2PUTA

The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
352
structure length
339
Chain Sequence
PYKHFMQKEIFEQPDSAFNTMRGRIDFENCVVTLGGLKSWLSTIRRCRRIIMIACGTSYHSCLATRSIFEELTEIPVSVELASDFLDRRSPVFRDDTCVFVSQSGETADSILALQYCLERGALTVGIVNSVGSSMSRQTHCGVHINAGPEIGVASTKAYTSQYIALVMFALSLSNDSISRKGRHEEIIKGLQKIPEQIKQVLKLENKIKDLCNSSLNDQKSLLLLGRGYQFATALEGALKIKEISYMHSEGVLAGELKLPIIAFATRDSLFPKVMSAIEQVTARDGRPIVICNEGDAIISVHTTLEVPETVDCLQGLLNVIPLQLISYWLAVNRGIDVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords isomerase domain of glutamine-fructose-6-phosphate transamin
publication title The Crystal and Solution Studies of Glucosamine-6-phosphate Synthase from Candida albicans
pubmed doi rcsb
source organism Candida albicans
molecule tags Transferase
total genus 142
structure length 339
sequence length 352
chains with identical sequence B, C, D
ec nomenclature ec 2.6.1.16: Glutamine--fructose-6-phosphate transaminase (isomerizing).
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01380 SIS SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2putA01
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2putA02
4LFCB 4JI2B 3QKIA 1HR0B 4DV2B 3JX9A 2PUWA 5BY2A 1NUHA 4EM6A 2CXTA 1WIWA 3M5PA 3JAMA 5LL6P 2UUCB 4NXMB 4DV0B 1XMOB 1X9IA 1DQRA 1JIQA 4S12A 5I01A 4JYAB 2I2WA 3I0ZA 4S1WA 1KOJA 1U0GA 2DF8A 1HNXB 4U6NA 4B3SB 4B3TB 1ZZGA 1N36B 2CXUA 1XNQB 4DV4B 4DR1B 4GKJB 1JXAA 1XNRB 2CXSA 1NRIA 4JI6B 2WU8A 4AMVA 2CXOA 3T1YB 2ZJ4A 2HHHB 2UXBB 2POCA 2XBLA 1Q50A 4LF4B 2VQFB 4AQYB 1G98A 1XTBA 1N34B 2UU9B 1N8TA 1JLHA 1VIVA 1X92A 3J81A 4LF5B 1U0EA 3NBUA 2AMLA 1C7RA 2J6HA 1FJGB 4JI1B 3CVJA 2UUAB 4DV6B 2VF4X 3Q7IA 2CXRA 1U0FA 3TBFA 1J5XA 2XHZA 3IFSA 3Q88A 4JI4B 4LF6B 2CXPA 1VIMA 2E5FA 3HJBA 3BCHA 2YVAA 4JI3B 4B3MB 2I22A 4DR3B 3FJ1A 4DV3B 1MORA 3ODPA 1HNZB 2O2CA 4JI0B 1HOXA 1VI5A 2VF5X 2ZM6B 5IT9A 4DR2B 1IBLB 2CXQA 1MOSA 2DECA 3KNZA 2E5LB 3J80A 4M0DA 2X3YA 3OTOB 2UXCB 2PUTA 1X9HA 5A2QA 2CB0A 1GZDA 2F4VB 4OX9B 4X66B 2PUVA 1IRIA 4X62B 3FXAA 1HNWB 4JV5B 4KHPB 3ETNA 1GZVA 1IBKB 1IBMB 4DUZB 4DV7B 4NXNB 4LFBB 3OOJA 4YY3B 2O2DA 1X94A 4LZJA 3UJHA 3HBAA 4LF7B 4LFAB 3J7AC 2A3NA 3G68A 4X65B 2ZJ3A 1TZCA 1XMQB 1J5EB 5BR8B 4IVNA 1VI6A 4JI5B 4LF8B 2CVPA 5LMUB 4DR5B 1JEOA 4JI8B 2UXDB 4GKKB 2VQEB 1TK9A 2UUBB 4DR7B 3T1HB 4DUYB 1C7QA 1I94B 1N33B 3FF1A 2CXNA 3SHOA 5FLXA 1N32B 4YHHB 3PR3A 4DR4B 1B0ZA 4DV1B 4TOIA 2Q8NA 1IATA 1T10A 3BJZA 3C3JA 4B3RB 2V4MA 4K0KB 3EUAA 4LF9B 3TRJA 4DV5B 5LMNB 3LJKA 4JI7B 1M3SA 1TZBA 4X64B 1HM5A 2PGIA 5IWAB 3FKJA 1MOQA 4DR6B
chains in the Genus database with same CATH superfamily
5TVGA 3W2IA 5FNVA 1V45E 1N0VC 4FHCA 4PHCA 4M0FA 1PZXA 1R3UA 1RBYA 2JGEA 1R0SA 4HTAA 4LSGA 3AR9A 5DOVA 5K2MA 5JHGB 2GJ8A 2O8CA 5LQJA 3K5PA 2Y0CA 3BEOA 2PIDA 4OP2A 2EEPA 4JKYA 2C61A 2HBQA 1Z5GA 1JJIA 3ITEA 1SKQA 1UK7A 3ID6C 4LTNA 4RGBA 3WP0A 1PL0A 1Z6TA 5BUSA 4WIAA 3KXLA 3NC4A 3WB0A 2BJHA 3C98A 1C4WA 4GRDA 5B5SA 1OIVA 2Z1DA 5JU6A 1S9DA 4G0XA 1ZGZA 5IHPA 5BYBA 3N8NA 2I66A 3JZMA 1XZAA 2PANA 4BLSA 4CHTA 5AK3A 5LBIA 2BVNA 4CMHA 3TDNA 2BT4A 5EMJA 4IIYA 3M70A 4R8LA 4WESA 1YOVA 2AW3A 3KFVA 1VG9B 4ZAZA 2HDOA 3KUKA 3X44A 1ZITA 1Q14A 1YK1A 2M9MA 3E9DA 2V59A 3NH6A 5CH8A 4HTFA 5KYGA 4X1IA 1TW3A 1PT9A 3VYVA 1JZSA 4PSAA 2QT9A 2BN4A 3NP7A 5EEHA 3RYTC 2QPAA 3GP5A 3UM9A 3EY4A 1S2LA 3NBQA 1M6NA 1VM6A 4MUNA 1I5RA 1W29A 4CI0B 2B5VA 5JEDA 4L78A 2AUNA 2D3WA 5BWBA 3K70B 5TPZA 3R7DA 4ER3A 4W5QA 3UKDA 3A4VA 2R8BA 1N7JA 4LW8A 4LYGA 2OLJA 4KO3S 4B9AA 2GK6A 2FW9A 2QQ0A 2C95A 4QEZA 2VTBA 1Z5PA 2B0CA 2GJKA 2QTHA 1KAEA 4UAVA 4MW4A 3F7MA 4H0FA 5ALUA 4DABA 1F51E 5EJ6A 3S2IA 1WZNA 3GN1A 1EB8A 3L93A 2Y68A 3BIOA 2QAJA 2YOFA 4ON9A 4DA9A 1WMAA 1U8AA 2E6KA 4E5PA 4IMJB 1U0TA 5FEMA 3DDUA 1DVRA 5I7AA 1U9YA 3EIUA 4NDAA 2IX3A 2BFNA 4FQ5A 5LNK6 4KJXA 1TGYA 1DRJA 4CLDA 1T8SA 1ZL0A 2IHKA 2JLCA 1WS6A 2Q5FA 1UMBA 3QLUC 4B44A 1OC2A 1UIMA 4BV8A 2XUPA 3IHTA 4WL0A 4YQZA 1IMOA 5ALRA 1A0OA 1K1EA 1W0CA 2HNKA 4ZAXA 1CRZA 2MU1A 4QYTA 1U8UA 2QUJA 2XMBA 4YCJA 4DANA 4J6EA 3SYTA 4NMHA 3H11B 4FFBA 2AE1A 5ADUS 4DDMA 3WA7A 1OH7A 3O73A 1N5IA 5F33A 4MYDA 1P60A 1SKYE 1WAMA 4DKXA 2OPHA 1RKXA 1OUMA 1NN1A 1AXRA 1E9CA 3JQCA 2XNJA 4BMXA 3HCNA 5CVCA 3BDAA 4CU5A 1GGMA 3DZGA 3OFSA 4D3SA 4JUAA 2QQ5A 3FTCA 2B8JA 4MPTA 5BN5B 1KJIA 1QP0A 4C2UA 3MNFA 3FR7A 4Z9AA 5DTIA 3ZZ0A 1CZNA 5IVKA 4FYIA 4PBSA 1WO8A 2X8BA 1D1PA 1TQ2A 3GGCA 3HP7A 3KOZA 5JMWA 2BTEA 4AZ3A 2Q2NA 4O1IA 2GDZA 1QS0B 1GEEA 1XL0A 4QQNA 4PFJA 4YA6A 1Y8QB 3VM6A 3TGPA 4ILEA 3D6VA 4U63A 5EXXA 1UPUA 3AC0A 4FZVA 4M0CA 3RUHA 1QQBA 1UINA 1YKFA 2WSBA 1L1RA 2ZS7A 3A4IA 3K6KA 1PV2A 2WG0A 3LSYA 4R1UA 5FWXA 3U7GA 1M3SA 3PT9A 1HKHA 3R7BA 2JFNA 3FSGD 3GEGA 1WZIA 2G5CA 1WZ2A 1ZOSA 5C4MA 1V1JA 1GPKA 1RJEA 3E23A 1OW3B 4M49A 4MVCA 4TTAA 1O03A 3B5JA 2GEKA 4XEHA 1PG5A 1WCIA 1P6QA 1AQYA 4ZQHA 4MRRA 5HDQA 1EI9A 3UBMA 2VF2A 1T91A 1V11B 1VDZA 2Q27A 3DR5A 4XGRA 1EIWA 1N5MA 4KLRA 3IMFA 4DSUA 1ZN7A 2HSGA 2W48A 3A3YA 1XVLA 3ZLVA 5FOSA 5DRYA 3EA0A 1JI0A 1FTSA 1SULA 3T1TA 2O23A 2XYGA 5EFOA 3UAVA 1P4GA 5LQAA 2VUIB 4X7BA 4ZMRA 5EJ8A 4AJLA 5KC9A 1YNOA 4LWZA 4Q9JA 3B2EA 3LHDA 2C2OA 3Q0IA 1R12A 4LSWA 2A0WA 5B3JC 5HRUA 4XB2A 1YHYA 4R3WA 1BYIA 1CVLA 2ZBQA 1T9KA 4ZO8A 4XOUA 4D3XA 3WRYA 1T5HX 2I2AA 2Z2XA 2B3TA 3NHMA 4QAJA 4WZBE 3WWEA 1I2MA 3T5CA 4E5KA 2PWBA 3FFTA 3BF7A 4Y6OA 2QAGA 2IH2A 3ML1A 4HQ0A 1CZLA 1HLDA 1KP2A 2W6JA 2WP0A 3O7WA 1OFUX 2RHOA 2IQ5A 4HD8A 3VVCA 3BMNB 3EUWA 4IIXA 2CMKA 1KVUA 4NBKA 4BX2A 3W5VA 2B35A 3AVOA 3AXTA 4CLEA 4CDMA 2IY8A 2BD0A 4AECA 5CDSA 2A30A 2OKCA 4XQCA 3TI7A 3VPAA 2PGJA 3X0DA 1M2OB 1JHYA 3KP1A 2F1HA 2OHHA 4R6WA 1RP1A 3UEOA 3FNBA 1B8PA 1RYZA 1YH3A 3CLSC 4PINA 2VJNA 1A9PA 4OK3A 4RC9A 4X91A 5EIFA 5IC5A 4CFSA 1Z6ZA 4O33A 5CNIA 4QARA 1P1CA 3O0TA 3PZRA 2H1SA 1UDWA 2ZWMA 1K92A 2QXYA 2ZT7A 1G5IA 3B1YA 3DAOA 1Z4NA 2KM1A 2JLUA 2KE5A 5CM2Z 3UWMA 1J5PA 3HL4A 3FTNA 3FHJA 1YHNA 5BWOA 3M4NA 4IJ6A 5I9LA 3EXIB 3RW9A 4QX6A 4I50B 1P0QA 3NFYA 5KYNA 4OU4A 2ZWVA 2AN4A 4ZAVA 3TW8B 2I9KA 1Y8AA 4I5GA 3GLFE 1JWLA 4TKVB 4F5WA 2A33A 4E1VA 1T0HB 5KWIA 3GRPA 4YXWD 3H19A 1J5EB 4E09A 1X86B 7ABPA 1E9FA 2GSDA 5FUBA 1PL6A 2XXBA 4KQ1A 4O2AA 1QGED 1L4UA 1G17A 3AJ8A 1N2CE 1Z8FA 4I19A 4LCBA 4YACA 1GCGA 4DADA 2OD2A 4DLLA 3UGJA 3DEAA 3T3EA 1NF9A 5H81A 1PX0A 5K8IA 4ZGGA 5HMLA 1NXXA 4Q1BA 2IYWA 1YONA 2ORWA 4DQLA 3DLAA 3DJFA 4A91A 5JNSA 1EHIA 4CIWA 5CW2A 1NL3A 2HT6A 3DLTA 4IIUA 4KW7A 4HP8A 3FPEA 3AJAA 3OA0A 3IH5A 3KM0A 4E51A 4HR7A 3O8CA 4AP6A 3LOPA 5AKJA 6ADHA 4AAYA 3DE6X 2AR7A 4PYNA 2O8FA 1T8PA 2XCSB 2ZU6A 1TQ4A 1FX0B 2ILVA 3I58A 3ST7A 3EMVA 1KE2A 1A9XB 4KXNA 5D3MA 2ECPA 1CUDA 4K5QA 2H8GA 1P18A 3HBFA 3QMPA 5K3DA 5G0SA 4C2AA 4BECA 1YRYE 5EMHA 3LLSA 3T7IA 2OBLA 3I23A 4OQDA 1CFJA 1C3OA 2WJIA 3CG0A 3GPIA 3I5AA 1GUBA 1JU4A 1L8LA 1R5BA 1XTTA 2IHTA 3SYNA 2C42A 4E7OA 1A7JA 1IHXA 3IKLA 2JAXA 1C0PA 1QO7A 2YS7A 4FYHA 4GEKA 4GP6A 4MYTA 4UNQA 5DDIP 2NU6B 4ER7A 4KO1S 5JS1A 3OECA 3PTLA 1U0HC 2BBOA 3I61A 2QW1A 5B4VA 1GO2A 3FMIA 3GUZA 3LKZA 3GGDA 4ZI5A 1OU4A 2PUFA 3L0IB 3OTQA 5I4IA 4FFPA 1UJ6A 5E6UA 4EHJA 4P3NA 2YHBA 2ZZMA 1TYAE 2GEFA 2VN8A 3GEHA 2W2TA 4K8OA 4CT0A 4MQFA 5B7GA 2YMQA 5K0NA 1SCKA 1TIPA 2EFYA 3IPLA 5TGDA 2IXTA 5FULA 3SXPA 3W7AA 4R81A 5DBEX 2VIIA 1O94C 2XE8A 3P0FA 1W44A 1P0IA 3NNNA 3OZRA 3QE0A 2OYCA 3T1VA 4FCCA 2D0IA 3UHFA 2BSAA 2PZEA 1G3RA 3PHHA 3QVJA 1JDBC 2XUAA 1L1QA 2X9LA 3H8VA 4S0XA 4E5YA 3K4PA 1N2JA 3GVXA 3V2GA 2F6RA 1EP1B 5DXJA 4KITB 2QENA 3QKRB 1V9SA 3LWBA 2OGUA 2EFGA 2X42A 3QYPA 3TTUA 8AT1A 5K05A 4RE5A 5KNLA 3ANNA 1CYDA 2VPTA 3I12A 4HWRA 1Q0RA 3A3KA 3B70A 4EG7A 1T9GR 3ENVA 4G56A 4OH1A 3C70A 1SELA 1XO1A 2OE2A 4R7GA 1BDHA 5LQUA 3LBYA 1OY1A 4BXOB 1HQDA 3ONNA 1UOEA 1DLJA 1VYUA 3R3XA 1L9XA 2AHOA 4G0NA 1AMNA 3CUYA 4CF5A 5IJ0A 3AF2A 4F60A 3ZH2A 1DBQA 1QDUA 3C5EA 4JP5A 1KSGA 2WF5A 3BQNB 2LCFA 621PA 3JQGA 4EYOA 3GJ5A 2WP8J 3C3KA 1BEEA 3OETA 4YJHA 3VDRA 4LDZA 4BB0A 1ZCZA 5JY1A 2ZJBA 2IBSA 2A9KA 1M33A 4WH0A 1I4DD 1WMDA 4WESB 1R0KA 2Z83A 1NJSA 3P52A 4GKBA 3RHFA 1E18A 3O0DA 4EB3A 5D00A 1EBUA 1RPAA 5B6PA 3ESAA 2I62A 3V1NA 4HTFB 4P5PA 2B4KA 1CJCA 1W2HA 2PLAA 1K9VF 4X1IB 5HEKA 2R66A 3QBDA 2EJUA 4I5DA 1GGEA 3ROXA 1BEUB 2PR7A 3RS4A 4RD0A 2CHFA 2PDAA 4UW9A 1EAMA 3HJUA 1TU0A 3FD8A 3IOMA 4TX1A 4F8JA 2DLCX 5KWVA 1GTVA 2HBZA 1GPBA 5FL7D 5FWYB 4BO8A 4CMEC 2QTMA 3ZHUA 4NU6A 3B3FA 4TOIA 4PRLA 1XZCA 4PR3A 3ICCA 4S1TA 3Q11A 4OA8A 2B7BA 4HQOA 1BWSA 4B2IA 2CVOA 5J4YA 3ADBA 2Y6VA 2F4NA 2FHSA 1REQA 2IODA 1TKAA 4MKZA 4A27A 2JGJA 1D0VA 1W36D 1NURA 1CETA 1UJMA 4NNJA 4QJIA 4YJKA 5IH7A 1EE9A 1TYCA 2J46A 2P6OA 4NOJA 4DSNA 4HXYA 3FHOA 1ULAA 4LZZA 1BJTA 2A5YB 2YVUA 1ZH2A 2V6MA 1BKSB 2R751 5FPQA 3ER9A 2P30A 2R1UA 4RLFA 4MVJI 4EQZA 4ZYYA 1CJUC 5T3UA 3EC1A 3REQB 2B8NA 2P2NA 3PL5A 2QIOA 1E69A 2IPMA 3QENA 1P2SA 4R8RA 5REQB 4Z1MA 3FOZA 4OHMA 4AF6A 3RE1A 1B76A 2XDWA 3CR3C 4K3UA 3WGMA 3ESYA 3AFIA 2LCQA 4FFBB 4LOKA 5KYVA 1JPVA 4V1CI 2IOQA 2V4ZA 3M5CA 4MA4A 4WCDA 1Z0FA 3EG9A 5C0OE 4ALMA 4EL0A 3U44A 2I6SA 3D8HA 2HCJB 3K6JA 2WE8A 2EV9A 4NPHA 2E5WA 2O2ZA 1YVDA 5FNVF 1NBME 4CEIA 3C2QA 1VMEA 1PN3A 2XYPA 4WBSA 3HVRA 2ZJ4A 4Z7NB 4HWPA 1DAIA 3VR4A 4YBZA 5AIAA 4DLTA 2IYNA 4X8LA 3H1FA 2YQ5A 1ORTA 4TQGA 1RT9A 1EFHA 3OQPA 1CE8A 3NGLA 4EHDA 3ZHRA 3D5QA 2Z8YM 1KRXA 1Q0ZA 2QB5A 1XJWA 3EGDA 2VFAA 3HVHA 3HB4X 4R2MA 4EB0A 2WIAA 3EISA 3FCSB 5EIOA 2PWZA 3CEPB 5C31A 1T15A 2ISQA 4XAQA 1EX1A 4L2IA 3UCEA 3DDCA 5J58A 2V3VA 3VKHA 1QX4A 1RS0A 2DTEA 2XYHA 3AJEA 1WCIB 5C1IA 2RHCA 4MGIR 1EVZA 4RV5A 4G4GA 4S1OA 3Q2KA 4N8SA 2H4XA 4DLSA 1P3Y1 4D0NA 5D5PA 3HUEA 5FPYA 2PU5A 2K6GA 3L46A 1NW5A 5IF3A 1G38A 2PRIA 2VAVA 1EQ2A 3FGNA 2CK3D 1Z28A 4L57A 3NBZC 1KL7A 1HDGO 2FW6A 1I3CA 1U7DA 1YZVA 3L4SO 1RC8A 1XNHA 4EA6A 4Z3OA 1TRHA 2PG3A 3A1EA 3PA8A 4R1QA 4RY0A 2IF2A 3TTYA 5AW6A 4B46A 1YQQA 1ZGBA 2O54A 3PVSA 4JC4A 5KNCD 1H23A 4ZVTA 2B7CA 2NT4A 3NDRA 1SY7A 1TYZA 1XEFA 2VWPA 2WKSA 3D3WA 3OC6A 4HGPA 1QBGA 1Z6AA 3I9V6 4MJ3A 4XSHA 1C0EA 3KC2A 4BO1A 4IVQA 4BQSA 4GXRA 4JY7A 4DR7B 3K5HA 3R5JA 3D4BA 3IXLA 2JCYA 3LBIA 3GPBA 4RMJA 4RESA 1PLLA 3VHRA 4BQRA 5HOQA 4C6HA 5SZHB 1FNBA 2ZIFA 3ED1A 1SHUX 3CVVA 3IIMA 1RLUA 3E9NA 2I1QA 2FMUA 3T7AA 4ED9A 1Q7EA 5IAOA 3PKZA 2ZPTX 4F5EA 3H2HA 4G0OA 4L74A 4YCCA 1UJBA 5AWFC 4M55A 3WLJA 3MJTA 2GKOA 2HSJA 3CLRD 4ITUA 5JMPA 3II6X 2PUGA 4QRDA 1A9SA 2OZEA 1ZM3A 3NIWA 1Y6FA 4L4RA 2XAAA 4NZYA 4R51A 4K9LA 3V8QA 3HKCA 2GN8A 3U4GA 4ACAA 1TDJA 5IJWA 1G2OA 5IFKA 3ZQ4A 5L4SA 3MTIA 1WIWA 2WY2D 1FXSA 1OBFO 1TOAA 1UC8A 3O8NA 3OOWA 3COJA 1DJQA 1Y1SA 1DFHA 2AFRA 3FI9A 4OL0A 2AOTA 2CLKB 2H5EA 4X5OA 2IHUA 5BR4A 3MGAA 2PO7A 2BMVA 3JQAB 1OTYA 3GCGA 3RAPR 4BN0A 3QF7A 4F6CA 5JZMA 1J56A 4I5FA 3AUUA 4HX9A 3IVGA 3OPXA 4H7IA 2W83A 4MA0A 4EGCB 1E9EA 4GDFA 2EWWA 1PO7A 3O8OA 3FMFA 3LF1A 4GD3Q 4IFEA 2VHJA 3O83A 3WL7A 4O2AB 1QCDA 4HZGA 4EPXA 3LT0A 1CS0B 3QNUA 1NVAA 5EZQA 4V0MA 2C84A 1DC5A 2GRAA 1A7KA 2VJYA 4CF4A 2W70A 5HKOA 1XNJA 2GAOA 1CJMA 2BGGA 1QLJA 3IP1A 5DIZA 1KJNA 1G3IA 2ZXFA 5TLSA 1IN1A 1ADBA 3IQZA 3M83A 4KR2A 4UEJA 1H66A 1YFKA 3MXTA 2G5GX 2X40A 3C0KA 4L8LA 3NTOA 2LIPA 4HH4A 3BFPA 1TVMA 5BUQA 1WCYA 2ZR9A 5K8UA 3LWZA 3SLGA 2ZXUA 2XB9A 4PCAA 2O8FB 3EA4A 4IRUB 4I9FA 4AQDA 3H4IA 4PLFA 4B3MB 3LPCA 3EGWA 5D3MB 3STTA 4KEAA 1XD9A 4MGZR 2HDNB 4LN1A 4U2FA 2G4VA 3CEMA 5KYYA 1NBEA 1N9ZA 2HJSA 2VJBA 1QH8B 1Z8NA 3Q8LA 3C8HA 1KJWA 2QD2A 4ZGWA 2GPBA 2IV3A 5IMBA 5EZ6B 3TEFA 2PGAA 4EY3A 4GC9A 1LSJA 2PZ8A 3DP9A 1ODJA 5LYJA 5EESA 4QUIA 4WXPA 3QXHA 4MZXA 2ZS8A 3KLPX 3PXEA 5ISMA 1U9IA 3NWBA 4P53A 3LT1A 4I9NA 2H16A 2ATIA 1FXUA 4P81A 2EDAA 2J0SA 1EJ2A 1PZEA 3E2IA 4BX9A 4UHJA 4NESA 2Y0PA 2XUGA 1LS1A 1Z0DA 3VPHA 3RJTA 4KO2S 2FPIA 2O20A 3PD0A 3I9FA 1DGQA 2A5GA 2NXJA 4M46A 2B2XA 5TF0A 2VQDA 1ZESA 4C30A 1W52X 5JPIA 4QIHA 4RIIA 3FYDA 1Z4KA 4M9UA 4Y2SA 5G2OA 4I3HA 3Q12A 3JR3A 2R8YA 3KSMA 1G16A 2FK8A 2ERYA 1JA9A 3C15C 4ZRDA 4BVKA 4G36A 3PA6A 3DZ8A 3QVLA 1J1ZA 5FLXA 2WSIA 1PS0A 4K0KB 2XCQA 4P33A 2GRJA 5CFQA 2HSEA 2XNDA 4HDAA 4JGIA 2H65A 4XQ0A 4DPKA 5CFNA 5JCZA 2WJAA 3IUMA 3G2JA 3ELYA 1XLWA 1YR9A 4Y67A 1AOXA 5T5QA 3TCNA 3WK6A 4BNMA 5I6DA 1W46A 3LNTA 3W90A 2JPDA 4NLLA 2YDXA 2PJDA 2I29A 4MGEA 1JFLA 4WAUA 3TLGA 2BGUA 4F9GA 4KXWA 1C2YA 5IJ0B 2VYCA 2WHRA 2CDNA 2XCLA 4Q18A 3MCVA 5IUKC 4Y1GA 5IC6A 3BOSA 1N0IA 4AY3A 4HG2A 4WY5A 1OB2A 3MTGA 3AUAA 1AQ6A 4DTIA 3TB4A 2GPSA 4UEOA 2X8LA 4YJHB 2BGTA 4HAWA 4EA7A 1M7GA 2QX7A 1L4KA 3LA8A 2JZCA 2BKLA 1MX9A 3KB8A 4Z86A 3ZGLA 2YIMA 4DMCA 5DO9A 5BR7A 4NCBA 5JUWA 1P6XA 1BH2A 5J1TB 4BFXA 1OREA 1ZD2P 1R6XA 3D7MA 5JJLA 4KFUA 1PE0A 4J7AA 3SWWA 3AO0B 4P2BA 5KYUA 3NO4A 4K9RA 2WU8A 2I6TA 2JLSA 4R4JA 4YT8A 1Z7EA 1UDCA 4LYEA 4UUQA 4YJGB 1CUUA 3KT0A 2VAMA 3QFTA 2GN0A 3L1JA 3UMMA 1XCMA 3U5TA 3D8RA 4AKHA 4J49A 3VR6H 3CLTD 2CFTA 2P4UA 1B8UA 2D0PB 2H06A 5CYOA 3ZVNA 3SDBA 1N5JA 1VKOA 4BX8A 4CMIA 5L8VA 2Z1MA 3V4RA 3LYLA 3OQVA 3WL6A 2ZQYA 1SA0B 3OE7A 3MUEA 1N4DA 4XYLA 2HRRA 3T7KA 1H1LA 3I5MA 3VC3A 3CUTA 1N25A 1VPVA 2KLHA 5CU7A 1MA3A 4FQ8A 1NW8A 4J2HA 3IEKA 3VTKA 4JXZA 3K53A 3PYMA 4PC1A 5CXSA 1XZMA 4ZVVA 3SHTA 1G1AA 4AICA 1ODTC 3NJ4A 3LXMA 1KMQA 1UR5A 2VQ6A 3PYXA 1JR3E 3OTGA 4ZU6X 3FRIA 5FUVA 2Y93A 3LS2A 3OY7A 4IDBA 3WGVA 3B1KA 4GI1A 3C3MA 4CIVA 2HK8A 1XAIA 3HRKA 2O0MA 3KFXA 2WHPA 2W6NA 4MHSA 3SFTA 3W77A 1A9RA 2F1JA 4XX1A 1R74A 1VPDA 2JIDA 2OSBA 3KZXA 5JDCC 5LWQA 4D9JA 5LN1A 5C7IO 4KIUA 1Z4IA 3IDOA 1VJGA 2YTZA 3ZY2A 1KO7A 5FUWA 3LWNA 1Y1KE 4W9MC 2CC2A 3O1IC 2AK2A 1G3MA 2O2DA 1EJBA 3Q10A 2ETVA 1IRXA 2IH4A 1UP4A 3C1TA 1QIJA 3D6AA 1W0JD 2G63A 2ZIEA 4K9DA 3FNEA 3ZWWA 4CEIB 4J1NA 1XPUA 2EARA 2M6RA 2R8EA 2ZT5A 1JGTA 1JQBA 5IDXA 1XX6A 4HZUB 5HQ3B 3I9OA 3NMUF 2WNIA 4UULA 4PC6A 1WD7A 5G02A 2FCAA 3ER8A 1H0KA 3LP8A 5BSWA 3GYGA 3QE4A 4TWJA 5AI8A 3CVYA 2JGAA 3UAXA 4C1BA 3W5DA 3QEMB 1NNSA 1E9AA 4H7FA 2HYIC 3V7WA 3JRWA 4GQBA 5DYWA 3F9RA 3RRJA 5HZKA 3MA0A 3BBLA 2H57A 1TMKA 4F93B 5E4FA 3NIDB 3VR3A 2Q9CA 3K0KA 5DLPA 5KTTA 3EGDB 2OQRA 3HN2A 4HXFB 1V48A 2HGSA 4PLTA 4Q7LA 5PNTA 3Q0TA 4J2TA 3K96A 2ZRGA 5I3ZA 3AG6A 4L07A 1T0IA 3L6CA 4I3GA 8ATCA 1XROA 1OH6A 4IICA 3IQWA 2COKA 4YEDA 4L2IB 2WSLA 3AF0A 5EC8A 4QSMA 2GLXA 3KTDA 1W93A 3K1YA 3B6EA 3AJRA 4RD6A 1K88A 5G3YA 3R0VA 1P44A 4IH1A 4NYMR 3GG9A 4JGBA 4D0GA 2YWHA 2Z3WA 2FETA 3DTVA 1WRBA 2A78A 2QR3A 4UPVA 5CX1A 3WQSB 2CXTA 3OLQA 3ILHA 3FVTA 4DM3A 2H85A 5DN9A 2GZMA 5LOVA 2GD6A 2UUCB 3AUJB 1SCUA 2Z5GA 3QPBA 4Q7EA 2PUBA 4CGZA 3MW8A 1VMDA 4KDEA 2HLDA 4YAEA 4S1WA 3BJRA 3H5IA 2HU7A 1P7YA 4JYMA 5INTA 4AXXA 1JVSA 4GVLA 3VDMA 4CF3A 4DMHA 5B3AA 5P8WA 5IT9A 1NATA 2XGSA 3NU1A 4ZCQA 4WERA 1XR3A 4DXDA 2IXDA 3W06A 2IHJA 3D3WB 5DX1A 2YWRA 1GTJ1 1QR6A 3PDJA 3MLBA 4YRBA 4NNOA 3R7AA 4X84A 2XNHA 4LF4B 3FFXA 4LZAA 4BWYA 1M67A 5ELXA 5LMCA 1U1FA 3JQQA 2Y05A 1M75A 1M72A 2AB0A 1T8RA 3T41A 1TFRA 5KNDD 2GZ2A 1JIXA 4TYMA 2VF7A 1D8AA 2ZPAA 3PR2B 3ZXUB 1H6BA 2W6ID 1YBMA 2V6JA 3VFDA 2NTJA 1SOMA 3H5OA 1QGYA 1WZCA 3L04A 3M6FA 1T8UA 1OE0A 3QMWA 1OHHA 3H4VA 4KMRA 3VR5H 4B7UA 1FJHA 5T41A 2C0QA 4JQZA 1E8NA 3CZQA 4JVOA 2CUZA 4R2KA 5C52B 2O5CA 1A5AB 2ETXA 2F9MA 3HDVA 3RCBA 4FKZA 1YR6A 5AVOA 5BW4A 2P6MA 2XCIA 1X9GA 2YUTA 1N1EA 1X77A 3JD0A 3A05A 3BMQA 3OFVA 4IYJA 3A32A 1H42A 3NORA 4KDRA 4IHQA 3UMVA 3C1UA 1DE0A 3AMVA 5I9TA 2OG2A 2A1UA 3QVTA 2JHFA 2AOTB 4NPAA 1R8XA 4OXRA 5DNEA 5FJIA 1KMIY 1F3LA 4UOZA 4FFVA 1PJ8A 2ORIA 5C37A 4JVMA 3E2PA 4V0SA 3K6SA 2XOKD 1KYYA 1TX4B 3B52X 2QQGA 4K6OA 1LTHR 4IWYA 4Y2JA 3HB7A 1GT91 4G67A 4OLHA 1U3TA 3ORHA 4PXAA 5L3RA 2AXNA 2EKDA 3MAGA 3JQPA 1OCEA 3UT5A 3O8OB 1ECCA 2A3NA 3G68A 1G42A 5A9SA 4P32A 3UMGA 4YRCA 3DMHA 4JSRA 4AWXA 1AS3A 4RQUA 4Y6SA 2NZXA 3L0YA 4PLHA 3T9CA 3EVGA 1CWUA 3D0QA 4LWPA 3ZIDA 3RASA 3EFEA 3KKNA 5CCBA 2BCEA 2GK7A 3R4VA 2IS6A 1BXKA 1T1EA 5THXA 2VOEA 4L8WB 5CCEA 4LYYA 5JAIA 3RS3A 4KTTE 1O5TA 1WQ1R 2GFQA 5ILOA 2P9YA 3EF0A 3FUWA 4J0GA 3DF9A 4ODIA 4RZUA 2FW7A 1QP7A 4W5JA 3ICOA 3QFSA 2HJVA 2YJZA 3W8DA 2C2ZA 4ZCRA 1CQJB 2VPPA 3D2CA 4EJ2A 4EZEA 2XUZA 1QE0A 1BMFD 2GPTA 2EJTA 5E0KB 3WYGA 1GZ5A 5FFMA 2QOEA 4Q16A 3KUXA 1LBQA 1OXXK 1HYGA 1YDMA 3SS9X 4NATA 1KNXA 3PDIA 2P5TB 5KYYB 5LMNB 5JFOA 5IBQA 2PL1A 5KVCA 1KK2A 1FDRA 3HJAA 3D8UA 4L85A 1YQUA 3OD1A 1ONNA 4Y9DA 5JC1A 1CHDA 1QJ4A 2IEGA 2O1EA 3A4TA 3N9IA 3OZUA 1XXHE 4DUGA 4WK6A 3DYBA 1KRWA 2Q0XA 1KEVA 2QUIA 4BP9A 1CJBA 1XZNA 4WNCA 2MSKA 4WSOA 5AK6A 4H16A 3D8TA 1W49A 1RJGA 3HPQA 4ND8A 3R1IA 3RKRA 3T8YA 3C97A 3IOYA 3KJIA 2YJ4A 4F12A 4YCLA 3T6KA 3RAGA 1JH9A 4LVCA 3ZS9A 1N6HA 2YICA 2EDCA 1PR9A 2G76A 4JUBA 2PRJA 3HNRA 4GWKA 2FPIB 3RFTA 4MTCA 2CNLA 1KIMA 4M9XA 3AB3A 3F3SA 1D9ZA 4NMXB 1BVUA 4WX2B 2HJWA 2EGUA 4Y6GB 4PYQA 3C8ZA 5DVZA 1OXMA 2Z9CA 1XJCA 2A0FA 3R3YA 2YR0A 4M1WA 5D85A 3VRHA 4TV8A 3AI1A 3FDZA 3KSUA 4MWSA 1JSZA 1FDOA 2UZAA 4LI3X 4YLYA 4MHTA 4MEJA 2PX5A 4LTDA 421PA 1UMDA 3TNLA 1EM8A 1T26A 4E03A 4B3DA 3L6DA 1PI3A 3IAM1 5F4ZA 2ZYTX 5DF1A 2NUTB 1K4YA 1JHUA 4WZBA 3DHYA 3QW2A 2HCBA 4AI6A 2FJUA 1W96A 1S8AA 4N5LA 3GWGA 2VH2A 3ORYA 1YU9A 1BIFA 3B12A 5KSPA 4N54A 2B2NA 4E3WA 2DFNA 4QPCA 1PP4A 3C3YA 3A06A 4G4JA 4L27A 5HJEA 2YXEA 2C3OA 2RHTA 4NZPA 1OTHA 5BPHA 1Z22A 2VNSA 3L5OA 2G77B 1J9GA 1T2NA 4NFYA 4RSRA 1O96A 1D9XA 3OLWA 2TS1A 2Z56A 1CY8A 3C1AA 5KSOA 3WS7A 3ZLBA 2E5LB 4FR0A 3PUVA 1OD6A 1D2NA 3EVTA 3I3OA 1LVUA 2NGRA 1W5BA 1DWQA 4GYYA 1R9MA 4GMDA 5GWXA 4ZEXA 4OQEA 3VOBA 3Q8WA 5H02A 3CLSD 1R0ZA 4RH1A 1R15A 2NZJA 4M0EA 4MLDA 4TUYA 4N1AA 4L15A 5IASA 3LC0A 2RJNA 4JBGA 4ZYZA 4KVZA 3HDJA 4FYYA 4LRYA 5TRTA 4LFAB 4L3WA 3LL7A 5KYUB 3DAPA 4Y9UA 5FYQA 3BXXA 4HAXA 3SEFA 5C53B 2CDAA 3FM9A 2EJWA 1B8NA 3GLFA 5G1OA 4KYVA 1QPBA 4M86A 4BMZA 1XLVA 2X9QA 2FUG6 5LYJF 4BQEA 3KQTA 3WLMA 4XWOA 1VHTA 5JQGB 4HLDA 1BVHA 3AEUA 3RVNA 5JZOA 1A95A 4JVLA 1N32B 1N2CA 5JHHB 1EA5A 3Q98A 1C3EA 1GZHB 2GYUA 3BMXA 2Q4OA 1H1LB 3CM0A 1TM4E 4MDFA 4X6YA 4CXMA 2D8MA 5DLQC 5E3JA 2WZQA 1L7DA 4R31A 3CLKA 4BFZA 2CNWA 2R6GA 4ZEMA 1R0WA 4ZO4A 5KOHA 5HTOA 2Q45A 1WPRA 2E0IA 1UEJA 3OFNA 1KYVA 5CDTA 4G8BA 4MP3A 2Q41A 1TQHA 5ALKA 2KHZA 5IK2A 1E20A 4WPGA 4CRWB 3QX3A 1A2QA 5AD1A 4J0KA 2WHPB 2BFFA 4I4CA 2F43A 1A8SA 5D7NA 4HGOA 2B4QA 2VKQA 4KB5A 1X7ZB 2P4QA 2ZXEA 2IA5A 2E87A 5DGTA 4DIDA 3P0RA 2B1GA 4F2GA 1JIJA 1QQ6A 1EK2A 2B5WA 3HVUA 5FOUA 3DBHA 5KDOA 1T9HA 3AVUA 1XCJA 2OGZA 5LZ7A 3LDGA 2WABA 3KB1A 2XMSA 3MFYA 1E4OA 3HFSA 5AKKA 1JG2A 1TUBA 2VI5A 1UFVA 2C92A 1P4RA 1DFGA 5BSRA 1VG1A 3G6WA 5IAGA 3DA8A 4BVLA 1QVAA 1NRIA 5EPUA 4FHGA 3QELB 4FN5A 4GOLD 4J9UE 4MW6A 1IWOA 3EXG2 3U3OA 2MDTA 3IRVA 3MPOA 4TL8A 2OG1A 1C80A 1JTVA 2OHFA 1HE1C 1MAHA 4M8SA 4NMLA 4TM7A 1IY0A 4PN7A 1OA0A 1N8TA 1YS7A 2JBAA 2QV0A 4RHCA 1J7JA 3WRYC 4YPOA 1RZRD 4JSYA 2IIBA 1N2SA 3SBXA 1VB3A 1LX6A 2OCXA 4ENSA 5JCOA 2WWXA 4AMZA 1K8ZB 2X5OA 2QAGC 3TLMA 4EEXA 1O94D 4B3GA 4DV6B 3HO1A 3IO5A 1Y5RA 2VF8A 4JD5A 4LKRA 4AO6A 1VFPA 3B6KA 1SXJD 3K8QA 4GDMA 2VS1A 1SU6A 2D06A 1X0XA 1JUDA 4KUHA 4D4IA 4HEA1 3JZIA 2GN6A 1M8KA 3HYNA 4NJEB 2VF5X 1U0SY 5EWMB 4CF7A 5IUNC 4X1OA 3N7TA 1LRJA 1YZFA 4JBWA 1OT3A 3LLMA 4WKBA 5CX1B 3H2KA 5LBUA 1VCHA 3RT9A 3LU1A 4M0DA 4AF7A 3SSOA 5LOVB 2NTVA 3D3EA 4KO8A 4FNGA 4PHHA 2J9XB 3WIUA 1ZM2A 2ZSIA 4HNAA 2FJ0A 1RQRA 3CYFA 1G63A 2OCYC 3IVAA 4KMOA 5A7HA 4ZICA 4OJKA 3D6NB 3NNDA 4XVHA 3JYQA 1GNQA 1JDJA 3LQ1A 3PS9A 5SYNA 2YQZA 3UJHA 3T3NA 2V6GA 3PTAA 2O7RA 3QF4B 4URVR 1QFJA 4KBFA 2ZEJA 4TTIA 4W5OA 4ZDJA 3A6FA 3AUFA 1RXEA 3NTLA 3NBFA 3OQJA 4XGIA 5ALMA 2GVDC 5AW2A 3E4DA 5A4AA 1V7CA 2N75A 3A04A 3B6IA 1QAMA 1YK0A 2APJA 1DAGA 1X7WA 4PZPA 2XSZD 3T95A 2RIRA 4R1NA 4PZAA 2IEDA 5HG0A 2Q3JA 5J5CA 3E7WA 2F7SA 2Q6LA 2R68A 4RJTA 5LP6F 5DH9A 1DCMA 1PZNA 4MOWA 2O1WA 3ETGA 1DT5A 4ZOBA 4NBLA 1ZJWA 4RKEA 2P77A 2Z8ZA 3KZMA 1JHRA 2BBSA 3EZGA 3UMCA 1PTJA 2FPLA 2ZRQA 3CCBA 1X7GA 1YIOA 2EFDB 5CDFE 3DZKA 2C5EA 3M6IA 2PSDA 3FKJA 3LRPA 2WV9A 4DXAA 5IKMA 1NPDA 4R2XA 2ZI4A 4YCSA 3HJCA 3L8YA 1BVRA 2A1UB 5E7QA 2QY9A 4CKBA 3SC2A 3T61A 4DWJA 4HC4A 2WYOA 3Q9NA 2DQ4A 1CBUA 1PEDA 2QRQA 2YV2A 2YHAA 4HAYA 3M82A 5H7XA 3WTCA 3PL1A 5F98A 5TQVA 3DMFA 3GZ4A 1I4OA 3WGLA 4JC8A 2H48A 4HNUA 1KYXA 1TA9A 1YS9A 3WE7A 2WKWA 3W7BA 3S4YA 1N9KA 2PX0A 3D4NA 1KI8A 5A9SB 2OQIA 1YV9A 1L4BA 2V7QD 4U9IS 1ENZA 2MOKA 2OXIA 3QVWA 4B34A 5H3LA 4D02A 3T5AA 4BMPB 1N1MA 1U2QA 5EERA 3ZXXA 2P7IA 9LDTA 1MEOA 1QNLA 5EJ2A 5B55A 5HKAA 3F96A 3GJRA 4QXQA 2DPGA 3EBOA 3NUGA 4URWR 5LOVF 1F4PA 2AX4A 1NBMA 2W8BB 3WR5A 1BWRA 1F7UA 1LLQA 4H0NA 4IKPA 3BXGA 2NSHA 1P1FA 1R6BX 1VHJA 2Q49A 2LXNA 1R3DA 1JIVA 5B36A 3O2NA 2A9FA 2OEPA 3RWOA 5CVJA 4QOIA 3G2PA 4EW2A 2AZDA 3ON5A 2A2ZA 1CZUA 4FFLA 2YX1A 3M4ZA 1XQWA 5I5EA 1CY1A 1JKIA 2QTWB 5ER6A 1G5FA 1MVLA 3PDIB 2BH2A 4KRFA 4Q4AA 2VL7A 1DZIA 1ZJYA 2GM5A 3TUJC 1OLOA 1XALA 4YMUA 5KUTA 1RYFA 3IBYA 1LJLA 3HCBA 2XD4A 4FFOA 4B0OA 4H1TA 1HOXA 1M6HA 3DPIA 3WGJA 5HZHA 2ROQA 1ACJA 4P0QB 2XAUA 1N78A 2O4CA 4Y6PA 4RGVA 4D4KA 3DWIA 2FP4B 4OXNA 2P0EA 4HYEA 2OXCA 4M3NA 3OMWA 4UU8A 5AKZA 1WABA 1W4BA 3HU5A 2HBYA 3L1HA 4OO3A 5THKA 4J0FA 5EGNA 3SQMA 1YCDA 1GZ7A 5JD4A 1PT5A 2EZUA 1XZ8A 4RPCA 2W00A 1R0XA 5A6SA 4XQGA 4A8TA 1LEHA 4QXRA 4F4JA 2ZYSA 2HRQA 1T9CA 3GOHA 1RXVA 2EZTA 1NUQA 3ILVA 3HDTA 2J0VA 4KN6A 3HA7A 4X7MA 3W4IA 4OHYA 1VYHA 1GAXA 1ZWLA 3GNLA 4IQGA 4TV8B 3FDZB 2JHGA 4YRPA 2PL3A 3MINA 3QVUA 3IP7A 3OIUA 3PE6A 4YAFA 5HWSA 5KQSA 3OIDA 2Q1WA 2ZETA 1XVAA 2QL9A 2GB4A 4U7GA 1UMDB 1G8MA 1I2BA 1KAMA 4YAWA 4BEJA 1NMSA 3L5KA 5ESDA 4N5DA 2WV7A 3EAFA 1LI5A 1LQUA 3AY7A 4ZQCB 1I5OA 1K5GA 1XLUA 3WDSA 2VRWA 5ECGC 3HKBB 3W5BA 3IEMA 1J0DA 3BTUA 1QK3A 3TR6A 3O84A 4CT5A 4XLLA 3IAAA 2V9PA 4PO3X 4IDNA 5G3ZA 3M3DA 4GX1A 5JD5A 1ID8A 1X2BA 5CA1A 1JHVA 4RE6A 2GN2A 3THRA 4S0ZA 1T2DA 1UL1X 2ZP1A 4PW0A 3RRZA 5BN4A 4Q3AA 1MXHA 1Z56C 1V7PC 4JK3A 5IVDA 2NG1A 2REBA 1KU0A 1O96B 1WL8A 5FLYA 1NOIA 3PEEA 4FGUA 4GI5A 2ZK7A 2ISCA 2I99A 2IHZA 4QGBA 4HQFA 5IKXA 1L4NA 1V47A 3QVSA 2DY0A 1HR0B 1MIHA 1HUQA 2AQIA 1HDXA 2IOHA 4MO2A 1YS4A 2AZ4A 3UF0A 3ZOZA 2C4UA 4RS4A 1FYDA 2Q6OA 1SD1A 3OKCA 3PDCA 4URUR 4AJJA 4I1PA 1R88A 2AF4C 2R65A 1HL3A 3EW9A 4TUYB 2IU4A 4EUKA 1FXWA 5J2UA 5ELLA 5I9SA 5JEEA 2CMFA 4JIMA 4BMYA 1G0OA 2HOQA 4O0MA 4U6NA 1IAQA 4FUQA 3M6AA 1KZ7B 1Q3HA 5DNVA 5CFRA 2NLOA 4IPTA 4TVBA 3JVUA 2CV2A 1WV1A 2VEDA 3HHPA 3GLFB 2ZT8A 4P4TA 2PJZA 4KN5A 4OK5A 3EH1A 5IYZF 2YVLA 2ZRCA 4MWTA 3UWKA 4DBLC 3NYWA 5JNRA 3K5WA 3BGSA 1OXKB 3O4JA 1A7UA 1KMNA 3RC3A 5B7PA 1W47A 2OHIA 3AV0B 1OKKA 4MUGA 3AEUB 1G19A 4J3FA 1E77A 1NDUA 1VGQA 5T6BA 3IPRA 4L4XA 3BCUA 1R50A 3P9SA 4K28A 2JASA 3AY0A 1JAXA 1L5FA 3EQ7A 1YC2A 2GJ9A 2X8AA 3B6ZA 5EJEA 3PV0A 1NBWB 3KXKA 3QWAA 3RVJA 3ZDZB 1N8NA 3A58B 1SUFA 4PLWA 3DV0A 2IYRA 1SG6A 3ZX5A 1RQXA 5CVEA 5FOXA 2R79A 1TC2A 3TOXA 4RCZA 4TYNA 3ODGA 5C4GB 5JRDS 2AEMA 3EN0A 4DLKA 4UAGA 2YINC 5AJVB 2MHCA 2PXXA 5FBRB 5EYPA 4AD8A 2H00A 4XIFA 4YMTA 2Q46A 1EGAA 1UWCA 4HB4A 3JWIA 3WNDA 2GBCA 2NUBA 2BFFB 5DASA 2WKPA 3CCFA 2F43B 4BX0A 3T4EA 1AHHA 1K98A 3PSAA 4WBNB 2JH9A 2JFXA 2I76A 3MWJA 4O02B 4OF4A 3LW8A 4OUKX 1XDZA 2C88A 3ZDFA 4NE2A 4Q48A 4CCWA 1YBHA 3QH4A 3AM3A 4DLUA 2VJOA 3DM5A 3IUBA 1QVRA 3N5KA 2WU4A 4B09A 5EIXA 3BMCB 3RK1A 3LLCA 4D4HA 2EX4A 2CFIA 4O1MA 4QOEA 1Z5WA 4MV0A 4HJXA 3BXOA 4V0RA 2D6FA 2JB9A 4W63A 2FPWA 5KJ1A 1LPMA 1X1RA 3K32A 3BSFA 3OZXA 4ML3A 3RANA 1R8YA 2XOEA 3IVMA 4TKMA 4BU1A 3LQ2A 3R8CA 1OXVA 3P1JA 4Q24A 3R3WA 2JBAB 1O7JA 4FSDA 4QYIA 1EWRA 1WUHS 2X8JA 2OXTA 1D0IA 3RVOA 2ZRIA 1I94B 2F8TA 4DYVA 4TUYF 4ZP1A 2C2BA 3QTLA 1JIKA 3RQIA 3H9QA 3T7TA 3AWIA 1SOAA 2RMKA 3V8EA 3P0IA 2ZUCA 4YRQA 3PWSA 5M7EA 3GJ8A 4LOAA 5L95A 1RAIA 3BYZA 2QI9C 3EMBA 4B8WA 1ULTA 3P9PA 2HMYB 1Z0UA 2QM0A 5DNYB 4B4VA 4R1OA 3A37A 1VLJA 4BE7B 5LQSA 5KHAA 2PMEA 4XTCS 3ZH9B 4CN9A 2B30A 2QU7A 2NXCA 1U98A 5LZ9A 1PGJA 3K70D 4ENVA 5ADWA 1UPBA 3IT0A 2B20A 5AVUA 1BXGB 5CTAA 1Z2PX 2D5AA 2XE6A 2BI7A 1DTWA 2HO5A 2QZPA 4HNAB 5CYFA 1UEXC 4OKNA 3GRUA 5BSTA 2LV8A 4X1KB 3MC1A 5C5DA 1AKNA 2GUWA 4G9GA 4K05A 1C9YA 4K7JA 4RH0A 5FJJA 4ZKDA 3GFBA 4QOSA 3QI7A 3BB4A 5DNUA 4BFWA 3MYYA 1A76A 4IO0A 4KLNA 1VXRA 6AT1A 5CK5A 1V8OA 1Q1QA 1MAWA 2PJRA 1P61B 2AGVA 3QFRA 3R7SA 4BZQA 1MABA 4HGYA 1PQUA 2DBQA 2VYNA 1EG7A 3A9RA 3NH9A 2RSLA 3D4PA 9ATCA 1JQJC 5A9RA 3W9SA 5KTMA 1GPMA 4JUFA 1FDUA 1NXSA 2FN3A 4J3JA 5DW3A 4BFCA 1AN0A 2EQAA 3GY0A 5DGHA 2VQFB 2EGGA 1X7WB 3KYJB 3PFBA 4FYXA 5K2OA 2VNIA 3RWMB 4ER0A 3IEIA 2OO5A 2G70A 1XF1A 2H1VA 4QDJA 1WSWA 1OIXA 2JFZA 4Y18A 1TCUA 1XF9A 3UJDA 3ZD7A 1U0EA 2G07A 3FCXA 4IFIA 4CIBA 1Y7HA 2NYAA 2DQSA 1CR4A 1L7QA 1M0TA 4OM7A 5GV8A 2KMLA 2N9UA 1NG1A 1PZHA 3M6VA 3CUVA 1T3LA 4P7JA 4WFIA 4REMA 4N0DA 4AMGA 1CT9A 4CNQA 1ENYA 2XDYA 3N2NA 3Q88A 2XY4A 3DKKA 3N6RA 1UFOA 3QU4A 4IFTA 5GQSA 2I4RA 1HFWA 4UOEA 4J4BA 3H6KA 3WDKA 1L8XA 3LHFA 4QU5A 1MP0A 1LSUA 2BTQA 4WQMA 2HM7A 3IRUA 4TT3A 5CBKA 3FW1A 3PQFA 4S2UA 5HUJA 3RRMA 1SEPA 4TYYA 3ZCUA 5IAJA 4FDAA 2WICA 5M2QA 5KEIA 2AKEA 3AL3A 5JCXA 1YD7A 3NM6B 2G7MC 3A0RB 4BKMA 2NZ8A 3SR0A 4L8GA 2HADA 2CB0A 4R5HA 5K09A 4MYRA 1QF7A 4OKIA 4OQNA 2AFIE 4ALIA 3KR2A 3P2OA 5LQDA 2C3PA 2OXFA 2C5SA 4EW3A 3E61A 4OI4A 2VBCA 2C0PA 3AFNA 1TM5E 3AEKA 2HMTA 2RC5A 1WXDA 2MR5A 3KXIA 3AWDA 1U9IC 5A3RA 3FOEC 1JR4A 2P91A 3K09A 3DO6A 2XMZA 2B94A 1OAKA 4PGHA 3VPFA 4KR9A 5F77A 3GNSA 4BTEA 1IN4A 3FA2A 4IV5A 1XRJA 2P9GA 4HDKA 5EFZA 5KTSA 3GH3A 5MF6A 2OLEA 3Q6MA 3WK5A 3C6KA 2OHXA 2YXDA 4DCCA 3NHLA 1TZMA 2BP7B 2V6BA 4Z4QA 1GPJA 3WI7A 2QYSA 2CVFA 4F7WA 1UKAA 2W58A 1NW9B 4NYMQ 4B7AA 1VXOA 1XB2A 4FDUA 3E05A 2A9PA 3S0JA 5ALVA 3KTOA 5I9IA 2XQIA 4YP1A 1ZJJA 1C7QA 4GWGA 4TMYA 3T1HB 3KETA 1E1RA 1QH0A 5U9CA 1QXSA 2VRCA 4XD7D 4ZT5A 1G4HA 2FUEA 5TXGA 1DKUA 2CLDX 2IEIA 4K6GA 2AN5A 1WU7A 2XB8A 2XEXA 4C05A 3BGIA 4Q4AB 4C7OA 3TTTA 1V0JA 2VC2B 3UWSA 3B48A 1ADYA 4LNHA 5JCJD 4Y6LA 3EUEA 1NV8A 3OJCA 2B78A 2WJZB 5ALNA 5ERYA 3T3HA 5C5IA 3I62A 2CJYA 1KOFA 1UBCA 1NLFA 1SHJA 2WSSD 3WJ2A 1WBBA 3OM9A 3WXMA 4I4TA 2CLHB 4MX8A 3DFFA 2FWPA 2ZSFA 4NC9A 2ZE7A 3H9JA 3TW4A 1QNFA 3EX7C 1M0EA 3NM4A 3KPYA 1CR6A 1IBRA 1LU9A 1Y5MA 3RDPA 4E5NA 2QL5A 5IDWA 3HR7A 1E89A 4PLZA 2C29D 2PZLA 3SFVA 1JXOA 1SC3A 1Y7PA 2VBGA 3VR6A 4CNBA 4DWOA 2WJVA 1HT0A 2VUHB 1L0BA 5E6RB 2EZ8A 2YN0A 2WG2A 1E0JA 3WLLA 4KE7A 7REQA 4N7JA 2OZKA 3TJMA 5KHLB 2PUCA 4MEBA 4JQCA 4PAGA 1D2MA 3MINB 1JXAA 4OA5A 3AGQA 4Q1VA 4RPKA 1JP7A 3WGZA 3ZU2A 2WWFA 4BBJA 2X76A 2JJ1D 2DWOA 1U5BB 1X8XA 2RI0A 3BPSA 1F3OA 2I54A 3H75A 3MGKA 1ZM4A 3DE2X 5EG5A 3MTBA 3COPA 3SI7A 2ZYIA 2UU9B 4KU4A 2IS2A 5IBCA 1B2RA 2IVZA 2NUPA 2VSQA 2FUKA 1IN6A 1I2AA 1U2ZA 5DM60 3Q9UA 4BP8A 4YB8A 3NDPA 4YUWA 5IBRA 3EZNA 5ITZA 1Y1PA 3IQXA 1CTQA 2XVMA 4WXYB 3BZUA 1Q16A 4QVIA 2JAHA 3UQZA 3R5SA 5E7JA 1RI4A 2C1XA 2PO5A 4BN4A 3E7PA 3IAEA 1ZCFA 2J8ZA 4UDYX 1PZFA 3TW6A 2Q3DA 2GR9A 5AJYA 2IBMA 5HDBB 4ZVSA 3HBJA 1N2HA 2PUDA 1W6RA 5AHXA 2H1OA 4MUEA 1L8AA 1XVUA 2QNBA 4I55B 4URZR 1FYXA 5LDDC 2P35A 1U6JA 4M7PA 5J2UB 3HY6A 1CVIA 2OFXA 2PN1A 5AM5A 4ZU3A 1TTPB 3WJ7A 4HN2A 2XKAA 4X66B 4DDUA 4AG5A 1PS8A 3A9TA 4MO9A 4ADSG 2IXFA 3JD2A 4IQFA 4ZVKA 1RM0A 1U94A 4JROA 5FBVB 3OIWA 2GTIA 3QTBA 4C4PA 3OKPA 2XCRB 1D4OA 3SX2A 1AQJA 4W6QA 1T1SA 1H4SA 4IBOA 1P2DA 1UOQA 3FPSA 2CUNA 2W22A 1ZH4A 2HXYA 3WMEA 3GDWA 3GT0A 3G6KA 4WOPA 1WMBA 4XCXA 1XFDA 2H1FA 4DDHA 1YJXA 1ZIXA 1U0NA 2J3DA 2Z57A 4LY0A 4W1PA 5GM2A 1NFQA 1G8GA 3G8YA 4EVQA 5GOZA 4ZXFA 3UT6A 3X2SA 2TMDA 2AZMA 3TFOA 1HYQA 1WG8A 2HXSA 1PJSA 3OD5A 4EI8A 1QHHA 2C4HA 4REQA 3HM9A 4QQRA 1D03A 1RQPA 1R0CA 1YI8A 4GGOA 1DWOA 2HPHA 5EYPB 3UJ6A 3S2FA 2FLKA 1X3SA 1QVWA 2P68A 1XQ6A 1RSZA 2QRGA 3L43A 3PNLA 1N3BA 1U7ZA 3AOGA 3LXRA 1H0RA 4DSTA 4WK0B 1R6TA 2PGIA 2ZJ8A 4F5ZA 5IWAB 4L6AA 1N0HA 3LTNC 1MN6A 5K0LA 2BFPA 1VECA 5FTWA 4CBVA 3FVRA 4QC2A 5HF9A 2O05A 5LQCA 3GC6A 1BC5A 3PVCA 4D9KA 3W2TA 4EUEA 1OLUA 2EZ9A 3AG5A 3IBFA 5TMEA 1ABBA 4RYLA 4QULA 4RF3A 5F9HA 3NCTA 1VC2A 1GQRA 1RYDA 2BZSA 1C8LA 1PFQA 1K63A 2HQ1A 2PCLA 1R5OA 3G0GA 1XXHA 1Y3HA 2DVMA 4FT2A 4BV9A 4JYAB 4BEBA 4NULA 2YY7A 5C32A 5EHZA 1L7AA 1UDRA 1JE0A 1ZEMA 2J7KA 4UFNA 5AM4A 5HKBA 3SZLA 2VXOA 3P9KA 3KWMA 1PK9A 3GW8A 3ZY4A 2ZBDA 2PAFA 2O3UA 3NUQA 3KDPA 5A62A 2BI8A 4CM1A 1USVA 1ZD8A 3PTZA 4WXRA 3V8VA 3VR5A 4XR4A 3DD1A 3H2GA 2QVCA 1A2BA 1UWKA 4J0QA 2XBLA 1LNZA 3B1FA 3L0PA 2X8JB 3KVNA 5FUXA 1VSUA 1RWKA 3UCXA 3FLEA 1FXWF 4A03A 2JF0A 4WZAA 4ZJUA 2FCRA 1CUSA 3ND9A 3PUJA 5IJ9A 3K5IA 3TZBA 1MBZA 2AD1A 3IB3A 5D3KA 3TVTA 4OAOA 4C4AA 4GKAA 4WJZA 5ALSA 2BFWA 3IEPA 5EQTA 4BB6A 3KVYA 2H4HA 4KE9A 3F73A 3ADPA 4KQWA 2C7VA 3QV1A 2B61A 4YFVA 2IS1A 4OX9Y 1JHZA 1NVEA 4JASB 3EMKA 2V6FA 3CF4A 3ZE8A 5TPZD 4EITA 3K1ZA 2HK9A 1SVMA 2ZSUA 1RYHA 2ZULA 3OIVA 4P82A 1V9LA 5IT4A 1JR6A 2VDWA 2BSQA 3CT4A 4YCDA 5I7HA 3L7AA 2GESA 2ZTLA 1DTWB 3NHAA 4UUMA 2YZNA 3DV9A 4O8CA 2HFKA 1ZNWA 1AK1A 1XV5A 3H5RA 4YALA 1SXPA 1F9EA 1RYEA 3GGGA 3UUEA 1K9SA 3B7WA 3EVDA 3UANA 1UBUS 1BTOA 3HVIA 4CV2A 2BM9A 3AR8A 4FZRA 4A6XA 2QR5A 4ZHQA 1CEEA 1DC3A 4HRAA 1MT0A 1OWMA 3ND5A 3Q5GA 1AF7A 4O4IA 5AXDA 1KKMA 5AVQA 4YY3B 5HM8A 2R7NA 4E2XA 1JMYA 2IWHA 4CL0A 1MABB 4Q7QA 2ZUDA 4H27A 4DIFA 5K0TA 5KKCA 2HV9A 2XUJA 2GM3A 4NONA 2E7ZA 2V7VA 5KAMA 4HVLA 1GV0A 1VJCA 1EE2A 2QHXA 5C7LO 1NDQA 4BY9E 3H4TA 4UBLA 4DLXA 1CY7A 4D8VA 4JYPA 2YWCA 3FHLA 1MJGA 5BSVA 4HDOB 1W9HA 3RYIA 2R2AA 2DJIA 1EKXA 5HA5A 4C3VA 3DVSX 4DQKA 5CVDA 3ZI4A 4BTLA 3M2PA 4ZALA 4RHUA 4HVCA 5KZMB 4BEWA 1QU3A 3TOZA 3RHZA 1P9RA 1DBPA 1AB5A 3OUTA 3P4UA 1P0MA 2J0QA 3DR3A 5A1TA 4WOKA 4N6OA 1DJMA 1H94A 3FLMA 4KAXA 4F06A 2ID9A 1AS0A 1FRNA 3PXXA 1KF0A 4IDPA 3AJ9A 3G0HA 1M2HA 3HVKA 2OB2A 3URMA 4EF4A 2RDMA 2BKAA 3O8BA 1M2KA 4DDVA 5JIBA 3E3NA 3IP3A 4G86A 4JLNA 3OT4A 2V0NA 4AUKA 1SUWA 5CIWA 2UVQA 3FJYA 1DAHA 1QANA 4CE6A 2YRFA 2OCIA 5B37A 3R6TA 2WTUA 4ZC8A 4Y9TA 1N57A 4CM6A 4D9NA 1XMOB 1DO2A 1O8CA 1ZGGA 4OQPA 1VLMA 3ZK7A 1XCBA 3AEKB 3GUUA 4CQMA 3LBAA 4ZJZA 2OV4A 4O3MA 3G8BA 4QDTA 2UAGA 4JVNA 5TDHA 3LY7A 1P8JA 4EA8A 3CZ9A 4HDKB 4JLUA 5ANRB 2X19A 2VHTA 2H7CA 1TEZA 2VUSA 3HS3A 4JU8A 4TWIA 1EWYA 1MUUA 3DBVO 4WVLA 2IYQA 1GILA 1V16B 2Z08A 4WKGA 3ELWA 4C43A 1CLEA 2P1ZA 5LP1A 1YMQA 4NY1A 2RGEA 4XQEA 5DGXA 5DNDA 3G2IA 4BQPA 1DEAA 2LP4Y 2GMWA 2FSPA 2RHDA 4TQ9A 1KZYC 2HA4A 2BCJQ 2XNSA 2CN1A 2ZUWA 1PAUA 2OUKA 5BMOA 2Q5OA 1KXZA 2FE1A 1CY2A 1ORRA 1R00A 2NO4A 3L1KA 3LQRA 3NHZA 4QPPA 4C7OB 2HJ9A 1IPEA 4JBYA 1T24A 2BPOA 3CVOA 1KC1A 1SQSA 3N2GA 3BMOA 4P93A 3SR3A 4BDSA 5BQ3A 1YRBA 5EKTA 1R9GA 3MFQA 3IUYA 2NU9A 4DCJA 1YQTA 1X13A 3LXXA 3ACDA 3MYRA 2Q99A 2E2WA 1JEJA 4I4TB 1P5JA 2E18A 4RTJA 1CU1A 1EFPA 4ZOCA 3KWLA 4HDNA 1P72A 1I4WA 4WWHA 1OGYA 1VA5A 5CXQA 1ZY2A 3NBKA 5A0TA 2R7LA 4UNPA 3O8RA 4LIPD 2AE2A 2WPNA 3BEDA 1CP3A 2Z9BA 5DNWA 3QEBZ 3SQOA 2FPMA 4KVFA 5YASA 1E64A 1W5TA 3LY9A 5C1OA 3T9BA 3MM4A 4CKEA 3G5AA 1M2VA 7REQB 4ZCIA 1J1UA 1S9HA 2JARA 4C78A 4ZYUA 1VSQA 3QEJA 3QU9A 1V8FA 2DPXA 2YIJA 4B4UA 3J7AC 1FFWA 5BMVB 1DKPA 1XRQA 1K7YA 2OBNA 3L8CA 4ENRA 1RXUA 3OPVA 3STHA 3DPSA 3Q7EA 4EPYA 3GLHE 3QHQA 1S5PA 2HAEA 5T4FA 4NJMB 3W1EA 2YFHA 3JU3A 1CQZA 3BXZA 2J3LA 4KL8S 3PQ5A 3RG2A 4IJVA 5K6TA 1GRQA 2NYRA 3JQAD 4Y1FA 1E2NA 2NZUG 2XDQA 3UVEA 4J1SA 1Z8HA 2JI4A 2NUPB 2XTMA 2XRYA 2G4LA 4HPWA 5TJHA 4WDQA 1GKIA 3WAGA 4N48A 3X1JA 4RF5A 4ILKA 3F7OA 1IQUA 1FLAA 1GWNA 2PSFA 3ME5A 4HXGA 5CLIA 5I8ZA 4P3PA 3CH6A 3THOA 2ZVPX 4BASA 2A9VA 1YHZA 3RU3A 3EZ2A 4BU0A 3H9CA 3OT1A 1MF7A 4J16A 2NQ8A 4JC0A 4ENTA 1YASA 4RK5A 1SH7A 1DBVO 1MV8A 3WNBA 2I87A 2P65A 3MUNA 4ZCSA 4XVCA 3CURA 2KQUA 3RTEA 4A0QA 5AUPB 2PD4A 4QPDA 4YN3A 1OX4B 3DOEA 2PIAA 2PZBA 3QKIA 1LC3A 4RA6A 3P5SA 5EQFA 5CDFA 1XPOA 1KY3A 4IIJB 2V8BA 4JOQA 3H2IA 1GT6A 4OQ4A 1BX3A 3ZC3A 4HNTA 1I6WA 3B82A 5AVXA 1X80A 1QF9A 5BR1A 1KY4A 4EG5A 1JJ7A 4FINA 3NRCA 2I34A 4V03A 1CY6A 4IXDA 4LHZA 4QU0A 4FKMA 1NXVA 1PL8A 1R6VA 4IDDA 3OUZA 1INLA 1JLSA 1N3IA 1NXOA 4H17A 5GADl 3HV2A 1ZRHA 4P7KA 3DMGA 4FFSA 1KR2A 3FNRA 4YRFA 1ZK1A 4I4TF 4UEKA 3VYUB 3U49A 3WQQA 1PVDA 2DKFA 3IR7A 3TIXB 1Z5NA 2I67A 2XODA 3MOIA 2Z3VA 2HKIA 2QGFA 2W8ZA 3EPKA 1V5FA 1UP7A 2NO5A 3E70C 4DS3A 4QXPA 1AK2A 1FSFA 1QTIA 2CB9A 2C9OA 2CFCA 2DT5A 4GH5A 4IUCS 1L5LA 1AUVA 1Z4OA 3EGEA 4H7HA 1ITZA 2IDJA 5I5GA 2B1QA 4R9VA 3WO0A 4FEGA 1FJGB 4REQB 2ABWA 1PJBA 3FWPA 3JTMA 3ZW9A 5JCOC 4BMNA 1T1RA 1OILA 2OO3A 1JHAA 4G01B 1FQJA 5BRAA 2C1ZA 2Z6QA 1TVKA 2EWMA 3T7EA 2LCIA 5HIIA 2NU8B 3VVMA 1OOEA 2C7QA 1BAPA 2C04A 4PAWA 5TR9A 5A71A 1GTMA 3TH5A 2DPYA 1Q0SA 3TZCA 4HQ6A 1MH9A 2O2CA 3IIEA 2PLWA 3O4RA 4JI0B 2VNKA 3H2SA 1SURA 3KLNA 1OLUB 5HF6A 3FYTA 2XGOA 2E4YA 3M5DA 5JXWA 1JQLB 4NCIA 1QO0A 2AG5A 1CG6A 1E6CA 1VJTA 3Q3VA 4HQKA 3B38A 4Q9DA 3GA0A 5B64A 2I2XB 5A5FA 1RZUA 4HEQA 1JMVA 1Y1TA 5LR6A 2F2TA 1PYGA 3I53A 4X62B 1LKZA 4G2NA 4MMYB 2P40A 5AKGA 4ND3A 4UZSA 4UJ3A 5EXTA 1DWUA 1D5WA 1ODLA 3F6EX 2VXBA 3MMNA 2NTYC 4XJTA 3OEEA 3U1BA 3SQXA 4TWAA 4Y6RA 3KJEA 4BS9A 3UK6A 2ZI3A 4TSFA 3EGOA 5E9AA 4R1MA 3W5AA 1WF3A 1MJHA 4IH9A 3HKEB 3RLIA 4I14A 3EYAA 5B6JA 1OWPA 3H5TA 3DB1A 1SBNE 1B16A 1YZHA 3B51X 2PZJA 1RRGA 1BS1A 3RI3A 4E33A 2D5CA 1NV9A 1TU4A 3VDNB 4WZAB 4IWXA 3PJDA 5K8JB 3NKVA 5IJ9B 2GM4A 4GKVA 1I14A 2Y9PB 1JG4A 3OE1A 2WIKA 4LJ4A 2X1HA 1O5IA 4BBZA 5A3JA 4RZ3A 1UDBA 1F8XA 3K2BA 5FLKA 2P0AA 3FZYA 3PEWA 4L95C 5LZ8A 1B15A 3SU8A 1BRTA 4KAJA 4MSUA 1NBHA 2YNMC 4YMIA 4L08A 1TJPB 1A50B 1YMVA 2K2WA 4OVKA 3TCKA 4ZCMA 2IU3A 5DHSA 1K6JA 3T0IA 5IEBA 5CEFA 3ZHQA 4IS3A 4DV5B 1E0KA 5DIFA 2P9TA 1PQYA 3ETCA 4KFRA 3Q9SA 1PTJC 2VDWB 3SMVA 4D5EA 4NEGA 1F4VA 2XTJA 5HR5A 4B73A 2C03A 1G6OA 3VPXA 1DDGA 3ANMA 4FWIB 4I5IA 1QQ5A 1G8AA 2EBFX 2WFLB 3G0DA 1KMCA 3L6EA 3LKVA 2UKDA 2WR8A 3OIFA 2FN4A 1PS9A 2VYQA 4PS0A 4G37A 5FHQA 4CMAA 2XWQA 2HFJA 3U80A 5FDFA 1KIFA 2RB4A 4H9GA 1H2EA 1NJFA 4IQ4A 2B98A 4S12A 4BO3A 4ZHQB 2HIGA 2O2IA 2VYVD 2FSVC 2R84A 3I0ZA 4O4IB 5KTRA 3JWGA 1HLFA 4WRRA 1XEAA 1EQUA 3C43A 3M1YA 3HFRA 3WQBA 4O2LA 4O5OA 2ZBUA 3KZVA 4JJGA 2BMFA 5C1BA 2IC5A 2LR0A 2ZR7A 2HMVA 4IIVA 4ZTBA 1DJLA 4CEHA 3BILA 4QNMA 3TNJA 3LT4A 3D31A 1K6IA 2YMMA 3RYIB 2VDMB 1TUGA 4HDRB 3KU4A 1SOVA 2NYVA 6GPBA 1GGFA 1DRWA 1GNTA 3I04A 4IIBA 1C9DB 2IELA 4ZVNA 1SCBA 4HYTA 2Q7DA 2JFQA 1S96A 4QM7A 3P97A 4BRUA 2AMLA 1C7RA 2FSHA 1QCZA 1GKYA 2DFKB 2E48A 2VDOB 4H3KB 2FGJA 1VMKA 2ZR0A 1PEKE 2BM0A 3VR4D 3U1TA 4MVJD 1O5OA 4KWHA 3UA4A 2QN1A 1GA4A 4MS1A 2FMKA 2CZCA 2GN4A 4QG3A 4XM0A 5FA6A 3K9FC 3TRHA 5GIPE 1NYTA 3ZHOA 1Z07A 3AV3A 5GP1A 4IM7A 1IJEA 2R5NA 1JDTA 3L7KA 4JBLA 2NP6A 3SC2B 1KO4A 3DGFC 1D2RA 1Y6ZA 3G2OA 4Q9KA 3RV4A 4EOGA 4P0PB 1PV4A 3AKZA 4LJ9A 1OGJA 2OV6A 3TQRA 2XIJA 4EHKA 2PUTA 2O5RA 3B89A 3BTSA 2RHLA 5C8YA 2EF0A 2SKCA 5E3IA 3NTVA 3NOVA 4CTMA 3GZJA 3CG4A 2C98A 5IKOA 3OJ0A 4QATA 4P4GA 4QWMA 3UOAB 5KKAA 4Q1DA 1EIZA 4F86A 3UATA 5HIAA 4HT3B 2IXGA 1HLPA 4Z8YA 5CG2A 3MRXA 3BIXA 4R0NA 2R3SA 4MR8A 1II8A 2ZAMA 3I9NA 4QUAA 2ZJ3A 2BR4A 1XYGA 2FW1A 5F76A 4B6QA 1VRCA 4CIDA 1J90A 2Z2KA 3QVMA 1TO6A 3UV7A 4LSMA 5EIBC 2H6EA 5E7MA 4EY8A 3FETA 2QX9A 2WM9B 5CDYA 4ZHQF 1E6UA 2OYRA 3AT1A 4W7HA 2YS6A 4XJVA 3VU9A 1G8FA 5F1OA 3OTWA 4O4IF 5JZ9A 1SXGA 1PJRA 3HI4A 4EEKA 2WYVA 1Z73A 3CR8A 1RQNA 2QTVA 5K6AA 3IBCA 5C7YA 3C3JA 2XTZA 2EHJA 1N9GA 3N2GB 5AJZA 1PBNA 4Y8VA 1D6MA 3PEUA 4HAUA 4KSBA 1FU8A 1Z37A 4Q02A 1CVRA 1RLOA 1ZKDA 1V6CA 4YRJA 5KX5A 3L0OA 2C3UA 1P2FA 2LGJA 1F8FA 4OYRA 3T5TA 1EFPB 3VVLA 4ZYVA 1PT7A 4HDNB 2ADMA 2D59A 3H1AA 1PYDA 2XQGA 2C7OA 3ZHYA 1AB6A 1ZOLA 4L8FA 5EY5B 3M33A 2Q1TA 1XQXA 3OLZA 4QEKA 3SVZA 5KJFA 5IEJA 3HJFA 4XRRA 4UHEA 4IAOA 4B3JA 1IZ7A 2GHRA 2PA3A 3OCVA 3ZZ1A 4ZAYA 4HFNA 2QN6A 2ZRBA 3IQGX 4IIDA 1F2UA 4S2EA 1M2VB 2GEBA 4CKEB 3UFXA 4KXLA 1A1SA 4N41A 4D81A 4G1MB 5HFNA 1U7PA 3K35A 2G04A 4XUDA 2CBGA 2E49A 2BDTA 3B8HA 4IDGA 1UAAA 2CXUA 5DI3B 1OXUA 3FOWA 2HPVA 1I3NA 5AVYA 1C0IA 2B37A 5DHAA 1GADO 3I39X 1RJWA 4KRXA 1ZSVA 4KVGA 4B32A 3Q3EA 3ZHBA 1P9NA 3N2IA 3NXKA 2R1TA 1ZXBA 1AMUA 4B1FA 3LP6A 3OH8A 5LQNA 5AOAA 2GPYA 4AJOA 1N34B 5LVAA 3CZRA 2V0GA 1Y6RA 3LZ6A 1SC4A 1ODIA 1V8ZA 2ZIAA 3G2KA 3ZBPA 3EEIA 1ZD9A 4FWTA 3U4MA 4WFKA 2F1KA 1C7IA 1XZGA 4P84A 1VOTA 4D8XA 2AC7A 2G5TA 3AW9A 2ENUA 1KXJA 3DLIA 4BLUA 4G5XA 4CMGA 1A97A 4DBZA 4CDNA 3EODA 3QXGA 4EY5A 4Y98A 3V1UA 2WHEA 3VC2A 1FZQA 3F5QA 1AM4D 2LWIA 3FPLA 3H3JA 4BPRA 2PH5A 4C03A 1DLIA 3HKDA 3GLIE 1FBNA 2VDKB 2RHBA 4IJMA 1CUIA 5JG7A 1EHCA 2RK6A 5H82A 4RA6B 4TZTA 1ESNA 1R9JA 3QEKA 2QR2A 2C4TA 1ODKA 2YZGA 3G3EA 1ECGA 1EZZA 1SCQA 4MIEA 1XYVA 4URFA 2VWHA 4PC2A 5CUQA 4HB3A 1JKJB 3V97A 4C7VA 3QFFA 1SM4A 4UUPA 1CRWG 3NATA 4NFSA 2D0DA 1Z12A 1Y63A 3RUDA 3ZXYA 1G5HA 2MSNA 3BXEA 2XWPA 2MMGA 3U0VA 3DCJA 5F73A 1SXIA 2NW6A 3KVVA 4ZODA 1G8HA 1VRVA 3ETDA 3GFSA 4AJEA 4W7IA 3LX6A 1A71A 3ASZA 2JBHA 2AG0A 3M6LA 3OICA 4C07A 3EZFA 3D64A 4FFNA 4MS4A 5C34B 1NIJA 2JA1A 1RFGE 1E2JA 5HGXA 1Q77A 2ZDGA 4DLBA 1JLKA 3Q3JB 2ZW9A 2BEUB 4KQ9A 3ZG6A 3ZQUA 4ZZ0A 3W8NA 3T38A 4NBRA 1VA4A 4L0QA 5TQ2A 1ZIOA 1H2XA 3DL2A 3ILXA 2DFDA 5FCDA 3RUCA 4F71A 4CQNA 2CNDA 2GD1O 2D2IA 4E0BA 2FMXA 3G9XA 3SHOA 2GPWA 5FBWB 4IHJA 5A4MS 1AHNA 4Q9AA 5DMHA 5E8RA 3E5NA 4L51A 3DO8A 3M9XA 5DB4A 1CYEA 1TVKB 2CBZA 4JB0A 4OG2A 4I5EA 3I1JA 2QDKA 5AW4A 4EFLA 2EP7A 2QWXA 3G0CA 4P3KA 4ZQIA 3WP1B 2NU7A 5KIAA 1YB1A 3RAEC 3I6ZA 1Q21A 1IONA 1TJ4A 3AUTA 1VLHA 3EDYA 2WW8A 3LGAA 3M7IA 3NEAA 1R8JA 3BBPA 4WZ6A 5A2GA 5C4IA 1FUUA 2XNDD 3DL0A 3UG6A 1AKYA 1C8VB 2A7QA 5CT9A 3WGGA 5AI0A 2WWVD 5I4BA 1CJTC 1D6JA 2NZWA 3P9YA 3D0OA 5IVIA 4GXQA 5CA0A 3VUFA 2Y9MB 4BNHA 1T3SA 4WA7A 2JCGA 2PY6A 2UV8A 1SIWA 1K8RA 4ZAGA 3S40A 1IN7A 4BB5A 1ZNZA 4RWEA 4RZIA 3L6OO 4OQMA 5K8TA 1IG0A 5LFAA 5K1ZA 4YJ3F 1EFVA 3G9ZA 5UKDA 3UJCA 2QF7A 3WV5A 2HIMA 1Q83A 5GZ1A 3RBXA 4OBEA 1SVSA 3PI6A 4RBNA 3LV8A 5BURA 4PICA 4JJEA 4RSMA 1D7AA 5CT6A 4HK4A 5JBQA 1Z7BA 2UDPA 3BRWA 4FT4A 1W5EA 1RADA 3LK7A 2HU8A 1IJBA 4CIYA 1VLQA 2MYNA 1HY3A 2O3QA 3DBRA 4LX8A 3WL5A 3DCYA 3G23A 3NKLA 4I2NA 4AG3A 3R3VA 1RVV1 2HK6A 3UJAA 1D6NA 1H2ZA 5DW0A 1U04A 3IL2A 3MWEA 5SY9A 4EUFA 3LYUA 1B00A 2HWYA 2OO5C 3BFJA 2XQKA 1JXQA 3F8TA 3RD5A 5HQTA 4BC0A 2GM9A 3TQTA 4QUGA 2I6GA 2PWPA 3U9TA 4EQ6A 4ZO9A 2DZDA 3PUZA 1O89A 3KCNA 1GCOA 3EZXA 1XYYA 4YI5A 1Y6GA 1E32A 1NKVA 2R6JA 4AO8A 3FUVA 5CFMA 5F23A 2JH8A 3PPWA 2DPHA 4OLAA 2Q3FA 2ZVDA 1FNSA 1GQ2A 1XKTA 2QP9X 4P08A 4LDPA 4JI3B 5FUMA 5JZBA 1XMJA 3WSVA 1VI5A 2PJUA 1KQ3A 1WKBA 3ADOA 3PC8A 4OXXA 4BLWA 4EATA 4EY4A 1P2VA 4F9FA 2XZOA 2UVPA 4JJAA 4LPKA 8ADHA 3SHWA 2E4ZA 5DGCA 1N6PA 1NVXQ 5CEJA 4KR3A 3QX7A 2SKDA 4HDSA 2FGKA 2XYVA 4JN6B 5J1SB 2G6TA 1TJ3A 3SK0A 2EP8A 2JFYA 5KREA 3AHGA 3QEAZ 2WDPA 2WFZA 4US0R 4HAVA 4KWCA 3K92A 1NF2A 1N8KA 5C80A 2QX6A 2DMRA 1EVYA 1CNMA 3IUNA 4M0UA 3MT9A 4AKGA 4QOHA 3BC1A 3SF8B 5C5EA 4F3KA 3K09C 4CEHB 1WB6A 1X38A 2X7JA 4X1YA 4YWHA 2DSNA 1VKZA 4Q82A 5HF5A 1IC6A 4RD4A 1TUEA 2R6R1 3W78A 3ILSA 3U13A 3ZU3A 1S2DA 1VE6A 3A1FA 3VO1A 1H3FA 4H7KA 2PKRA 2WVGA 3ZWBA 4NENA 1FNDA 4IRXA 5BW8A 1FQOA 3NKFA 1AGNA 1T5DX 3F47A 3OZEA 4LS3A 5DX8A 1OLSB 1UANA 1TQ8A 2RONA 2IRWA 3QPCA 1TEXA 4NICA 4S3MA 3ULKA 1GDDA 2NXNA 2A1IA 4UHKA 4MS1B 3LZDA 4FGZA 3PNBA 5HZGA 4QKQA 5TT0A 3CSSA 1QZTA 3U09A 1THGA 1MR3F 3NX4A 4LDAA 5GIOE 3OF3A 2DSTA 2CMDA 1H2BA 4JI7B 1A5SB 3CINA 3VR3D 3RIEA 4D4MA 2WAOA 4R2HA 2IXEA 1X8LA 2QG9A 4MICA 3BWEA 1IOLA 1ESZA 4MYCA 4KXFB 4Q01A 5SYAA 4DIOA 4FFDA 2GILA 2EYQA 2QRVB 3S2UA 3U3KA 1D0SA 3U62A 3F0TA 3DNPA 4WLVA 1KSHA 1DKRA 4HFJA 4F2PA 1VHQA 5G53C 2GCOA 4QRHA 3ENNA 2HO4A 4ZVOA 3T52A 3VI3B 1MX5A 2QTFA 3HM2A 1F6DA 3E5RA 3KOYA 3SR4A 5EGSA 1ZGHA 1C4OA 2NZVG 3EOZA 3A1UA 2BEVB 4MR8B 1II8B 1JECA 1NYRA 4WLFA 4YMLA 1KJQA 5AXCA 1P1HA 4D25A 2GWHA 4DREA 3PJEA 1R6UA 4KQKA 4R8MA 1MG0A 2HLDD 3LSTA 3VBEA 2Z5LA 3LPLA 1HZZC 2OVBA 2R6CA 4UU7A 4A0HA 5ECYA 2IU0A 4MV9A 3COYA 3VHXA 5DYIA 3RUIA 1IHYA 2AWNA 2HJHA 3ZEIA 1AGXA 2CNOA 5FWDA 3RFXA 2AKAB 3FPBA 5U4XA 4R9SA 2RE8A 1CQXA 3BIFA 1VGVA 1W88B 2NXEA 2YYAA 4LCEA 3R3HA 2DC1A 3USZA 2X5XA 3BE4A 2N46A 4JR1A 2EJCA 1UXOA 4ZPJA 1BNCA 4MROA 3OF2A 4EG6A 4FCVA 1O95A 1DV1A 1B43A 2CD7A 2ID8A 4XWAA 2Y67A 3RC2A 1ZD4A 3I9LA 4RVOA 1N5RA 2XVZA 1TC1A 4KWEA 2A9JA 3FMVA 3PGLA 4PX9A 3VQTA 2AW5A 3TGWA 1OFUA 2GAFA 3ELBA 5JO9A 1Z6QA 4KUGA 2UXCB 2NPFA 4Z4HA 5J3JA 1OHHD 2YV3A 4MJ7A 3TR5A 1DG1G 1F38A 3LBHA 4GUDA 2O14A 4DA8A 3MOGA 3VMMA 2IIVA 2EJVA 2IW3A 3AFHA 4FK8A 1RQ2A 3HCCA 2XUIA 4GZLA 2QU8A 3UFXB 4XX0A 3W2FA 4ESOA 5BWMA 4UMEA 4NZMA 4GQAA 2GI4A 1U0RA 3LVQE 4DCNA 1MIOA 4OMUA 3RKUA 4AP5A 3QTTA 4C06A 4Z4GA 4QGHA 1FU4A 1UBNA 2EF1A 2LRHA 3A9SA 1WKCA 2GYWA 2CCJA 2QXTA 1T36B 3PRHA 1DXYA 4Z1OA 1WLSA 3HBNA 4G0YA 5J2TF 3TZLA 1H22A 2HMUA 1B3RA 4HLUC 3O9ZA 1C0LA 4ERXA 3I1FA 5CGZA 1BA3A 2WM3A 4CDGA 4D8TA 2R1TB 3KQLA 1EFCA 3K31A 5C8YF 5EHXA 1ZLYA 3BICA 2FNAA 3HZOA 1XUOA 4E7PA 3D7KA 1NLYA 3JQ7A 1JQ5A 1PD0A 3BERA 3GJ4A 3JD1A 3R0ZA 3IODA 1L4MA 1U1DA 2PH1A 2L0XA 5J9FA 2ZRAA 3WIDA 1JLRA 5CXUA 5I7FA 3PNKA 3OZ7A 3A3NA 3K0CA 3WLAA 2HX1A 3LIIA 1KVQA 3MBOA 1RAGA 1GPAA 3A27A 3KT6A 2SHKA 1QWSA 1E1NA 4Y6QA 4KK4A 3IQEA 4QASA 1GIAA 3BM5A 4QU9A 1T4MA 2H1RA 2HLPA 3HWWA 2I9PA 2OCBA 4IZHA 4POAA 2H18A 1QV7A 3GK3A 4DEVA 4YQFA 1RJFA 5JAQA 1NYQA 4P36A 1IY2A 1KHTA 3M5WA 5EJMA 1IVYA 2BGWA 3WFIA 3V8MA 3C41J 1DAPA 4LFCB 1PR4A 2Y1EA 2BM8A 3G8DA 4E07A 2H4ZA 3UXHA 4C6TA 1HMPA 3SZRA 4PGMA 5TGTA 3V4LA 2HLHA 3MRVA 5G41A 4UPEA 4JT2A 1KO8A 3CGWA 2WD7A 3OQOA 1JEAA 5I01A 1SXQA 1FUIA 4HAOA 2J9YB 3TI9A 2VP4A 3DQZA 4TLAA 4COOA 4FMBB 4RKYA 3K8ZA 1ELOA 3W9BA 5KX5F 1FLDA 1MC5A 1P73A 4DUGD 4U0KA 3SM9A 2GCNA 3LC2O 4IOKA 2G09A 4O4LA 3S3TA 4CM9A 5JH7B 1ZNXA 2XLBA 3NTRA 2PMBA 4P83A 3T54A 4HGRA 3U81A 2DY1A 1XA0A 4PONA 1ZONA 2Q4RA 3EIHA 1M6EX 4RIFA 4WUTA 1CZRA 5TQ2B 3NBAA 1G7TA 1EINA 3T1OA 3FWHA 2CLFB 4CCYB 1EVQA 3TTSA 1WQ4A 4B6OA 1KDVA 3WSTA 1KPIA 2DR0A 3O1JC 2YV5A 5EKUA 1NU8A 3AVWA 5AKIA 3GDGA 3D3NA 3I01A 5AM1A 1IVSA 3IOBA 1LF0A 2QJOA 3TEJA 5IXJA 3I52A 5KQPA 3CFYA 4W6ZA 1VIYA 4GLOA 2NU7B 4ES6A 3A9WA 4JXKA 5CITA 4ZV7A 4M9CA 1XQYA 3FDIA 1ZJ5A