B 3CFBA 3CGTA 2ATPA 3D0LB 5CGYC 1JZ2A 4MAYA 2VDPL 2VDOH 5E5MB 1QSEA 4XPBH 4QRUA 5D8JH 3V6OA 2EDXA 1F2QA 1W2KT 2GYSA 1OSZB 3BKYL 1UGNA 5HI5D 4MXVF 4LSUH 1GC1C 1I9RH 4PJXA 4POZC 1KJ3H 3IJSA 2NY0D 3GJEB 5EPMB 1YMHB 1QBAA 1NAKL 3BWAA 5D1QA 1RJCA 4IRJB 5GS0D 3MUY1 4RMSA 3G9VA 1GHFL 2I9LB 3DMMC 3EYQC 3RIFK 1T2QL 1JNNL 5KN5B 4JZJB 2H9GA 3MRMA 1MWAA 4CKVX 4X8JA 4LLVA 4EDXB 4JM2B 4YE4H 3D18A 3IU4H 3RU8H 3FO0L 4NO2B 5EU5A 4NZJA 1E4XL 3S6CA 2C5DC 5HPMA 1JPFB 3K1DA 3U4BL 1CICB 5E8PA 3FFCA 3BW9B 4PLKC 4P2YA 4XPFH 5LBSH 4FABH 3VMOA 1UWXH 3BP5B 3TV3H 1IFHL 4BM7A 3HC4H 3T2OA 2J88L 4NKOA 4JFDA 4Y16D 1I3GL 2EDYA 1TFHA 2HVJA 4I0KA 3TT3H 3O3AB 4HX1A 2OLDA 3RVXD 2OTPA 1MELA 5F7MC 3TGXA 1MI5D 4OFIA 3B3IA 5E1HB 3HRZA 3RHWF 1XGPB 4U0RC 3RTQA 1N6VA 4YFDB 4N0CD 4MD0B 2UV3A 5I1AB 4G9FD 1JI2A 4FFYH 3UTZA 4P46B 2QBWA 5IB3A 5F7EH 3O3BA 3OX8B 1RHHB 5IQ9A 3R8QA 4ZDHB 2BNQE 1Q72L 5FGSA 1QPPA 2OSLB 5AWNH 3HI5L 2WLZA 1W72L 4P9MH 3NTCH 4O2FB 5DC0A 4APQD 3BWUC 4IBLT 4NIKB 3V9FA 3DNKA 4PD4J 5L9DH 5ESAA 3JVGC 4Q7DA 2HP4A 3QIUB 4XVUD 5KG9A 1DBMH 1PYWA 3HCVB 4DW2H 5FHAH 2X1PA 1VENA 4H1LB 3H7BA 4XWGL 4Z0BL 5A2JH 4YAQB 3RL1A 5J06A 1TQBB 3TPUA 2YZ8A 1IEBB 4QHKI 3KPOB 4CMHB 5MHSE 2AABH 4M7LL 4RDQF 3TIEA 2P5WD 2AK4A 4BZ2H 4BUGA 4HIEB 3IDIA 3LDBB 1TQCC 3T04D 4ZS6C 3IF1A 2EH8L 4OUOA 2EC9T 3TVMD 5DWUH 1G7LB 2FRGP 2NXZD 3O2WL 1J1PL 4GH7B 3G6DL 1I7ZA 5JORB 3O4LA 3BEVB 1WAAF 3VXQB 2F53E 5D5MA 4G3YH 3RQ3A 3UTOA 3HAEG 2EXWC 3Q6FA 5GISH 1TJGL 2GTZB 2AJZA 4X8XA 4MCZB 5D7IB 2XZCL 1ULVA 5DLMH 3JWNC 1A64A 2FYYA 2GW5A 4PY7A 4YHLH 3SKMB 5ACMA 1E28A 1GPOH 1DFBL 5FIEA 5F3HB 4UQ3B 3RUGB 5IG7B 1IGTA 3K4DA 5JUEH 4KDTC 3MROB 2DAVA 1LDSA 3EOBA 2IAND 2VSDA 3JXAA 3TFKC 4CMMA 1S78D 1OP3H 1S7WB 4TULH 3DVNB 1F2XK 1OAZL 4YHKL 5FKPA 1U8JB 1N7MH 3BHBB 4OZHF 5JDSA 3O6FD 3KPSA 4U2ZA 1ROWA 1T0MA 4KMQA 3PGCB 4OCXH 4CU8A 3GBML 4XI5D 4ZYKA 1PEZA 5DS8B 1KLGA 5JHDE 3O4OC 3QDGA 2CUMA 3GSNB 1T7ZA 4KJQD 4OLWH 1BFOA 3HG1A 2DN7A 4ZFOL 1NDMB 3SCMD 2A77H 2IPUK 3VXSA 1T1XB 3ZKXC 5A2KH 2CUIA 1PX3A 5SX4I 2Z93B 2NLJB 4NRYA 3X3GL 3OAUH 4UDUA 1X5HA 5JNYA 3LD8B 1QRNE 3KPQA 5C0IA 4AEHH 1DBJL 4KXZI 4JQVA 5BRZB 4Z77A 3MBXL 4HWBL 2AXFB 3B9AA 3MLYH 1OAYL 4NPYA 1RZFL 3PDGA 5AZEL 3QUXC 3QR2A 1T3FA 5TF1L 5DJ0B 1NPUA 3FHQA 3F12B 5DVOA 2HKHL 3SBWA 4LASH 1I8MB 4Z7WE 3QJHB 5DJ2A 4JM4L 4FA8A 1R3HA 3GBLA 5AG8A 1LK2A 3UYPA 1MHPL 5IGXL 4NUJA 5B4MD 1KCUH 2GITB 5F6IC 1UM6H 3AB0B 1KB9J 1S5IL 4ALAL 2VXQL 3L3GA 4L3EE 4L4TE 5HI5C 5H37H 1YNLH 4ORGB 3BFOA 2PTVA 4R4BA 2NY0C 1IGCH 4FZ8L 2AEPH 2VITA 5TGBB 1KIQB 3MLPA 3VH8B 4I4WB 4WW2C 1AJ7H 4K71B 2OR8A 1ZSDA 5GS0C 3D69B 1C5CH 1O7VA 1YEEH 3F8UB 5E0QA 3DV4A 2OJZH 3QUZB 3QO1B 3GMRA 3VGBA 2X42A 4X80L 2HKFH 4LNVA 2VL5B 5AAMA 3SDYH 2J7LA 4YK4C 4GG8A 3BKML 5LG1A 5FA4A 2JK5A 4EUPH 3D0VB 3LCYA 4JRXB 3OKMA 2BNUA 1UYWH 1NAML 1VEOA 5E2WL 4EDWL 5I1LB 3BN3B 3IFPA 3F7YA 1JPSL 4MA3B 4HV8A 3REVB 3GUTA 1M7IB 2WW8A 3U1SL 3PP4H 1UWGL 3PL6A 4P2QA 2OM5A 4OB5H 4Y16C 1MCPL 2MHAB 3S97C 4WRLA 3LRGA 2YKLH 1CBVH 4Y2DB 1BQHA 4KDWA 2Z0BA 4GQ9H 3RVXC 4OZHE 2ESVB 1X5IA 5CD5D 4O51B 3FONB 1IGJB 4QTIH 2BC4A 2JF1A 4YDLC 3GI8L 2DYPB 1E4WL 3VDCA 4BELD 2VLRE 4QOKE 3VXOB 1SJVA 2W9DH 4QHMA 4XPHH 1NGPL 5C0DA 3O41B 3OPZL 3K3QA 4XAKD 1FYTA 4ODUA 4JFYA 1ZGLM 4NOBA 4O4YH 4APQC 4Z5RA 2QHRL 5I15L 4MAUL 3RWGB 5ACZB 4GXUM 4NHUA 5LGKA 3DYOA 3UXFA 4ZNCD 3VG0H 3D6GA 4U33A 3RAJH 2M8XA 5BZWA 3SQOL 4WU7A 1MHCB 1V7NH 4ODHL 4XVUC 1KN2H 1T2XA 1KNOB 1NBYB 1SYSB 5CJBA 5DK2A 2W92A 2DOCA 2BOBB 3FRUB 2Z8SA 4ZAKA 1TJIH 2AQ1A 2VZ3A 3IFLL 3CDGA 4KK5D 3C08L 1MY7A 2H1PL 4V2CB 2G60H 4JZNA 4G8EB 2AXGA 4NJ9L 2JIXB 3VRLF 4RGMC 3IDNA 3MNWA 3TVMC 5I76B 5T1MA 3GMNB 4TRPL 2NXZC 4QWWD 1T4KB 1NCDH 2D7OA 1NFDA 5GSVA 4K23H 4U7SA 3L9RB 4ETQA 1BGXL 4FQIL 1M7DA 2IH1B 4EJ1C 4UV4H 2Z31B 5MEOB 5FECA 4R4FH 1A4KA 5DEFA 1JGUH 3CFKA 2P46B 4I5BB 5KVEH 1QR1B 4DK3A 5J9PA 3D3VA 2DQIH 1IL1A 1JWSB 2NNAA 1A47A 2BNRD 1SBBA 4ISVB 1A1OA 3OMZA 5T5FH 2EYSB 3NCYP 4Q97A 5F1SA 2F54D 1IKFH 2GJJA 1P4LB 4NQXA 1U95B 3WHE0 3JUZA 3AU1A 3NCYS 5GXBB 2GFBB 1AGCB 3QUMA 5ENWB 4F2MA 5EUOE 1S78C 3AMKA 1DLFL 1A4JB 3ULVL 4ODTH 3WS6A 1G7IA 5J89A 3UBXG 2RFXA 1ZT4A 4H8WC 2EIZB 3TNMA 3OG4B 3O0RH 3O6FC 4E41D 3PIQA 1KCSH 2YUXA 1JPTL 5EO9B 3SE4C 4XI5C 4NUGH 4KJYA 1DSFH 4JCLA 1HHHB 3QAZB 5GZND 2VABA 5KANG 4KJQC 4CDGC 3GFUA 4PJ5D 5IESH 1HH6B 2W65B 1F3JB 3MNZB 4DKEH 4F7MB 4FXLA 4NDMB 2EE3A 1FV1A 3KR3H 1T5XA 3SCMC 3CIQA 4GBXD 4KY1L 1KFAH 1LO3L 1RK0A 1NL0H 5CMAB 3IAGC 2I9TB 2Q8BH 5HYFA 2KPNA 2IFGA 5TPWL 2HN7A 3EFDH 1XZ0B 1MQKH 1I1FB 3HHRB 2EYTB 4PJ7F 3CK0H 4BFIA 3PV7A 4UBDD 1J87A 1MRFL 3HZVA 4P5MA 4XC1H 4G5ZL 2NX5D 3PF2A 3ILPA 2JJVA 4GO6B 3W0WE 3FTGA 1MRCL 2X1OA 1BLNA 2W1NA 4UILH 3OTTA 4XP6H 1WQVT 5CINL 4MNHB 2CGRH 1MREH 5FF6B 4P0DA 3NA4A 3SJVB 1FGVH 2ED7A 3MLWL 2QQKL 4AIXA 4Z9KB 5D6CB 1OSZA 2GJ6B 4MVBD 3L5WA 1UJ3B 5B4MC 3C6LB 2P49B 5GPRA 4N0UE 1DQDH 1E4KA 5ITBL 1EEZB 2Y06L 3FAWA 1MJ8H 1YMHA 3ARTA 3PGDA 3I6LD 1RUPL 3WHXA 3LPGA 2PN5A 3L3DB 5DVMA 2IPKB 2I9LA 5EOCH 3WJLC 3WIIL 4JZJA 3BESR 4DTGH 1S7TB 1CDHA 4OD1L 5GGVH 5HVWA 1KJ2B 4XHQA 3GDBA 4XGZA 3N1MC 4OSUL 4WWKB 5DRZB 3FB7A 1RVFL 3OF6D 1U6AL 1CICA 1U8IB 2OX5A 4PRIA 3WIFB 2HLAB 4ONFL 5JPMA 4IRSB 1IZJA 3C9NB 1JTOA 3UTSB 3DVIA 3K2UL 3U7WL 4M43L 3QWRA 3BP5A 3T2NH 1D5MA 1SMAA 3N85L 5IUSA 3FB8A 3AXLB 2ZUTA 4HF5H 3N9GL 4UUJB 5JOFA 1GL4B 5FA3B 3L7EB 3O3AA 5HYSB 2JELL 4K94C 2HFTA 2A9MH 1CFVL 3ZTNL 3ULVE 4GXUN 4P2OA 1Z3GH 2GEEA 1XGPA 2VMFA 4Q9CA 1NGZB 3CMGA 2NCMA 3S5LG 5LCVL 4MD0A 4K8RL 5I1AA 1L7IL 5CD5C 4Y4KD 3UMTA 1S9YA 2NTSP 1UT9A 3OX8A 4PJDF 2C4FT 1RHHA 1BQUA 4ZDHA 3EFFA 4WWID 1F45A 3LZFH 2E6JA 1AIFB 2OSLA 2BRQA 2HVKB 3QPXL 3EIFA 4QRQA 1RI8A 3PHQB 2VDMH 1WTGT 2WBKA 5TFSL 3VXRD 1SEQH 1QKZL 5I75B 5C0GB 1ZEAL 2NYYD 3FT3B 3TN0B 3D1MC 3IKCB 4BZ1L 1ZGLP 2YPVH 4N90E 2E7CA 2IPUG 2QR0B 3QIUA 2QQNL 1XH3B 3MRDB 3QQ4B 3HCVA 3BD3A 2Z35B 4OLZH 4H1LA 4PRDB 3O9WB 3MJ7B 3CX2A 5KVFH 4YAQA 5F1IB 1IEBA 4OGYH 1JHTA 1MH5B 3KPOA 3ALXA 1UWXK 2CK0L 4FQCL 2BRRH 1KTRL 4YFLI 2HFGH 4OV5B 4KK5C 5KANI 2UWEA 3QA3B 4YDKH 4G8GB 2IADB 4LHUB 2XTJD 5JORA 3BEVA 4X6EB 4OQ1A 3HRPA 1OAUL 4P48A 4M62L 4X6FB 4QWWC 5FUOL 2IAMD 1OT2A 2HWZL 1P84J 1JYNA 2FR4B 4MLIA 7FABL 3ZTJG 4KQ4H 3WBDA 5HHMB 4CNIB 3MRFB 1W72B 4XRCA 1AXTL 4WENB 4DZ8B 5D7IA 2OCFD 1DVFB 5J6HB 4FZEH 4FNLH 1DUYB 4LSPH 5ICXB 3SKMA 3KG5A 1IT9H 1F90H 3HNSL 5F3HA 3RUGA 5T3XH 1U36A 4KRNA 2Z9TA 1NDGB 5DJYA 5C0EB 4BQ6A 5DK0B 4FTVA 3GIVB 4GS7C 1UWEL 1S7WA 4BQ9A 3K8LA 2YHGA 4JY5H 1K3ZA 3OKNB 3BHBA 3T0EE 3WNOA 4FQXB 3W81A 1T22A 1XGQB 1N26A 3PGCA 3PJSB 4OJFH 1A14H 3IGAB 3LHPL 1X6LA 3DHMA 4X4ZA 5BO1L 1UM4L 2JJSA 3GSNA 4NKQB 4MAYD 4JPWH 5GS2D 5LGHL 1QLEL 4FQLH 5E5RB 1ZVHA 4AIZB 4WI7A 1IAKA 1QSED 5CSZB 1UENA 5GJTH 1NDMA 3GO1H 1A3QA 5TH2B 1NKRA 1BAFL 4BQ8A 3MRCB 5GZNC 5DFTA 3M1BA 1YEGH 1JK8B 2YS4A 4FMKA 1HKFA 2E3VA 4GBXC 1IGML 1YJDH 2Z93A 5BOPA 1UJTA 3JV6B 2WWKO 1EO8H 3DWTA 5EOQL 4LGPB 3HC3H 3KLAB 3IDXH 4HH8A 5D2NC 4KTEH 4OZFB 2Y9RT 4PJAF 1GC1L 1JGVH 4LRIC 4EIZC 2AXFA 4UBDC 2NY5H 2BHUA 5K9QG 4XNYH 2IG2L 2HRPH 5D5MF 4NO3B 5DJ0A 5E2UH 1CT8B 3F12A 5CJQL 2IQ9L 5AZ2H 1I8MA 3QJHA 3P9MB 3SKJH 1OP3K 4KU1A 2J8UE 5KAQG 2FLBT 1EJOH 2DQTH 3FFCD 1U3YA 2NY2B 2UZYB 3WL9B 1I8LA 3ZYZA 1QFUL 2XN9A 4UU9A 2GITA 3OKKB 5E2JA 1J8HB 3G04A 4MVBC 4K7PH 3UP1A 4ODSH 1OOAA 2EDFA 4ZFOB 4S11A 3DIFB 3RZCD 5ICYB 5TGBA 2YD6A 1KIQA 3UZQA 3VH8A 3RTQD 1YEFH 2CLZB 1IC5L 1DBKH 4AL8H 2Y7QB 3LY6A 3B43A 5EU7E 1QYGH 3BGMB 4LEXH 4MJ5A 1MF2H 2Q76B 5FKAB 1J1OH 3MXWH 5J11B 4QRPE 4L8BA 3D0VA 4I3SH 5B38G 1EGJL 1IAIL 1LO5B 2C3VB 3T8XB 5SV3A 1LDPH 5DD5H 1AC6A 1TVDA 2R8SL 4ZUWB 4UAOB 3CNKA 5BOZG 5DHVB 3KWWA 3LRSB 1KENL 3REVA 4WJ5A 4NSKA 4D9RD 4LVNB 4GMTH 4Z7OF 4M1GL 5ID0B 3GI9L 4WGVB 1LP9E 4FQQB 2VLJB 5LWYL 5HYJB 4KV5F 1W0YT 4C56D 3L3KB 3UZVB 3G6JF 2ESVA 3C5JB 4WI5A 3GMLA 4O51A 3FONA 5F71A 2FX7H 1IGJA 1LQSR 1XF1A 4QXTB 4MX7B 2BSRB 5GQBA 3L95B 2DYPA 5KOVC 2DQDL 4RNRB 3ISWA 4Y4KC 2DQGL 4DFIA 5I1DB 1IC7L 2K7QA 2V2XB 3OBAA 4N0FB 5SWSE 3VXOA 3O45A 2GTWB 4Y5VB 2DD8L 3O4LD 4Z76B 3O41A 1A7RH 4XNMB 1NGWB 5E8DL 1DANT 3JTSB 4XPAH 3DXAE 1IBGL 3SN6N 2OR9L 3UAJD 3MREB 1N5AA 3HPLA 3JWDH 2FJGB 2NYYC 2NY7L 3NGBB 5GRUH 5BS0E 1IAIM 5GRYA 3F58H 2OL3H 5DRWA 3LPWA 4MXWH 3RI5F 2VC2L 5F9WB 2QV2A 2ENSA 2Y07L 1KTKE 2YPLA 3OXSB 1C5DA 3STLA 1K6QH 3X11B 2QSCH 1LE9A 4MCYA 1KNOA 1NCAL 3RL2B 2PYEB 5A2IH 1H5BC 3V79C 4BZYA 1OP5K 4UMGA 1ZT1A 1RV6X 2C1PA 3HLAB 4BK4A 4HKXB 1RMFL 2BX5A 5I76A 1DN2A 3KPSD 4XAWL 3CUPB 3PWPB 2IMNA 1TDQA 1T4KA 2Q3ZA 4ZUTB 4M6NH 4G42B 3UTQA 3QWOA 4TSBH 2XTJC 5D4QA 3L9RA 5INDA 4QRSB 3QDGD 2IH1A 3CJJA 1ACZA 3HG1D 5CZKA 3HMXH 4YQXH 4OZGE 1BVKB 1NQBA 4YZFF 2AS5M 1QR1A 4C54A 3R8BB 1FRGL 3N1PC 1ZA6B 3STZA 3E6FB 2GY5A 4WEMB 4G7VL 4DUVA 5I2IB 2WIMA 1BFVL 3C8KB 2NTFB 5D70L 1P4LA 5C0CD 1JYXA 4HIXH 2G5RA 3MRLB 5JW5B 1JMZA 2ZCHH 5E4EB 2GFBA 1AGCA 5ENWA 4P23D 3ZDZE 2V5RA 2ZWLT 1YMME 4X9BA 1F3DH 3QRGL 4HUWB 5FYLL 1OGAE 3TWCH 3CH1B 1G9NC 1GIGH 1TXKA 5F9AC 2EIZA 5JHLL 4G7YH 3NFPA 4NNYB 2FH8A 2EDHA 2IF7A 3QEQB 1H8OA 1GRWA 1D9KB 2DQCH 3MJ6A 4RFNC 5JQHC 4DOHB 4MAYC 1TZGH 1HHHA 4WY7H 1CXKA 3WO4B 1CFQB 3BIBX 3MNZA 4F7MA 4NDMA 3FQRA 2DL9A 4X4MA 4J7RA 1K3IA 5CMAA 3TNNB 4E0RA 2B0SH 3BP6B 3WEXB 1JNLH 1F13A 1T6WA 5DJXB 3HUJF 4YDIH 1IGIH 3P4MB 4GRWF 2A83B 4F7PB 3QNZB 1XZ0A 3QUYB 4U6XB 3GGWA 1J86A 1I1FA 1S7VB 3HR6A 1CGVA 3RNQA 4JQIL 5D1QC 1GGUA 5I17A 2EYTA 2VDPH 3MXVL 1EHLL 4LCUB 5IFJB 2P48B 4ZFZB 5DF0A 1IM9B 2IPTL 4PP2B 3BKYH 3GMQB 1KV3A 4HD9A 3W9EB 4I1NB 3K8MA 3MCLL 5F7UA 2VZTA 5D2LB 5L6YH 5DA4A 2Q86B 5HYQB 1NAKH 1A6AA 1KJVA 3PGFL 4H88L 4MNHA 5GS0L 4LKXB 3F7VB 3RX5A 5T1KA 2GSGB 3FQXB 3SJVA 4X7TB 3ZE2F 1T2QH 3BD5A 3RWIA 1JNNH 4HQQL 5TDPB 2HFEA 4NP4L 1UJ3A 4Z78A 2PXYB 4RMTA 2Z91B 1YNKH 2X4UA 5CHNA 1EEZA 4JN1L 3FO0H 2APVA 2JJWA 3AFLA 4M61B 1JE6A 1DQTA 1E4XH 2KZ1B 4LGSB 5CWSB 2J6EL 3DROA 3GSOA 3L3DA 2IPKA 3PDOA 3RZCC 3VD3A 4H0HB 2FIRT 3RTQC 3UDWA 2GQHA 1S7TA 5GJSL 1V5JA 2VXSL 4PJCE 1IFHH 4ONOA 1KJ2A 3EDKA 4H20H 2J88H 4PJIE 2XZQL 1I3GH 1MJJB 4WWKA 4MZ2A 4OQTL 4M7JL 1P7QD 3SGEI 2E27L 1PKQE 4PRPB 1U8IA 1QNZL 2HLAA 5DUBB 1A22B 2VN4A 3H3PL 4IRSA 3C9NA 3RA7L 2GKIA 3AAZB 2IMMA 4NQEE 5I8KL 4PJEF 3S35X 2EDKA 4GXVL 4WV1C 4UUJA 4NZDA 3EO0B 5FA3A 2C3XA 5C09E 5FYLE 2E7BA 3K81A 3FAXA 2OXGA 3HI5H 2ORBH 2W91A 4X5XA 4G80B 1W72H 3ORJA 1TPXB 4ZAKD 4QCIB 5I8EB 2VL4A 4FQ1L 4BUHA 5JIHA 1D5BA 3U4EA 1G84A 1HQRB 3UTTD 1KXVC 1YPZA 2LVCA 4U1LB 4R2GB 1AIFA 2HVKA 1IVLA 3PHQA 1FSKB 2MQ0A 1ZANL 1ZXQA 4AH2B 3C5ZD 4Z0BH 4KH2A 1N2RB 1A6TB 4X6CB 3MV9E 4TUJB 3TN0A 3IKCA 4M7LH 1DQJB 3HUJE 3I85A 3UAJC 2QR0A 5DUPL 2EH8H 3MRDA 3DRQB 3QQ4A 4GRWE 2X6MA 2Z35A 3D3VD 5DJAB 3O2WH 3X17A 1J1PH 4PRDA 3G6DH 3MJ7A 1MCFA 1SJXA 1I8IB 2FX9L 1FNGB 3AY4A 1MH5A 1FVDA 3BO8B 3VD4A 2CD0A 4ELKA 3G6AA 1TJHL 2ITCB 1TJGH 1YEKH 5E56A 3U7YL 4PR5B 3NIGF 5DSCB 4LK4A 5CAYB 1BD2A 2XZCH 1MVUA 2IADA 4FRWA 1AR2A 4LHUA 2D7NA 3CH8A 5LGJB 1V3LA 2WIIA 5FO9B 4LDOB 1B0GB 4X6EA 2NY3B 3ZE2E 4P3CH 5KVDH 2DTSA 4OZFH 4X6FA 1U3JA 1MFCL 4PGDA 4YHIB 5LXGL 2FR4A 2BVOB 3MCKB 1HN1A 1FFNA 1CLZL 5ERWB 4CNIA 4JDVB 2YN3A 1OAZH 3ESUF 1ZE3C 1MSPA 3AS0A 4YHKH 5J6HA 5L7XL 3ZDYE 1AD9B 3WNLA 1DUYA 5ICXA 3BKJL 4NQDB 3LPFA 5SX5H 4WTXA 2D0HA 3GBMH 3LIZH 5C0EA 3O6ML 4U4BA 3ARUA 3OKNA 1MI5E 3V8CA 5FOBB 4G8IB 5E1AB 4P23C 4FQXA 5I66B 1XGQA 4R0LA 4R97C 4J12A 3PJSA 4G9FE 3IGAA 3MV7B 2VZOA 4YX2L 1ITBB 1B2WL 3LKQA 2BK8A 4EI6B 2P1YA 4KUCF 3X3GH 2VXTH 3SBWC 3RX7A 2HJFB 2DLFL 5CSZA 1Z9MA 3TT1L 5TH2A 4JDZB 1DBJH 3DX8A 3CDCA 3LMJL 3MRCA 3WFBL 1Q9OB 4HWBH 3OHXB 1BQHG 2GHWB 3BPNC 2GIYA 1OAYH 4NNPL 5AZEH 2HA1A 4XP4H 5TF1H 3MNVA 5DHVH 5T3ZL 2RR3A 3JV6A 2HKHH 5IVXB 4PB9L 4IRJD 2N56A 5E2TL 3KLAA 1MCDA 3N50A 1XF4B 2HLFD 4JM4H 2UWEF 4Y89A 4ZPVB 4OZFA 2IALB 4L5FH 5I8OL 1RY7B 3P9LA 5J0BA 4TVPH 1AO7A 3MRQB 4JM2D 1S5IH 4ALAH 4PTUB 2E6PA 2VXQH 2W9LA 2P5WE 4NO3A 1LP9B 1QUNA 1YNTB 3SDXE 4MJIB 1CT8A 4NRZB 5IW3A 3P9MA 2BVPA 1CICD 4FZ8H 1EUTA 3WL9A 3SE8L 3DOSA 1HDMA 2PETA 3MFGB 4JFOA 1A6ZA 3UJJL 3OKKA 3MPCA 2P5EB 1J8HA 2Z4QB 1NMCC 4M5ZL 4X80H 1F6AB 5I19L 3TYGH 3GNML 1RJYA 2N4IA 3IDYB 4M7LT 3KPRA 2Y72A 3MRNB 4Z6AT 4Y5XB 3BKMH 3TBSB 3DIFA 3FT4B 5ICYA 1IEAB 1NBQA 4H5SA 3CXHJ 3DO7A 2CLZA 1NAMH 5HDOA 2Y7QA 1U8PB 5EC2B 5DVLA 2PW1A 1UQSB 4I0CC 5E2WH 1X4XA 1I7RB 2ZP0T 4P46D 2Q76A 1JPSH 3L3JA 3JWOL 4Y19B 4O58L 3V0VB 2IANE 2XTLA 4IIQB 2Q1EA 4JFHD 3U1SH 2R0ZL 1UWGH 4I18B 3JSSA 3IU3B 3AS2A 4K94L 5LKNA 3K7UA 4DKDC 2QKIA 1MCPH 3KAAA 1LO5A 2C3VA 3T8XA 3AVEA 4ZUWA 1NUGA 2NY1B 3MGOB 4ODWA 5IWLC 4QHLB 3GI8H 3QIUD 4FQQA 2FJFA 4H25B 4U1GB 4OF7A 3JZ7A 5T5NF 5E2VL 4G6ML 3SO3B 1C12B 5IFHL 5CUSL 3WIHL 2G9HB 1FO0A 1NGPH 3SGKA 3OPZH 4AEEA 3VWJB 2IBZY 2B7DT 4J3OC 4ZAKC 5B21A 1IM3B 1T03L 4QXTA 2QHRH 2BSRA 1VGEL 2V9TA 4RNRA 3GSXB 5I1DA 5CP3A 2V2XA 4Y5VA 2GTWA 2BXYA 4PJ8B 5HDBE 1QVOA 4Z76A 4WEBH 1NGWA 1ZA3B 3JTSA 2EIBA 2GCYB 1F4YL 1RZGB 5IBLD 1AXSB 1RZIA 2O61B 4AEFA 2DM3A 3EW3B 4AG4L 4BKLA 3MREA 5I8CA 2FJGA 4FMFA 2H1PH 1ED3B 3P0VL 5A2FA 4WI4A 4NJ9H 4PGCB 1J11A 4GKSA 2RBLA 3X11A 1DBAL 1OT1A 4PJFB 3T08A 3RL2A 2ZUWA 4TRPH 1WIUA 2BSED 2W0PA 3MUHL 3B4NA 4TNWF 5T33L 3ARFB 4GUPB 1BGXH 1AGBB 4YGAB 3KHOA 5KSUB 4LP5A 5LVEA 1M05A 5FGRA 3GMPB 1HQ4B 2YPKB 3O3EA 3Q5YA 4I0PA 5E7FA 5IT2L 3CFCL 3QZWA 4HKXA 3V52H 2AI0H 1QFWH 1X5XA 3PWPA 3QO0B 1FJ1B 3RVWD 3WS6C 4X9FA 3TC9A 4QRSA 4LOUD 4AENA 3BZEB 2KZWA 1GAFH 1EXUB 2VE6A 4HK0A 4HGWA 5AUMB 3VW3L 1IQDB 1OLZA 1DLFH 4U2YA 2X9WA 2YUVA 2NQCA 1ZA6A 3E6FA 4CDHA 4N8CL 5D1XB 5KS9F 2VQ1A 1IGYA 4Z7UB 2C3HA 2AGJL 1JPTH 2NZ9D 3Q1SH 5JW5A 3P11H 2DWEB 1T04B 3PWVA 2FO1A 4FQ2L 3BQUD 4P59L 4F80A 5BRZD 3O6KL 4LIQL 4Q9RL 4J3XA 1DP0A 3MGTA 1TIUA 3CH1A 5CILH 2NW3A 4KY1H 1LO3H 1UB6B 4KI5D 1CXLA 3T2PA 1NCTA 1JPST 4LARL 3BH9B 1LVEA 3BN9D 3BPCA 3QEQA 2EH7L 2IQAA 3KJ4C 1D9KA 1DLHA 5AYUL 1YN7B 5T3XD 4ZO7A 4U0QB 4D0DB 3KLDA 1CFQA 2ZSWA 3G5XB 3NABL 5BW7A 4XAKE 4PRHB 1WISA 1BJMA 1WT5C 1MRFH 3V6ZA 3TNNA 5TQ0L 3FO2A 3WEXA 2EO1A 5CJOH 4G5ZH 5DJXA 1ADQL 2NMSA 1MNUL 2LAGB 3P4MA 1NGYB 1MRCH 2A83A 3KPPB 4F7PA 5IB1B 3S8WA 4U6XA 2CDFB 1S7VA 5EG6C 4KMTH 3IFNL 1ZMYA 4IRJC 5E4IA 4LCUA 4DVBB 4IM8A 2H26B 3MLWH 4ZFZA 2HLFC 2QQKH 3T1FB 3QUZD 4PP2A 1PG7W 3GMQA 1J0YA 4JZJC 3TBYB 4OT1L 4F37K 4YLQT 2UVFA 4JM2C 5D2LA 3EYVA 5ITBH 4QHUA 1K5NA 1VADB 2Y06H 2Q86A 3VWKB 2C9AA 5HYQA 4JRXD 5HI3D 3K8KA 4MDIB 1RUPH 4LKXA 2YD1A 2GSGA 3FQXA 1CICC 4X7TA 4H1LG 4HCRL 5TDPA 3DSFL 4OM0L 3QHZL 4WUUB 5IHLB 5JOPD 2APBA 3D39B 4OD1H 1Q0YL 1CXFA 1FL3B 1EFQA 3MLVL 3TBTA 4GMSH 1U8OB 5CWSA 1YN6B 3BJ91 3P77B 4HUNB 1RVFH 4Y2DD 1U6AH 2H45A 2ESVD 1Y0LB 2BNRE 4ONFH 2UUDH 3K2UH 2F54E 2DM2A 1NANH 3PWUA 4HK3J 4JFFB 4M43H 3U7WH 3G08B 1W0VB 1DQQA 4IMKA 4P46C 3CU1A 1WSST 1MJJA 3N9GH 5DQ9B 1FPTL 4JHAL 4PJBE 4Q9QL 2JELH 3WD5L 3ZTNH 2HG5B 3EO9L 1S9WA 1JGEA 1CQYA 2JCCA 5HVHB 5EBLB 5LCVH 2C4XA 3AAZA 1EUUA 4E41E 8FABB 4OZIA 4K8RH 3OKEB 2KKQA 1L7IH 2OTUA 4QRTB 5C7XL 3OKLB 2N1KA 2FGZA 1I3RB 2WWMD 1MCEA 1X9QA 4J1UA 2A6IB 1HSBB 3QIUC 4PJ5E 4WW1B 2HT3D 3QPXH 5CZVL 2FEDD 3QUKB 1H0DB 4LIQE 3LQMA 4K07A 1UZ8A 1AGEB 4MJ4A 3GIZL 4QCIA 2D2OA 2Q8AL 1QKZH 5I8EA 1DANU 1ZEAH 1TQBC 4NFBA 4CMHC 4JVPA 4BSVA 1HQRA 3FN9A 4U1SB 4BZ1H 4P2RB 1I8KA 5D2NE 3LDBC 2JIXD 1LEIB 1HI6A 2QQNH 1QRKA 1YEIL 2VLKA 1C5BL 3VFSA 4N8PA 4AH2A 3H9HB 3ZO0A 1N2RA 2UZXB 3QEUB 2NX5E 3FHAA 4Q58C 1A6TA 4X6CA 3WNNA 4LF3B 4TUJA 1A3LL 2Z31D 4ZSOE 1CDGA 5IBLC 1DQJA 1KTDA 1YY8B 2CK0H 3HZKB 4FQCH 2DKSA 3DRQA 4R9HA 5DJAA 3QQNA 5C0JB 4KRLB 4HJ0D 4XMPL 4HDIA 1I8IA 3OB0K 4YHNA 1FNGA 4M6ML 1OAUH 4M62H 2OZ4A 5FUOH 1KXTB 2HWZH 3HI1B 1G9MC 3R1GL 5C6PB 1GCFA 2E6QA 3LH2L 2ITCA 7FABH 3I6LE 4JG1L 4PR5A 3QP3A 5DSCA 1AXTH 2XWBA 5KSAA 1L6ZA 1CCZA 4JKWA 1RUAL 3VA2C 4HXAH 5FO9A 1B0GA 3HNSH 3RVWC 4JHZA 1IRAY 4YHIA 4LOUC 1DJSA 3MCKA 1PSKH 1UWEH 3IFOB 4JDVA 1BZ7A 2MKWA 1G9NL 1AD9A 4PGEB 3FKUS 5EU6B 1KTLB 3VH8G 3T0XA 3RWFB 3LHPH 4S1SL 1UVQA 5BO1H 1OPGL 4QT5A 1ORQB 4NO0B 1UM4H 5KSBE 4JDTL 2NZ9C 5LGHH 2DLTA 1QLEH 4RIRA 2A0LD 3CXDL 1SEBB 4LLYA 3LD8C 3BQUC 5FOBA 4G8IA 5E1AA 1BAFH 1DDHB 4HIHB 1M71B 3OKDB 5I66A 3S3PA 4YR6B 4CW1B 5IR1B 3V4VL 2CSPA 1S9VB 3LN5B 3GSQB 3BSZL 3Q5OA 1IGMH 3QDMB 4EI6A 4KI5C 2AEQL 1S9XB 1EHAA 3HE6B 5J1AA 4TSAL 1J0ZA 3BN9C 2E7HA 3MUGB 5EOQH 3OGOE 2EEDA 3SJVD 4M1DH 3OAYH 4JDZA 1I8LC 5IB2A 2GJ6D 3VXRE 1RZJL 1Q9OA 4NHCL 3C6LD 3AB0C 2IG2H 2OYPA 3PDDA 1F6LL 1CFBA 1XAUA 1FZMA 2M1KA 4LCWB 5HJ3B 5CJQH 2D0GA 1WCQA 2IQ9H 3HFML 3U9PL 5IHZB 3OL2A 4KDVA 1ITCA 4RGNB 1XF4A 4ZPVA 4ONHB 2Z92B 4PY8J 1QFUH 4K71C 2R15A 4HXBL 4U6YB 1MLBA 3QUZC 4PTUA 5A40E 1A6UL 4I3RL 1YNTA 4WWKD 4G9DA 4B53A 1J1XL 3MRBA 1WWBX 1AY1L 1T20A 4IRSD 2XTJE 5HI3C 1KEML 3UTSD 3S37L 1YJDC 5E6IB 2P5EA 5IEHB 1YEDB 2Z4QA 2VDOL 4V1DB 1KB5A 5D72L 4Q6IB 1F6AA 3C5SA 1B9ZA 4XPBL 1EMTH 1PLGL 3HR5A 4Z7VF 4JHBA 1OP9A 2DMKA 1VFOA 4Y5XA 3TBSA 4FN0A 3ETBF 5K33A 4PYHA 1EGJH 1IEAA 1I9RL 2FZ3B 1KJ3L 4I2XB 4XVTL 1H8NA 2NY5C 4ZFFB 3NIDE 4Y2DC 3ZHDA 5EBMB 5IEKA 1ZKAA 2L0DA 5DI8A 2R8SH 1UQSA 3W9DA 4WIQA 4H0IA 1I7RA 3NBNA 2NY6B 5D1ZD 3BZDA 4JFEA 2AK1L 4Y19A 3V0VA 1TCMA 2IEPA 1HEZA 4M48L 4M1GH 3GI9H 1WZKA 5D7LB 5LWYH 5GS3A 3NPSB 1PJ9A 2D03L 3FN3A 5JW4M 5CLTA 5SX4H 3TN0D 4RAVB 3VFOA 2WM0A 3DX9A 1P7KB 4CL7A 1DL7L 1OWWA 3BKCL 3LSOB 2HAZA 5EO1A 1IC7H 3BDBA 4H25A 4XXCC 1QSEE 1WGOA 5LBSL 4P5TD 4FABL 2WWMC 4MB4A 3O9WD 4TVSa 2G9HA 5DZNA 2HT3C 2FEDC 1NCWL 3C09B 3MRGB 3RDTB 3VWJA 1EAJA 1IBGH 2NY4B 2VDQL 1MEXL 4XMLL 1IM3A 5ID1B 2OR9H 1I1YA 2ITDB 2NY7H 3QRFM 5FGCB 3GSXA 5CKGA 2KQNA 2VC2H 4G8GD 2R4SL 1NLDH 4F8QA 2Y07H 4FFYL 3D87B 4LHUD 3NIFF 4PJ8A 1NCAH 1ZA3A 2AJUL 1ZHBB 5GGVY 3B2UD 2CLVB 2O61A 1AXSA 2YEZB 1BEYL 4D9LL 3O6LH 3IVKA 1QRND 1T1ZB 5HHMD 1ED3A 2Z31C 1D6EB 1DVFD 4EXKA 4L9LB 3FFCE 2APFA 2B8OT 2EIEA 2IFFL 3H7LA 1RMFH 3PNWB 4PJFA 4HAGA 4XAWH 5L9DL 1NFKA 2PF6A 4HJ0C 1KLUB 1DBML 4JFDE 3ARFA 4GUPA 1AGBA 5SWZB 4Q0XL 3GMPA 1OF2B 2YD8A 2FH6A 1WIOA 4JQXA 4I9WD 3BZ4B 2X70B 2EKSA 4GRMB 4FQXD 4X7FC 4Y4FB 1CD9B 3VXMB 3QO0A 1FJ1A 1F8TL 5F7HA 4G7VH 5DWUL 1BF8A 3U9UB 2AQ2A 1G6VK 2WUCL 3MBEA 2F8OA 3TESA 4X5WA 3O8XB 1FZKB 2MPAL 1EXUA 5D93B 2X1WL 4OAWB 1IQDA 2B1AL 5E24E 3HN3A 1WBYB 5K9KB 3KXFA 4P4KB 1HE7A 3QAZC 3KPMB 2LU3A 3QRGH 2R2EB 5FYLH 5I6XB 4PJ9B 1P4BL 4KQ3L 5MI0B 1T1YA 3LKPA 2V5MA 3HAEH 2BHZA 5JHLH 5D1XA 4Z7UA 3DO3A 2VDNL 5I16B 5FYKL 3FQWB 4YHLL 3SDAB 3S5LB 2DWEA 1T0PB 1T04A 3QDHA 4JFPB 2VISB 4NKIL 4C56E 3CC5A 5IB5B 1A1NB 1Q38A 2A0LC 2YRZA 3V7MA 2HYMA 3LKRB 1TMCB 4Y1AB 1NEZB 3BEWA 4UNTA 5EUKB 3IT8D 1UB6A 4G6AD 3ARVA 1D6VH 3G5YA 1IE5A 5SWQB 4R7NA 4TNVK 2WP3T 2E7MA 2NR6C 3BH9A 5IFAL 2X40A 2APXA 3MSPA 3MX0A 4JQIH 3O4LE 4D0DA 5GRWA 3MXVH 4ELMF 32C2A 5DD1L 2P4AB 3TZVB 1J8HD 3DRTB 5DZOA 2IPTH 2NZIA 1UJ3C 3MCLH 1J0HA 3KPNA 3C6LC 5HHXH 5ISZA 3QQ9D 1NGYA 1DR9A 5IB1A 4JN2B 1ZLVH 1JFQL 4H88H 1VEPA 5GS0H 1Q8MA 4UZGA 1VFBB 1HOCB 1LO0H 1HXMB 4OF8A 2UY7A 4YHML 5F8RC 1KBGL 1NMAL 1S7UB 4HQQH 3REWB 5JTWA 3H9SB 3EYFB 4NP4H 1ZHKB 3TBYA 4NFCA 1OLLA 1A7PL 4JN1H 3VXUA 1F4WH 1Z6JT 3MLYL 2J6EH 4WWKC 3ZYIA 3HA0A 3F6IA 1T6VN 1BHGA 3O2DA 3QG6A 2QQLL 1FFPB 1PX4A 3KPSE 3MRRB 3GK8H 4D94A 4IRSC 2XKSA 4U05A 5IVZB 5GJSH 3D25A 3QDGE 5JQ6H 2VXSH 3D39A 2CDEB 2OI9B 3HG1E 5JW4N 2VLJD 2XZQH 5HHOB 5HYJD 1YN6A 4TVPD 3NZHL 3S4SB 5DJ8B 4OQTH 3ZKND 2W59A 4M7JH 2E27H 4ZOBA 1Y0LA 1QNZH 3MZTA 3H3PH 4LHUG 3RA7H 1EFXD 4Z8FL 1U3HB 2AEPL 2XXCB 5C0CE 3RNKB 1B88A 3LN9A 4LKCB 1BQSA 3L3IB 5D1ZC 2DQEH 4GXVH 2VN7A 4IMLA 1YEEL 5I73B 1FNLA 3NFNB 2P44B 2XKNB 2D0FA 4WFHD 2UY6A 3D48R 1VPOH 3SDYL 5EBLA 1OD7A 3B2VL 4HH9B 2PCPB 5I75C 8FABA 2GK2A 3WDIA 4FQ1H 3OKEA 5IOPA 1MLCB 1HYRC 3IJYB 3O3UN 4QRTA 3TN0C 1VGKB 1G0DA 1I3RA 5TQ2L 1WC7A 1CL7I 2ZUXA 3KNBB 5LAXB 1HSBA 5IK3A 1R24A 2B20A 2MOVA 5J13B 2PYED 4P5TC 4Z7NE 3O9WC 3UYRL 1U8LB 4NJAH 5JLZB 1UB5A 4K7PY 4PJHF 2WNGA 5FCSH 3ULUD 3AY4C 3QULA 4RMVA 3N06B 1A5FH 3SPVB 1H3TA 5IMOA 3L3HB 2I07A 3O11B 5DUPH 3LQAC 4G8FB 1WFTA 4HS6B 3PWPD 4OCNC 4RA0C 3H9HA 4L3AA 1JJUA 3QEUA 4M03A 1KCRL 2FX9H 1UXSB 1V05A 2UUDK 2BY3A 2H3NA 3B2UC 1FCGA 3U36B 1YY8A 3HZKA 3DETD 4K3DL 3T65A 3QUML 4NCC2 3U7YH 1QHPA 4R26L 3SGDH 2MCG1 4L8DA 5C0JA 1DVFC 2VIRB 4PD4K 5K93A 5KVGL 3TH4T 4NZTH 1CDIA 4OZFG 2FX8L 4YIQB 1OTSC 2OJEB 1QA9A 4PJ7B 4WO4B 5GGTH 1CLOL 2XFXB 3KHQA 1CG9B 4KTYA 3HI1A 1MFCH 3VRIB 5LXGH 2VR9A 1T7YA 1CLZH 1MFAL 1XCTA 3U2SB 1FL6B 3BT2L 5BXFB 4PGBB 5DVKA 2YD2A 43CAB 5L7XH 1IAMA 3BP7A 3UTPD 3EJJX 2X4PB 3NN8A 1NLBL 1S7QA 1XGRB 3BKJH 3H9YA 4FQXC 2CIKA 2JCCF 3OJMB 1QSFB 4OZ4B 1XIWB 2F53A 3QEQD 1RAMA 1D9KD 1NGXA 4OCSH 5JXEA 3IFOA 1LO2H 4O2EB 5C3LD 3GMOB 2QTEA 3DURA 4PGEA 3A0OA 5EU6A 2CR3A 3SKOB 3ROOB 2QADB 1AD0A 3CCHB 4YX2H 1JGUL 1B2WH 2DQFB 1ORQA 2DQIL 2DQUL 3B5HA 3QUYD 4NO0A 5CJ5A 4GLRH 3T3PF 4U3HA 2V5SA 2Y4SA 3INUL 1T2JA 3QIWB 5T5FL 2DF3A 2DLFH 1SEBA 2BY1A 1SHMA 3VI3F 1IKFL 1OB1A 3TT1H 1IM9D 5IMMB 2AJVH 3VGEA 3LMJH 3OKDA 4XBGB 4AQOA 1RZKL 3WFBH 5IR1A 2AEIT 3LN5A 1S9VA 3DVGB 2CLRB 3UTTE 3QDMA 5DQJB 4G6AC 4ODTL 4P57B 5T3ZH 3HE6A 1FLRH 5JHDA 3B9KB 3MUGA 1A21A 1OQOA 1RURH 4LFHG 5E2TH 4Q6YA 3I75B 3O3DA 4JM2F 1V7MH 1JWMB 5I8OH 2PXYD 1O7SA 4U31A 4OGZA 1DSFL 3P9WB 3FB6B 5IESL 4EOWL 5ITFA 4PJHE 2ZUUA 4DKEL 5C71A 5HJ3A 4LCWA 4ZXBB 4RWYH 1M6OB 3Q0HA 3D3VE 3QQ9C 5F9OL 3PQYB 2G75B 4PJDB 4ONHA 2Z92A 1X3DA 1T7WA 3SE8H 4NC0B 4BFEA 4JJ5B 1JV5B 4IJ3B 2ATPB 3UJJH 4NBZB 3RY4A 4U1MA 4KPHL 3CK0L 4YXLH 4M5ZH 4ZG1A 5I19H 5KW9L 2DMCA 3VFWA 5I0ZA 4QRUB 4M6OL 4GW1A 5J11C 4PRPD 1GOFA 2R2HA 4LMQE 4PJXB 4Y5YB 1WTLA 4N68A 4HEME 4XP6L 5E6IA 3IAPA 4UAOC 5IEHA 1YEDA 2R39A 2VZUA 5HGAB 3IAQA 3JWOH 4O58H 5IIEB 4LVNC 5CSGA 4L3EA 4K94H 6FABL 3GBNL 4K3HA 3MRMB 1MWAB 2DQJL 4X8JB 3QZWG 4I2XA 2FZ3A 5DK3A 4ZFFA 4PP1D 3ZKNC 5EBMA 2MFNA 3SGKC 1CDBA 2FB4L 1WAAA 2Q7NA 3BI9X 4R2GD 1FIEA 1BVLB 5D7LA 5A3ID 5K9JL 3CVHA 4OV6F 1KPUB 4Y5VC 1X5LA 5E2VH 1RIHL 3C6SB 1B4JL 5IFHH 5CUSH 3WIHH 2K3TA 3WUZA 4NN5B 4NT6B 1T1WA 4ZODA 3UCRA 5EDXA 2HVJB 3U0PB 2D31B 4RAVA 4HX1B 1IKNA 3MOAL 1Z0NA 1T03H 1QO3B 1VGEH 3NGBC 1AR1D 5IVNA 3LSOA 4O02L 2OQJB 4OI9A 5CIPA 1NMBH 1GZQB 5F9WC 1A7NL 4HIIA 1XCQA 3O3BB 3MRGA 3VI3E 1K4DA 5KSVB 2XACC 1OAXH 1E6JL 4OZHA 4AG4H 5ID1A 2A9ML 1ZLWK 3ULUC 3RJDA 3T4AA 5F97E 3P0VH 2DKMA 2YWYA 4GG6F 4TN9A 2VLRA 4QOKA 3EUUA 2NY3D 1Q9LB 1ZHBA 4M8QA 3TYFB 1G9ML 3P4OB 2CLVA 1PD6A 3T1WA 4CN6A 2YEZA 3ES6B 1V3KA 5T33H 4OKVA 3BDXA 2W0KA 5ABDE 5CJXA 3H7BB 5AEAA 1N4XL 2VQTA 1D6EA 5JW3L 5IT2H 5GGRY 3RL1B 3DETC 3CFCH 4L9LA 4ZNEE 3TPUB 1PBYA 4X83A 1UKTA 4NQDD 3PNWA 2AK4B 2YPVL 3IJHB 4IRZL 1KLUA 3RWCA 3GSNL 3ZL4H 2K7PA 1OAQL 5SWZA 3BRGC 1RU9L 4PJAB 1FN4B 1OF2A 1X6NA 3I6KA 4J3SA 3ARBA 3BZ4A 3P73A 5D5MB 5E4EC 3VW3H 2X70A 5E8EB 2HFFB 4E9LA 6CGTA 2BRRL 1CK0L 3VXMA 2HFGL 1CFSB 3MV7D 5MENB 5J4MA 1TENA 1MHHB 2AJZB 4N8CH 2APWA 2H6PA 3U9UA 4YDKL 4JFHE 2AGJH 4HUKB 3O8XA 1FZKA 4PY7B 5DXWA 4OFYD 4FQ2H 4L1DA 4OAWA 1D9KC 2V2WA 4P59H 5K9KA 1IGTB 1VKXB 2R2EA 3O6KH 4QXWA 1K8DB 4LIQH 1CN4A 3WO4C 4KGJA 3DV6A 4ORZC 3G5VB 2AVGA 3ZTJH 4K55A 5I16A 1FVEA 4NQCB 1L0XA 3SDAA 2EH7H 4UB0L 4JFPA 2VISA 3LN4B 4O9HH 3QUYC 3VFTA 5AYUH 3SDCA 1K8IB 1INDH 4WU5B 4U6VL 5IB5A 4CVUA 1L0QA 2P47B 3NABH 4PJGF 3LKRA 1CF8L 4QXGL 4Y1AA 1NEZA 4NZRL 5EUKA 2WQ8A 2R2CA 1TNNA 5SWQA 4C4KO 4MJID 4GW4B 1ADQH 1CIDA 3ZE0E 3VXSB 5H35B 1FORL 4OFPA 1MY5A 3QG7H 1U8QB 4LVOB 1A14L 4OI7A 1IARB 3IFNH 1A0QL 4LLQB 2XG5A 5HDQL 4JPWL 3DRTA 3N0PB 4UDUB 3C60D 1JMXA 2PXYC 4OT1H 5SWSD 3G6JB 5E08L 2ADJB 1J05A 5D7IE 5HHNB 1INQB 5L2KB 2V7HB 4NPYB 2E9BA 4KK6D 1HOCA 1T3FB 1T66D 3RUGE 4ZOAA 4X6DF 4EN3B 2V9RA 1WBZB 3LKNA 4F9PA 4HCRH 3REWA 4M4PA 3EYFA 3DSFH 1ZHKA 4OM0H 3QHZH 2ICES 4Y19D 2G5BB 3QXDB 4RISL 4PUBL 2YD7A 1Q0YH 1T5WB 5HVGB 3BIAX 3MLVH 1CZ8L 3W0WA 2KBGA 3L5JA 2NY5L 5FGBA 5C92A 4L8SB 2EKJA 3PHOA 2OS7A 3EKCA 1MCSA 2NY1D 4NKDA 4ZPTB 2YRLA 5CSBA 5AD0A 3LV3B 3EOYG 4YHYB 1FZOB 1G6RB 4N0UA 3THMH 1ZSDB 5HHOA 2I26N 3DV4B 3S4SA 4JHAH 5DTFA 4Q9QH 3PP3K 2P8PB 1KCVL 4MJ2A 3WD5H 1EIBA 3VWJD 1R5WA 4HLZH 1TPXC 4GG8B 4PP1C 4QHNA 3W39A 1U3HA 1NC2D 1LMKA 4LKCA 4Y0GA 1YEFL 3AM8A 4PRBB 5JOEA 2JKXA 2XT1B 4N9OB 4LSSL 1G7PA 1QYGL 1IAOB 3WUWB 2XKNA 5BRZE 4R2GC 1JNJA 4PJ8D 5CZVH 4Z18A 5A3IC 4UT7L 3GUTB 1FSKC 1PQZA 3PL6B 3GIZH 4P2QB 5JR1L 4KI5E 3IDMA 2Q8AH 2PCPA 3V6BR 4WFFD 4R6UA 3IJYA 3ARSA 1BOGB 1VGKA 2CR6A 5TE6L 5DD5L 4ZUVB 4KI1A 3KNBA 1AR1C 2V17L 1YEIH 2ZUSA 2BC4B 1C5BH 3MGAA 2R0KL 5C8JA 1G7HB 2AJXL 2ICWI 3WLBB 1UA6L 4WNQA 1A3LH 2QQQA 3HE7B 3L3HA 3IDGA 4MSWA 1FYTB 4ODUB 4HWEH 2FX7L 4WHDA 1U41A 5IQ7L 1TTFA 4B41A 1MHEA 4G8FA 4XT1C 4HS6A 2EEAA 4HFUL 1ORSB 3L5IA 3MTRA 4URTB 4XMPH 4YUEL 2VO5A 5DD6A 2NY3C 4M6MH 4WU7B 3U36A 1RPQA 3R1GH 4M3JA 2X4SB 4WHYG 4JRXE 3LH2H 2DQHH 4JG1H 4CADA 2VIRA 4J3UA 1Z9SA 4UNUA 1RUAH 3RWEB 4MXWL 5D1XD 4YIQA 5JOPE 2OJEA 4NM4H 3QCVL 3IDNB 3MNWB 1HKLL 1XR9B 2A73B 4OF5A 4RMWA 5T1MB 3VRIA 4O2CB 2WLYA 3VXTB 3CVIL 3U2SA 2D7PA 1NFDB 1FL6A 2V2TB 5BXFA 5GRVL 4ETQB 43CAA 2ESVE 1MQ8A 3WXVL 1G9NH 2EIDA 2X4PA 2D7QA 5CEZH 1FE8H 1JN6B 3HPJA 5BV7L 3LKSB 1A4KB 2ILLA 5DEFB 3CFKB 4S1SH 1MPAL 1VCAA 4GRLA 2NNAB 2C7UB 4HC1A 3BPLB 3BIKB 4HS8L 3CXDH 4PRHD 3ZDXF 1P84K 3GMOA 1P5UA 5C08B 4BH8B 3ROOA 1KOAA 1Q1JL 2A2QT 3AU1B 3QUMB 3CCHA 4CVWA 3C2AL 2CKBB 3BSZH 2DQFA 1CL7L 1P5VA 3DTXB 2AEQH 4LPUA 1G7IB 5E8NB 1FFOB 2RFXB 3QIWA 5HHVL 1F4XH 4PLJD 5TDOA 1UACL 5FFLA 3PIQB 5D71L 5IMMA 3OAZH 2Q6WB 3A67H 1RZJH 1MWAH 3SQBA 4NHCH 5J6GA 5JIKA 3DVGA 5C09D 3VWKD 5DQJA 4YPJA 4P57A 4EI5D 4KVNH 4D0CA 3SY0B 4A6YA 2X4TA 3FL7A 5K9OB 3HFMH 3U9PH 3BMWA 3NFSL 4TTDD 1XGUB 4PJEB 3IS1X 3I75A 3RHWK 3VDBA 1J7VR 4ESKA 2EZ0D 1JWMA 4WUUD 2Z8WC 3D39D 1TZGL 4APQB 4N5ED 1KJ2L 3C60C 3C8DA 4BFIB 3MLSH 5EZIH 1HHJB 1MUJA 3IDYC 2VDRL 1M6OA 3HZVB 2ICWJ 2B0SL 4Y5XC 1JNLL 4AYFA 2ZJSL 3DECA 3PQYA 1LK3H 4PJDA 3UJTL 2XIDA 3DUSB 1KEMH 4JJ5A 4KK6C 4JFFD 3S37H 1OHQA 1T66C 3MLUH 4NC1C 5D72H 2DICA 2A6JB 1CTNA 2AXHA 4IIQC 1PLGH 4I18C 4PGJA 3L5WB 1TCRB 3TA3A 1JHKL 4XVTH 4Y5YA 2J8UA 5L6YL 4N8VB 3DGGB 3UC0L 2BCKA 5HVFB 4OLXL 5JIIA 4OM1L 1T83A 3EYOA 3QH3B 3ZZ1A 3PGDB 5EWIH 2NY1C 1S9KC 3WHXB 2AK1H 5HGAA 4D8PA 3H0TB 5IIEA 1P69B 4M48H 4LPXA 4HKZB 1FH5L 2XI9A 3AMLA 1HIML 4LPVA 4U1GC 4NN7B 3WDHA 2VZSA 2EXYD 1YNKL 3MFFA 3R06A 3SO3C 5J12B 4O5LL 2D03H 4XGZB 2DWDB 3VWJC 1DQML 3FQUB 4PG2A 1BZ9B 4NWTL 3FB7B 5BMFL 4P2RD 1DL7H 5E94A 3B5TA 4PRIB 2BY2A 5JPMB 1BVLA 3BKCH 2D4FA 1A2YA 3EOAB 4KKAD 1KPUA 1D5MB 3C6SA 1EHNA 3M8OL 4QRPA 5L88L 2OK0H 4PJ8C 3ZDXE 4H20L 1H3UA 1NCWH 4NT6A 3FB8B 1OCWH 1YC7A 5JOFB 5L0QB 3O6FB 3U0PA 2D31A 2VDQH 1MEXH 4XMLH 5F7LB 1L7TL 1QO3A 3LQAL 4K9EC 4X0KA 5MP6H 1UG9A 4P2OB 2GAZA 2OQJA 5FYJD 4HUMB 3SJVE 2BDNH 5JA9A 1GZQA 3MV8B 2R4SH 2R9HD 2GJ6E 1NJ9B 1S9YB 1WFUA 3EFFB 4NYLA 5KSVA 2AJUH 4QRRB 1BEYH 4QRQB 4D9LH 2VZ1A 3WFZA 5CD3B 4NWUL 1AKJB 3CFIC 2ORBL 3ECBB 5I30L 2DI7A 3B83A 4JQXC 1X5KA 3ET9F 3L3OA 2OMNA 2IFFH 4AT6A 3TF7C 4Y88A 2VXVL 4Z7WF 3TO4A 2P8LB 1Q9LA 3TYFA 4WGWB 1GOHA 3P4OA 2RB8A 3ES6A 3DXAA 2JB5L 4Q0XH 2QEJA 1QEWA 5BS0A 3HNTH 4PG9B 1L9MA 1JHTB 4PREB 5EU6D 3TH3T 4ONGH 3UTSE 2FECL 3EBAA 3IJHA 1F8TH 1E4JA 2UWEB 3NAAL 5C0AB 1J10A 2WUCH 4NO0D 5D1XC 2B2XL 4PJAA 4Y7MA 1FN4A 2MPAH 2G2RB 1XFPA 1JWUB 2PTUA 3CZJA 4OFKA 2B1AH 2HFFA 5E8EA 4ZUUA 1YZZA 1JGDB 2AJ3B 4NFDA 3DMMA 3WKNA 4YO0B 1P4BH 4KQ3H 1OM3L 1CFSA 1YEKL 4G6FB 4ERSH 5MENA 1MHHA 3PWNA 4XRCB 3QDMD 3SOBL 5E99L 1R3IH 2VDNH 3HE6D 3HZMB 1ES0A 5EZOL 5FYKH 5DO2D 5EOCJ 2WK2A 5JMOC 5KVDL 4P3CL 4NKIH 4RCAA 5TE4L 1R5IB 1VKXA 2D3VA 1OL0A 5DJYB 1G7MB 1EK3A 4B5EA 1K8DA 4FTVB 4LEOB 1KC5L 1A1MB 3PWJB 4LLUB 2RHEA 4Q9BA 4MXQD 3G5VA 1QFOA 1XMWA 3FMGL 4LCWD 4X4YB 4NQCA 1OQXA 5IFAH 5E00A 1T22B 1YYML 4RGND 3LN4A 1AE6L 2H32B 1A8JH 3LIZL 1K8IA 4WU5A 2QSQA 4PLJC 5DD1H 1D7FA 2YZ1A 1RD6A 2FEEL 2LABA 5DJCB 1OGAA 1IAKB 4LGRB 3HZYA 4GW4A 1YA5A 4DN4L 4YDVB 5H35A 1PY9A 2YMXH 3VWKC 4G8GE 1U8QA 3M1BB 4EI5C 4ZUSB 1JFQH 1PZUB 5IBTL 5CJ8A 2VXUL 1AGDB 2GK0B 4LLQA 5GGSY 4TTDC 5F1OB 5E6ID 4YHMH 3QIBD 4R3SB 1KBGH 1NMAH 2VXTL 4RFOH 4V1DD 5DHYB 2EZ0C 3QQ3B 3S35L 1EZVY 1QBLH 5EO0B 1P2CB 3G6JA 5HHME 2ADJA 3JVGA 4N5EC 1A7PH 1BZQK 4OLUL 3DSNA 5HHNA 1HZHL 1INQA 5L2KA 2V7HA 3P4NB 2QQLH 4XBPB 4XP4L 4EN3A 1PEWA 3S3SA 1WBZA 5T3ZD 2NY6D 4TUOB 4K3JH 1H3GA 2G5BA 3QXDA 2W9EL 3QBTB 3D9AL 5F9JA 1SVCP 1T5WA 3D85A 4L5FL 1Y6MR 2XN9B 4I9WE 5D7LD 4UU9B 4PBVC 4TVPL 4X7SL 3NZHH 2YK1H 1FO0L 4L8SA 5IJKA 3G04B 4XXDA 1IJ9A 3RWDB 3LEXB 4ODVL 4ZPTA 4Z8FH 3LV3A 3BOVA 3BZFB 5BQ7B 1NCBL 3VFGL 1FZOA 4G6KL 1V8HA 1G6RA 1A9BA 4JGJA 4HG4J 1HWGB 1T0NB 1U0QA 4RX4A 4MJ5B 2P8PA 2X4RB 3TYGL 1BREA 1XGYL 3G9AB 3RDTD 1P9MA 2EXYC 2NY4D 1CR9L 1UH3A 1FL5A 3CAFA 4MA8L 4PB0L 5EUOF 3B2VH 4KDTA 4L8BB 4L29B 5I71B 4XVJL 4PRBA 1AXIB 2ZUVA 4GS7B 2EE6A 5TQ2H 4IOIA 4XB7A 1OP5H 1IAOA 3WUWA 4KVCL 1KIRB 3KWWB 4KZDL 4KKAC 4WJ5B 4NSKB 3UYRH 3ULUL 1ZVSB 4K2UL 5HGBB 4U49A 1BOGA 2PYFB 4F7CB 5CFHA 4EXPX 4NQEA 4ZUVA 1EHXA 3MLZH 3GMLB 1LEGA 3WDJA 5KS9B 4HGKC 3HNVL 4QF1A 1J8HE 1JI1A 4GW5A 2R9HC 4KTDH 1G7HA 1KCRH 3WLBA 2VOTA 3GJFA 3O45B 3QB7C 2VB5A 3HE7A 2FATH 4RWHA 2EEBA 4K3DH 3QUMH 4AEIL 2AJSL 3B9DA 3OQ3B 3WN5C 2CJUL 4R26H 4Y4FD 5IW6B 2XXMB 5F93C 3QNYB 3VXMD 1N5AB 3HPLB 3K46A 1ORSA 3MV01 4POUB 2WUBL 5KVGH 2FX8H 1UCTA 5DHXB 5DRWB 12E8L 2X10A 5IW1B 3QUXA 1YY9D 3O8XD 2YPLB 2YD9A 3STLB 1C5DB 1CLOH 1DEEB 4AY0A 4JANB 5AG9A 3MV9A 4WEBL 4MCYB 3TPKA 2X4SA 1LE9B 4J3VA 2W38A 4P4KD 1FNEA 1MFAH 3HUJA 5CBAA 2ICCA 3BT2H 3N1GC 4PJ9D 3S36X 4LNRA 2X09A 1BJ1J 1NLBH 1ZT1B 2FJHB 5J56B 2YUWA 3IYLW 3RWEA 4P9HL 2C1PB 4NQTA 4MHHI 2XICA 2VLJE 1XR9A 2A73A 2VWEC 3VCLB 4O2CA 5HYJE 3CMOH 4TVPE 3VXTA 4OTXL 3SEPA 3UTQB 3QWOB 2V2TA 3TJEL 5INDB 5F3BB 4BK5A 3VI4E 1DN0B 4HUUB 2NW2A 2VR4A 1VFAA 1JN6A 3LKSA 4XZUB 3V52L 1WICA 2AI0L 2ZNWA 1QFWL 2DQUH 1MCWM 1WWAX 5F21B 2C7UA 3HE6C 3STZB 3BIKA 3INUH 4WFHE 5DO2C 4S2SB 1GAFL 4RDQG 5C08A 3TZVD 1KYOJ 4BH8A 3GRWA 2EDBA 1RZKH 3KLSA 5D7KD 5DURD 3SHSA 4UTBL 3BGAA 3ULVF 2CKBA 4MXQC 3DTXA 2WV3A 2BMKB 3Q3GB 5E8NA 1FFOA 3IS0X 3RY5A 5DD3L 2PYEE 5JIPA 3NFPB 4RGNC 2AJYL 3MRJB 2OP4L 2HTKD 2Q6WA 3IXAB 3Q1SL 3H9SD 5HTSA 3P11L 4CU6A 3ULUE 4W4NA 1QPXA 4EOWH 3DUUA 1HNGA 5ANMB 4ZOEA 5DR5L 3FQRB 3SY0A 3V4PL 4AMKL 3LB6C 5CILL 5K9OA 3KDMB 4E0RB 3ALPA 3ZLQC 1XGUA 3PWPE 5F9OH 4PJEA 1K85A 1EVTC 4WI9A 5KZCB 5EU3B 5BV7B 1QFWM 3AROA 1QFPA 5E6IC 3GGWB 1J0KA 5I17B 4APQA 3QIBC 3RNQB 1U92B 2Y5TB 4KPHH 2ZCLH 4Q6IC 4F7TB 1HHJA 1SVZA 5KW9H 5IMLB 4M6OH 4Y2OA 2GSIB 5CJOL 1Z0MA 2AAVA 5BZDA 2E8ZA 4MD4B 4D9QD 1SM3L 1DE4A 4GAFB 1PKOA 4XH2A 3DUSA 3RPIA 1VESA 4KMTL 1A6AB 1KJVB 3Q2CA 2NY6C 3QFJB 2AV7A 2A6JA 5T1KB 1ZLUH 2P5WA 1Z5LA 3RWIB 2FHCA 4O00A 3OR6A 6FABH 2HFEB 4FS0A 3GBNH 3ZT7A 4UOW0 1D3CA 1TCRA 2Q7YA 1E4XI 4Z78B 2DQJH 2O5ZL 5FCUL 3UTPE 2X4UB 5CHNB 15C8H 1NCNA 2VUYA 4JY4B 3NPSC 4CRPA 5CGMA 4N8VA 3DGGA 3OAZK 3KYOA 3QH3A 3DROB 3QEQE 3GSOB 3UX9B 1F11B 4C55A 1JNHA 1IKNC 3MLXL 3WXWL 3H0TA 2FB4H 1R3KA 4DOHE 2CDGB 2IAMB 3PDOB 3I3BA 1DUZB 1CI5A 2IH3B 4HKZA 4PIRF 4H1LH 5K9JH 4F3FA 1RIHH 1B4JH 2DWDA 4GMSL 3C09C 3RDTC 2OBGA 5D96B 3FQUA 5I74B 1BZ9A 2NY4C 3I02A 3ARWA 3MOAH 3CXHK 4XNXL 3FO9B 3W5MA 1BIHA 2IANA 3NCJL 4O02H 1TTGA 5C0ND 3EOAA 3ARDD 1A7NH 3QXAA 1VA9A 3MJ9A 4WI2A 3JWOC 2OZ4L 5D2LE 3O6FA 4NN6B 5EZLA 3RVUD 3AC0A 1LO4L 1E6JH 4EKXA 1Z9LA 2YA0A 5ETUB 3V4UH 1F3DJ 3FCTA 4X5XB 4JGUA 1U8NB 4ODBD 1U8KA 4LLWA 3MV8A 3MZGB 4L9LC 5DC4B 1D5BB 3U4EB 1NJ9A 2DLEA 4LHQB 4IEFB 4WO4D 4QRRA 1YPZB 1G9MH 2VTFA 1QSVA 1NEZG 4UIKL 3PXHA 2EDOA 5CD3A 4GKOA 1AKJA 1EJ6A 3ECBA 1N4XH 4OF0A 5JW3H 1F4HA 5FV1L 2R0LL 3OJ2C 4Y4FC 1BJ8A 2P8LA 2CIIB 2J8UF 1QSFD 1WEJL 4IRZH 1XIWD 3QI9B 5E9DB 2YOCA 2UYLA 2X4QB 1NCUA 4DVRL 3GSNH 1OAQH 1RU9H 4FP8L 1YY9C 5I1GH 3O8XC 3OZ9H 4QNPE 5D93C 1JYWA 4PRPE 4JFQB 2IJ0C 4PG9A 5HY9B 1FVDB 4PREA 1C1EL 2FWOA 4P4KC 2QADD 5I6XC 4ELKB 1CK0H 4PJ9C 4M8VA 5MI0C 4F7EB 3G6AB 4JJHA 4KKBD 1FLTX 3K4ZA 3IRPX 1SY6A 5C0AA 1BD2B 1MVUB 5GGQL 4AK1A 2O5YL 3QIWD 1VERA 2G2RA 2ARJQ 2WIIB 4KAQL 1JWUA 4U1IB 4XCYB 1JGDA 2AJ3A 4HBQA 3RZCB 4YO0A