2PUTA

The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
352
structure length
339
Chain Sequence
PYKHFMQKEIFEQPDSAFNTMRGRIDFENCVVTLGGLKSWLSTIRRCRRIIMIACGTSYHSCLATRSIFEELTEIPVSVELASDFLDRRSPVFRDDTCVFVSQSGETADSILALQYCLERGALTVGIVNSVGSSMSRQTHCGVHINAGPEIGVASTKAYTSQYIALVMFALSLSNDSISRKGRHEEIIKGLQKIPEQIKQVLKLENKIKDLCNSSLNDQKSLLLLGRGYQFATALEGALKIKEISYMHSEGVLAGELKLPIIAFATRDSLFPKVMSAIEQVTARDGRPIVICNEGDAIISVHTTLEVPETVDCLQGLLNVIPLQLISYWLAVNRGIDVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Crystal and Solution Studies of Glucosamine-6-phosphate Synthase from Candida albicans
pubmed doi rcsb
source organism Candida albicans
molecule tags Transferase
molecule keywords isomerase domain of glutamine-fructose-6-phosphate transamin
total genus 142
structure length 339
sequence length 352
chains with identical sequence B, C, D
ec nomenclature ec 2.6.1.16: Glutamine--fructose-6-phosphate transaminase (isomerizing).
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01380 SIS SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2putA01
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2putA02
1NUHA 2ZJ3A 2V4MA 2UXCB 4DUYB 3I0ZA 5BY2A 1MOQA 1T10A 4S12A 4EM6A 4KHPB 1JEOA 3G68A 4AQYB 3T1HB 1IRIA 4B3SB 2PGIA 2X3YA 4U6NA 4LF7B 2UUAB 4LFCB 1NRIA 2XHZA 4X65B 4DV5B 1HOXA 3FKJA 2CXQA 1XMOB 1C7QA 1GZDA 4LFBB 4DR6B 3BCHA 3FJ1A 3HJBA 1HNWB 3T1YB 1N36B 4GKKB 3FXAA 1J5XA 3OTOB 3J80A 2DECA 2UUCB 1IBKB 1N34B 3LJKA 1N8TA 1IATA 1HR0B 4GKJB 1N33B 3JX9A 2XBLA 4DV7B 3Q88A 2ZM6B 2VF5X 2AMLA 2VQFB 2PUVA 1HNZB 3EUAA 4AMVA 1IBMB 2CXNA 2E5FA 3PR3A 1JLHA 4X64B 4X66B 4NXNB 1C7RA 1DQRA 2J6HA 1X92A 1G98A 4DR1B 3M5PA 1XMQB 4DV6B 2VF4X 2Q8NA 4DV4B 1FJGB 3TRJA 4JI3B 2O2CA 4IVNA 4JI2B 5IWAB 2POCA 4OX9B 1U0FA 5FLXA 5BR8B 4YHHB 2PUTA 4S1WA 4DV2B 1TZBA 5I01A 3NBUA 4DR7B 4LF4B 4M0DA 1Q50A 2CB0A 1XTBA 4DV1B 1KOJA 4B3RB 4JI5B 5LL6P 4NXMB 3J7AC 4DR5B 3HBAA 2UXBB 4DV0B 4JI6B 1JXAA 1JIQA 1M3SA 2CXPA 3C3JA 2CXTA 2F4VB 4LF8B 4X62B 3BJZA 2UUBB 1VIVA 2UXDB 1ZZGA 2ZJ4A 2WU8A 2E5LB 3QKIA 3UJHA 2O2DA 3FF1A 2HHHB 4JI0B 3TBFA 4B3MB 5LMUB 1VI5A 2CXSA 4JI1B 1U0GA 1X9IA 4JI4B 3Q7IA 4DR2B 1X94A 3OOJA 2I2WA 2UU9B 1B0ZA 3ODPA 3CVJA 4DR3B 2CXUA 1N32B 2VQEB 4LF5B 5LMNB 1MOSA 5A2QA 4LF6B 4JYAB 4LZJA 2A3NA 1HNXB 4K0KB 1XNQB 3KNZA 1HM5A 3JAMA 4JV5B 1J5EB 2PUWA 3ETNA 1VI6A 1XNRB 4JI7B 2YVAA 1TZCA 1WIWA 2CVPA 4YY3B 1IBLB 4JI8B 4LF9B 4B3TB 4DUZB 1I94B 1X9HA 3SHOA 3J81A 1TK9A 1MORA 2I22A 4TOIA 1GZVA 1U0EA 1VIMA 2CXRA 4LFAB 5IT9A 3IFSA 4DV3B 2DF8A 2CXOA 4DR4B
chains in the Genus database with same CATH superfamily
2WTNA 4FFWA 3GRKA 3FPGA 3O91A 2GZHA 1O6BA 1T9KA 1HT1E 1SZPA 4PZAA 4FT2A 4YMUA 3K1YA 4CTOA 5B4UA 4NC9A 5ALEA 3VAZA 1U2PA 2J9RA 1F6DA 2KE5A 2XIQA 3G68A 1G66A 3OFVA 4MKZA 3R8XA 3FOEC 3KSDO 4A8PA 1EVZA 3UAGA 4BNMA 4MCHA 4H6VA 2PJDA 5LB4A 3ZWMA 1JHVA 1S01A 1EIWA 1XNGA 1FDTA 3ZVNA 4EY5A 1NNEA 4L07A 2C4UA 4UMVA 4WASA 4QG3A 3ENQA 1EESA 4RJTA 4L0MA 1IHDA 3PFBA 3HADA 4CUZA 3GPIA 1V2GA 4HVTA 5BOSB 3C87A 1G38A 2KW5A 1Q7TA 1VPEA 4TLCA 2VPZA 2XA1A 3D3KA 4OPMA 1U3DA 2IDKA 2GKGA 2QR3A 3VOAA 1KEEA 1P4SA 1SEVA 3HB1A 5IT9A 3H04A 3TRFA 2YQ5A 3TAHA 5DN6A 3VOTA 3GPBA 1Y3BE 3N8KA 1JR2A 4HB4A 5SYNA 4BMXA 1HKHA 1XJCA 3L1KA 3EIEA 3WI7A 1LBEA 1RHQA 4OYLA 4UNPA 3ROKA 3SC3A 1PNOA 3DUFA 1I6WA 2N47A 3UGTA 1B16A 3D6MA 1MC8A 3EPHA 4CV0A 2CK3D 3I1IA 2W2TA 2O2CA 2I2AA 2WJ6A 1UEXC 1GYPA 2Z58A 3G1WA 4RESA 4AU1A 5HZMA 5KNDD 3IXLA 4AKIA 1UP6A 4KGVA 4NCBA 1D7AA 1DAKA 2VATA 2FW1A 4IJQA 1LDMA 1SKBA 2P9GA 2G8NA 3TL2A 4BFVA 1BKYA 2JH9A 3P9KA 4CKWA 3Q15C 2FYTA 4XFJA 3L9WA 2ZSDA 3H0KA 3PUXA 2ONCA 3Q40A 2F3QA 4L6IA 3SVZA 4Y0NA 2IX3A 3EBOA 2UVPB 5H80A 4Q1CA 1AO3A 1L5GB 1RBZA 3PVCA 3TAUA 1BCSB 1FYXA 1UC5B 5ER6A 3U49A 2YWCA 2O7NA 5A1TA 1E32A 3RHZA 2O59A 1NRJB 2PQ2A 3SKVA 4CKEB 2QX8A 1JU3A 4NJEA 2QE7A 4XIYA 4DM7A 5AHXA 1YE3A 5B4VA 3FX2A 1J0DA 1H6CA 4YP6A 2Q3JA 3C15C 4RD2A 5SZIA 1LLUA 4QRIA 4GEGA 1E2IA 4EJSA 3ZDBA 2ZYRA 2QGNA 4HGQA 4MW4A 4TV9B 5FRDA 3G9QA 3ODPA 5HR5A 3AINA 3EDMA 4RELA 4DR3B 1UADA 2D6FA 3GP3A 3P19A 4MKIA 4AP5A 4XFDA 3QWFA 3NHYA 2YV2A 2V7XA 4LISA 2IXTA 3TPZA 5EJ9A 5K8IA 5C18A 3RNOA 3HVUA 4DBLE 1T5SA 4BS9A 4D97A 1T3SA 2RIRA 3ELYA 4OL0A 2YZMA 2CSXA 4E11A 4P3KA 2VL7A 1MB3A 1PVDA 1E2PA 2C5AA 2V74B 1Y1SA 3GPCA 3D3JA 3JWEA 4JVNA 4LV8B 3LECA 4Q1AA 2LDXA 4HAXA 4HAZA 2JD1A 5F5NA 3C48A 3EC7A 5NULA 1OAOC 2P2GA 2G6TA 3HKBA 1FU8A 4HNQA 2PQ6A 1WS6A 3HFJA 5TDHA 3WWCA 3DE1X 3X1ZA 4BCBA 2ZXUA 4X44A 5HFJA 3ORFA 5CR9A 1X13A 3D2LA 4RK6A 2JIMA 3PA6A 4I9FA 5JJCA 5JXJA 2OCLA 2DSTA 3EPRA 1JDBB 1QGAA 1X77A 3QWHA 1P9OA 2KPOA 3KVOA 5IVPA 4J94A 2GO1A 1NN3A 3L92A 3WLJA 4DUGD 2IS2A 4AJ9A 5HUHA 3LUHA 2C3OA 4HEQA 4G8DA 3PGLA 1YZHA 3UUFA 4QDUA 2GVZC 4OHRA 4AL4A 3IEUA 4MULA 2OOKA 1HH4A 3CRZA 4LA4A 3JQ7A 1ZD2P 4QSHA 3LKZA 2XRFA 5CT9A 1IVNA 2OV3A 4HNTA 4EL5A 4GWLA 3T7CA 2ZQZA 3SS9X 13PKA 1J23A 1N8NA 1J9GA 2UDPA 3EULA 3LDHA 4UNIA 3B8EA 3CCBA 5EINA 2P5TB 5DBGA 2AI1A 5GWXA 3EBPA 4OHZA 5KIAA 4FZVA 4MAFA 3VX4A 5TQ2A 4A36A 1XJ0A 2ZBVA 1A8QA 3DMYA 4EA9A 1YDWA 3DC2A 4N5DA 1XA3A 3ADDA 2VJDA 3HCRA 2DFDA 4M49A 2GJ9A 4ZTUB 3AR6A 3ZS8A 4L50A 4C0HA 2QNIA 3LZCA 4IF4A 4NNPA 5CT6A 1I13A 4ZK6A 4AC9A 3AVTA 1QHGA 2CSUA 1RXUA 1FP1D 2XODA 4RCZA 1D6MA 5K20A 1DG3A 3PFHA 1TZJA 3SYMA 5K3AA 2F3PA 1XT6A 2NTVA 4Y6SA 3UAZA 3HMKA 4BQIA 2C2OA 3GUVA 3KFXA 3GT0A 1PU2A 4REOA 1JPUA 4M83A 4PQRA 3MGKA 2XA9A 2RK3A 1TECE 1SCKA 4IEFB 3WWZA 1APBA 5AJYA 5FI0B 1ZU4A 2AT1A 3RBXA 1ULAA 2ZSIA 4WN9B 2LW7A 4D1YA 4JUDX 4OY3A 1Y98A 3FFAA 1I3NA 2B1RA 5J5CA 5J63A 3RRBA 4OKIA 4S0ZA 3RE1A 3RS9A 4RQAA 5EKUA 2QTRA 4HQNA 2QVCA 3WGVA 2JG3A 3U3JA 2H1OA 1ZY2A 4OEHA 4KN9S 3BKXA 3ICPA 4MUYA 3KZOA 4XYBA 4MAAA 3S99A 2Q3FA 1SC4A 2IY7A 1QYDA 2ACWA 4AIRA 4XWTA 5CVUA 3UV3A 4ENTA 5JOQA 5LL6P 2CVHA 5TVGA 3N87A 3AL3A 4P7JA 1SIOA 2X0JA 1J99A 2FMHA 2DX7A 4FFRA 4GPIB 1YMUA 4FDAA 4RANA 3RBAA 4B44A 4GPBA 5F21A 5TGZA 3E27A 3X1YA 5K2OA 1SK9A 3I1JA 3WY9A 2ZJ4A 2X23A 1CIPA 3KR1A 4J3FA 6NULA 1IZ7A 1GYQA 3PA8A 4S24A 2YS7A 5ALUA 4NFLA 3KLMX 2NPFA 1NVXQ 1E62A 1A97A 3NT4A 1GDDA 1Q22A 4MV7A 2WRZA 3BXZA 1KVUA 4KHZA 2C0QA 4N9WA 3RYCB 2ACKA 1BA2A 1ZXLA 2H00A 4R3UC 2H54A 5E6RA 2G83A 4QOFA 1S9HA 1RPAA 1HNXB 2AIRA 4MHSA 2DPGA 1NQWA 2QTGA 3KJGA 4KQ1A 2Z8YM 4MS4B 3UMBA 2HJVA 3BDIA 3G13A 2VDNB 2IP4A 4I9HA 3RC9A 4C3ZA 2CDBA 1KQ3A 2J45A 5I5EA 4DA4A 4I81A 1D2AA 2KBFA 4CM4B 5AJTA 3AM5A 1ZU5A 4PRKA 5JHHB 2A9OA 4WXEA 3GG9A 4F8EA 3ILXA 2J09A 4CEIB 4MYCA 3C3MA 3BE8A 4OHVA 2EHDA 1JQEA 1Z2EA 5I9LA 3V4RA 1IEQA 4GPTA 4JNCA 8AT1A 1FX0B 4HWTA 4KXWA 3S8YA 3QFCA 1ZH0A 1Z6AA 2XT0A 4KJZA 4EELA 1E18A 3GRUA 1ZGZA 3COYA 2OXCA 1GDTA 1SBIA 1ECLA 3OLXA 4P3NA 1DEXA 1SXJC 2G4LA 2WJYA 3KX2A 4LDQA 1GGFA 4GMDA 3FE2A 1JHUA 2WAXA 1DIRA 2QTBA 1ABFA 1ZGJA 2Q4DA 5E4FA 4PZEA 4FLFA 2PEZA 4X92A 4HI0E 1KH1A 2H2IA 3EW9A 3MA0A 4FFNA 5CAEB 2XJ9A 4KOEC 2C96A 3V9AA 1HNNA 2O2XA 3ZC3A 3IO3A 1UJ4A 1CIJA 1VQ1A 4A1OA 1RJDA 2Q5HA 2VWGA 2YCLA 1X80A 5ER9A 4DNQA 3TQCA 3EXAA 2E6UX 2D7CA 3RRXA 4RKWA 1HEYA 2H16A 4L9SA 3RIHA 1BEEA 4PG6A 3WB1A 2HWWA 2NYUA 4TTQA 5LD2B 2PKRA 3LT4A 4R0NA 1SCBA 4C4OA 1PJRA 4OXKA 3GDHA 4P58A 2ZRCA 1LD3A 4TTJA 4URYR 2FE4A 1I9GA 2WDPA 4DMLA 1FLDA 4AJ4A 5JWRA 2Z0MA 2R5WA 3AV0B 2VNIA 2YXDA 3DMPA 3LKDA 4AKTA 3MPUA 3H4MA 5KC9A 4KE8A 3HTXA 4X1YB 2RH8A 2GNPA 3A10A 4HX2A 2ZAIA 4MVJI 3T5GA 4OXQA 3WJ1A 5JJKA 2Q8NA 4FHFA 1XK6A 1E2EA 2Q0QA 5DCWA 2H7XA 3TLGA 4EVQA 3JZIA 2ODPA 4M0EA 4E30A 3ZWPA 2D2EA 1XEWX 5T4FA 1VDMA 2FZ4A 3MBOA 4DB4A 2AOUA 3CLKA 4DUPA 1ADJA 2JLVA 1KI6A 3W06A 2CXXA 1GVNB 1I0IA 2Z2KA 4Y8VA 3TOCA 4HLUA 1UK9A 1E1CB 5AKIA 4BO8A 2F90A 2ZTMA 1P74A 2C4TA 4F21A 1T9BA 2QX4A 3VR6H 3WMGA 4AJ2A 1BGVA 3KHSA 7REQB 2QJOA 5ADUS 3IOYA 4NBWA 1TADA 4BE9A 2H8GA 5HK9A 1N1DA 1YZQA 4BKOA 3GGOA 3UB3A 3R0XA 4GXQA 1WMFA 3PD1A 1KRHA 2WOJA 4EITA 5A3JA 4CQLA 4PYIA 1FJ2A 3HZOA 4OUDA 5IVDA 1AHPA 2CFIA 3AR8A 4JCCA 4LHZA 4K6KA 4IHJB 2X3UA 3BFXA 3KRTA 4R7GA 4CNQA 1IONA 4ZHQB 2G4VA 4XGNA 3NH9A 2PJRA 1QX3A 2O48X 1IQRA 1WU8A 5EMLA 2OSVA 4EFDA 1L5HA 1J8FA 1OD6A 4I1YA 3DUWA 5J40A 4CTKA 4Y7DA 4W6QA 1W2WB 2X8LA 4M6WA 5AXBA 2OE2A 3JARB 5LP1A 1BCSA 1ESDA 3RADC 2VHWA 4ZO7A 5IJ0A 5JY1A 3Q3HA 3ISJA 1GTG1 2HFKA 2VQEB 1SG0A 1Z0JA 3IE0A 3H9GA 1L9KA 4HD8A 1VL5A 4F4HA 1L1EA 1CUFA 2JKYA 1CNMA 3QLTA 4K6OA 4G4SO 5EZYA 5FR2A 2D0OB 4AF8A 3LBAA 2GWRA 3KXPA 1HDRA 4RK7A 4WK4B 3TTYA 2F3SA 1KJ8A 2XECA 2KLBA 1T0HB 2Y67A 3AP1A 3MAGA 3P9YA 3KQKA 1L1RA 1S4QA 4PO9A 4QU9A 3V32A 3KAKA 1TTPB 3ESYA 3IVCA 3ME5A 3OTGA 4A82A 2C95A 4AUMA 4C3OB 4DCOA 3BH0A 1GZVA 4UQOA 4DM3A 4HXFB 5LN1A 3CH5A 3V80A 3U44B 1B43A 3W1EA 3PWTA 3H5NA 3MWEB 3DPIA 3VZCA 2CNWD 3PD0A 4WOJA 4IO0A 4FS3A 3TE6A 5CA1A 4MUHA 3ANNA 2I66A 4HN9A 3LRXA 2ZIGA 2FLVA 2QRLA 4GC9A 2YCBA 2NUTB 4G1CA 1WU7A 3WDSA 1UM9B 1U28A 2XSZD 3IJPA 2I4RA 2HQOA 1SXJE 3ESRA 5KTRA 4V0LA 2RGYA 3D4NA 2SICE 3NIDB 4OSPA 1Z6ZA 5LZ8A 1P4JA 3OEEA 3V3TA 3JTMA 1Y42X 3T4XA 4EYOA 1OFUX 1AOXA 4ZYUA 4IKEA 3E5RA 1F8GA 1COWA 1I3CA 1QF9A 4MIKA 5FHQA 4JMLA 3HHPA 5KZMB 1IZ9A 1KYIA 4OJNA 3T61A 4D4KA 1OH7A 1LPAB 2FXIA 3GFOA 2PZ8A 3RHFA 1BA3A 2NO5A 3FCYA 4Q9AA 2B34A 3ELWA 1G5IA 4JU8A 4BX3A 1HR0B 4HH1A 4D74A 3CE9A 2RHCA 3M6MD 1USGA 2X6RA 3VR6A 3AUYA 1ECBA 1FNSA 3FG9A 4Q34A 3VV3A 5KJ6A 1KWKA 5EE3A 5BT8A 4G85A 1Y1PA 2XVZA 2PLRA 3A4LA 3E9MA 1V8OA 3E0QA 1OV4A 4FDVA 4P84A 2DZDA 2C8KA 3GAAA 4MPPA 1JIKA 5ALGA 2P30A 2CV0A 2I1LA 1NPDA 3FFWA 5EE0A 2EW1A 1WCWA 2FVXA 1O5TA 3MHPA 5AWFC 2OM6A 5ALRA 5ULLA 1UKAA 1GGJA 2JFXA 4M0FA 2AOVA 4YYEA 1WCYA 1ZD4A 5B37A 3DMDA 5AVYA 2ZUEA 3ASVA 3NTVA 3NBXX 5DDIP 2LGJA 3B9BA 2G25A 3WZLA 5ALFA 4B7ZA 4CF3A 5GM1A 3L18A 5TNXA 1OTHA 1VLJA 5LMZA 2H4YA 3WMWA 2DCUA 4CMIB 1VJCA 2XVMA 1GNRA 3REQB 3LHKA 2BKEA 1EAMA 4YRBA 1HMPA 1WXHA 5F73A 1EDBA 5C2JB 1JDBC 4XUGB 2NSYA 1CYEA 2W22A 3Q8WA 2ORVA 4GKVA 4C87A 3N6RA 1U31A 3FROA 5KHAA 1H2EA 4NMHA 2O8EA 3C8ZA 4BO3A 1JYFA 1A4UA 3KOYA 3NXKA 3PHCA 2PSEA 1JI0A 2H11A 3PXXA 5TY0A 1S2DA 2Y1DA 4NEQA 1PGNA 1J00A 3TOXA 2BFDA 3NHPA 1RXYA 2VBGA 3FY4A 4EKNB 1SVNA 3OLVA 1F2DA 3U09A 5ECYA 2QTHA 5AESA 1J2JA 2YX1A 2E1RA 3NKVA 3PDHA 1VECA 2QY6A 2NXEA 3L7DA 5HFNA 4RY0A 4EATA 5IDWA 4RPKA 2CL6X 4LY3A 4F6LA 2YHUA 1V16A 4LX8A 5CB4B 2FUKA 3N75A 2B82A 1JFTA 3W2GA 2AKYA 3TEFA 3VISA 5LMNB 1KFEB 1TC1A 3EEFA 4QU8A 4GRDA 4JKOA 5KEIA 5P21A 1K3UB 3NYWA 3SGLA 4D4HA 4ETNA 2ORWA 1PFUA 1ACJA 2WOOA 2PRKA 2GEDA 1PE0A 1CUSA 2B8WA 4BHTA 2C9MA 3E84A 3W9BA 1N4DA 4Q7QA 5EJ5A 4YCLA 1QG2A 1ZRSA 4E2FA 1JDTA 4MLCA 1E5XA 1JFFA 2PSSA 2W48A 1Z22A 4FN5A 1PVVA 5H7XA 2I22A 2A58A 2IL1A 4R8VA 5KOHA 2P4QA 2BRUC 1YZ3A 1EUCA 3BREA 4JASB 4Q3AA 1GSOA 1E3WB 1EFKA 1WB4A 3OPYB 1CS4C 3MJDA 2X5JO 4WPGA 5B1YA 2YFHA 3LY8A 2IHKA 1O6CA 1O94A 2CYCA 2Q1SA 4QTTB 1SVOA 2VUHB 5AVKA 3CF2A 1Q7BA 4MR9A 1SXPA 3H5IA 3EVAA 4TT3A 1ESMA 2PTGA 2V7EA 4G2NA 4V39A 2XITA 5IKOA 3EDRA 4WOPA 4QBHA 5CFZA 4N8EA 3AZPA 3LOQA 5EJ4A 1BJTA 3O3MB 4QJBA 2PRYA 3SR0A 1CUUA 2BFNA 5JU6A 1P1IA 3BXPA 3B1VA 4QDKA 4HGNA 3LC0A 3ROFA 3MWKA 5EMHA 3UJCA 2IJGX 1C14A 1S1CA 5THKA 3HFSA 2BF4A 2XBLA 3GV0A 1LVHA 4RA9A 4DQXA 2AMLA 3J81k 4IHJF 2WM2A 4BO2A 2PGDA 3KHTA 3EWNA 4FYWA 1XZCA 5FYQA 2W6NA 2X7JA 3OU6A 4CYMA 3IT3A 1TCAA 4EKDA 3HA5A 1VKHA 1L5YA 2ZBRA 4RHYA 4YRTA 3AKDA 1AXEA 1M2JA 4BO9A 1YR7A 3GCZA 5K3DA 5IYZA 3TW0A 2VDRB 3EWAA 5FO1A 5HTOA 1CS0A 4CHTA 3ZI0A 5CB4A 2BJWA 3HCEA 4IDFA 5E1MA 3OJ0A 1GQOA 3NTOA 2VPQA 3TX2A 1WKCA 3QUTA 5D1HA 2W6MA 1K6IA 2PU7A 3UH1A 5IHXA 2WQ7A 1JKXA 1V9SA 5JDCA 1TVEA 1XMPA 3MJHA 1ZGAA 2Q1XA 5DX0A 4RTRA 4AYWA 3E03A 1THZA 1RABA 3H13A 4NQRA 4HDSB 4L95C 4Z4EA 2FZGA 5JNLA 2QYSA 3LWBA 3SXUB 4H27A 1WB9A 4JZYA 4IDEA 2D00A 4E15A 4YDHB 5JNUA 2HW8A 2YWXA 1LF0A 3AKEA 1YDGA 5F1PA 3SF8B 4D0GA 2J5BA 2XMGA 2P3SA 3C3JA 2H6EA 4H3VA 4KQHA 3D8UA 3ESZA 4NH0A 4G2TA 2IUEA 3VZPA 1K89A 2PK3A 1L5QA 3SNKA 3AKCA 4N76A 5J2TB 1YIOA 1J24A 1ZYUA 2G09A 3M4NA 4PC7A 5HQJA 1JJAA 1ZUD1 4TYYA 2UVPA 2I7TA 5JI2E 1DBWA 3VAYA 2GM5A 4F84A 1XA4A 4MKXA 5KPDA 1D2CA 5IM4F 2Z3ZA 4FMPA 5EHQA 1P2TA 3K05A 1J0EA 721PA 1OBCA 3Q4GA 4RJIA 2JD0A 2QMZA 1GTL1 5CHYA 3QH4A 2NV0A 5FFFA 3EGDA 2QN1A 5EZYF 1I1QB 3UJ3X 4G5YA 1Z36A 1K6XA 4EI2A 1I4OA 3NIWA 2WD7B 2XF2A 2YIMA 3PENA 4UVGA 4K6HA 4FE7A 3C3PA 3HBFA 1RRFA 3VKWA 1EG7A 3IA7A 4XAQA 3IPYA 4ARBA 4DZRA 1I94B 4G0VA 1RPNA 2I9PA 2OQIA 3GG2A 4WNCA 2FQ1A 3ZGLA 4TKVA 2K2QB 4ALJA 2XZOA 1CEYA 1CZKA 2RI6A 3ND5A 1EI9A 4JT8A 3U17A 3MTEA 3CCCA 3CURA 1JDNA 3VR5H 3HO1A 1MFZA 3A1VA 3JQ9C 5B58T 3SFTA 3GLKA 1R74A 5A4FS 1E4OA 3UG7A 4ZCPA 4WSOA 3T0FA 5JCPA 2IIQA 2ODEA 2QX9A 5IDVA 4R6WA 3ZHYA 5LOVF 3SCZA 1NT2A 2JGEA 1EZZA 4HL6A 4DIKA 1KTVA 3D7NA 5MFPA 3LX4A 1NP3A 1ZRHA 4CKWB 1A4IA 3EZXA 1T24A 3U7QA 1JAHA 4LY6A 4YCCA 2CXQA 3LP5A 2Y1EA 1GNPA 4S3MA 3F73A 1L7OA 3PCRB 4B85A 4Q21A 2JAXA 4CT4B 2TYSB 4IF6A 1IQ0A 4AFNA 2HPVA 4NOLA 4CG0A 4EPXA 4YYZA 5FPKA 5LQJA 4BFZA 5FF9A 2QAGA 1GRVA 4BDTA 5F2NA 1GAWA 3KE9A 1Z8FA 3DZBA 4M1KA 4UXHA 4E2WA 2IU3A 1HPLA 4UPVA 2HA5A 3E3MA 1BROA 4YAJA 4MMYB 3V4SA 1NLYA 3T38A 3C3EA 2EW8A 5MFZA 5LZ4A 4ZALA 5F1YA 1IBMB 2QMUA 4RJ2A 1QYIA 3DM9B 2XTJA 4RZIA 4IIXA 5E1BA 3FJOA 3ED1A 5DEOA 1Z0AA 4BUZA 1CDOA 1YT5A 2WKPA 3F5FA 3S2SA 4NE9A 2XWSA 1UIMA 1ICEA 1KEEB 3SHVA 1O0BA 1GL9B 2IEYA 4JA0A 2H31A 1G8YA 3BZBA 4D02A 1EXDA 2AB0A 2GCOB 4WZZA 5EIOA 3TSZA 1VHDA 1PBTA 2QR5A 2JCGA 2K87A 1T8TA 2I33A 3HCFA 4L74A 4YCJA 1AXRA 1L5VA 3WIVA 3FYHA 2BP7A 4D0SA 1HL7A 1URPA 2Z95A 3OAAD 1FOEB 2F9MA 3THXA 4YP9A 2A7XA 4XARA 3N53A 4RVNA 4CF6A 3P2EA 3MYYA 5FNVB 3U6BA 4RUKA 1SVMA 2H4FA 4FX5A 3TEMA 8OHMA 1W47A 3P96A 1UBEA 2YV3A 3F6YA 3CA8A 3AEKB 3OEHA 1L8OA 4JJFA 1BFDA 5CUQA 4EHAA 2I6QA 2PNJA 4BE7B 4ER3A 4FLEA 1DJQA 1E9RA 5DTQA 4YP0A 3WFZA 3AEUA 2H9AA 3ETDA 3T94A 2B0JA 1U99A 1T3TA 3AOGA 2H1RA 3CX7A 3LRPA 4I1VA 4D82A 2ZUBA 4BN4A 4W8OA 4E2XA 4HH0A 4XA8A 3D4LA 4ZAXA 4F3CA 1W7AA 2JLXA 3IAUA 1U3FA 3KLOA 3UJNA 2Z3WA 1BOOA 1XQ6A 2FWJA 2Q9AA 4Z0PA 2GBIA 2ABWA 2BGWA 4LC0A 4OLBA 2DUUA 1QHYA 5HIIA 2H4JA 4ND4A 2ISCA 3Q10A 5ANRB 2FQWA 4RK0A 1KIMA 2EKDA 2QWXA 4EEKA 2XWQA 5ECWA 4C1NA 4C9BA 1Z2DA 3EQ2A 4CBVA 1FF9A 2G6BA 1E1LA 2CLHB 1QIKA 2AMFA 2P1ZA 2Q7XA 1MU0A 1N3IA 4HYEA 2HHAA 4QD3A 4YAWA 3SIWA 5L6MB 2DFKB 2F9LA 2GARA 3MD0A 2HBRA 2OV2A 3FTDA 3PXUA 1NJGA 3ITNA 3OKAA 3ZEAA 1RWXA 2O19A 4B3FX 3N0XA 4HDMB 2OYCA 1XDWA 2ZRAA 2OLEA 3FPJA 4RD1A 1CR6A 5I7EA 1B6SA 4NEHB 5B53A 3VVMA 4ZMSA 3FZYA 3IUNA 1BD4A 4OQQA 5L8VA 4KGDA 2DF8A 3BQ9A 4ZYTA 1N6RA 4DR4B 3I61A 2ATIA 2Q9UA 4G3XA 4H0CA 4LK3A 1DMSA 4B80A 5F64A 1RKBA 1E4VA 1OYVA 4UDOA 3UYLA 4FZ5A 4WNAB 3QBTA 3K9CA 1LK0A 3O03A 4QBGB 3GQBA 3PVZA 5D87A 3M3DA 3X2EA 5TT0A 5C32A 1J07A 1VC2A 2YOFA 4X6UA 3SJCA 4F6RB 3CQ9A 2XWJI 5T7BA 2VDVE 3AW9A 4AXXA 5JFGA 2A35A 4JB0A 1NBME 1G2PA 2ZU0C 3BWYA 5K3CA 4A6XA 1DWUA 2IEZA 3C6YA 3IR5A 5CYPA 1P39A 1Q0HA 2GXSA 1ZUNB 4YCDA 2FMKA 1IVYA 5C5CA 1PCXA 3I12A 5EXTA 2JFOA 5G1OA 5EEGA 3DL4A 3LU1A 3BJIC 5CJPA 4EVSA 1FDRA 4KMOA 4UATA 1A2BA 3QPDA 1QUFA 1NOIA 3T5AA 3IE1A 2FFBA 3K71B 3QI2A 1NE2A 4ALNA 1KPGA 2OHIA 2GJ8A 3SQDA 1Z4LA 5FOWA 3RVKA 1RQGA 3ER9A 5BV7A 1LI4A 1C3LA 1CERA 3MS2A 1SUAA 1T6XA 3P26A 4G0MA 2QRKA 4JYCA 4V03A 1KBZA 3WC4A 1O97C 3UWSA 3E23A 1U5BB 4C0JA 3VR2D 1RVV1 2XCIA 3W6OA 5BXQC 5C46F 2QP4A 3GUCA 5FLYA 3WIUA 1KZ6A 2EWWA 3W4IA 3PTAA 1B6TA 1NM5A 2VTVA 4QUGA 3NBUA 3WGGA 4EGQA 1AKUA 1KO1A 4LF5B 2VP3A 3ESAA 4Q18A 1YVRA 2VJKA 1HZZA 1OKKA 2IC5A 1HK7A 4EYSA 1QGUB 2CHUA 4AKHA 4FFPA 2W6IA 4RZXA 5AVQA 4D6YA 3A6PC 3DZDA 4O4HB 2EOAA 2P78A 4MQ6A 2XUOA 4HDOB 4QODA 1JQ5A 3NJ8A 2W71A 1OJLA 1RR6A 4JITA 4CIDA 2JGDB 1ZWLA 1JHMA 2WT4A 2G0NA 2YJZA 1Y63A 5ELLA 2E89A 3Q9SA 1OBHA 4XR4A 1PI3A 3CZPA 5CEFA 1AN0A 1VLLA 1R0KA 1VSBA 2CNBA 4IFTA 4KQFA 4NBUA 3FOWA 1MG5A 2EP7A 1YBVA 4WNAA 2C54A 1II9A 2H92A 2V3WA 5EUQB 4F1WA 3L0SA 1NJ1A 3RVRA 3Q11A 5FIUA 3VNSA 5B3LA 1JQ3A 4MDEA 1U7OA 2B2XA 3JALA 1QMGA 1PJLA 4HTFA 2BPOA 2BI8A 1WBDA 4IMIB 2J9ZB 3UAWA 3MBKA 4P7KA 3JRWA 2FQXA 5DOZA 3N9IA 3GLHE 4NECA 5BSFA 5HUJA 4H1TA 2HEIA 2V6JA 3ZE8A 4TLAA 1Q3HA 3OQVA 2XCUA 1WF6A 1YOVB 3JWGA 2BF7A 1DJNA 4NL4H 3VPDA 4YK7A 4LXUA 1FUEA 3B9QA 2J9FB 1Z4OA 3I58A 4LOLA 1SC9A 4GSYA 3WXMA 2B69A 2I2XB 2WF7A 1U8ZA 3DOIA 5EIAA 3TRIA 2ZCJA 3HY4A 1WIWA 2NYRA 3D7KA 5LFAA 3A4IA 1CUWA 4Z54A 5B2FA 4CM3A 1TYCA 4U63A 1G59A 3BK2A 5IF9A 3R9XB 2XI4A 4IRMA 5D2CA 1M75A 2O6HA 4ZCIA 5LZ9A 3HGTA 4CEHA 2ZDHA 4MVJA 2O5VA 3QU5A 1Z3IX 4B0OA 5BSTA 3OA2A 1Y9DA 4G56A 1MXHA 3VI3B 3PPIA 2ZIEA 3P9XA 4LE2A 1C3VA 1M1NB 4DUYB 2FJPA 4TQUS 1I5RA 1YQTA 1LFDB 1N1EA 1FYWA 2JIPA 1X7GA 3LW7A 5IAJA 3ICWA 3TJMA 1ZAYA 3STVA 4OGWA 5EP3A 4ND1A 5ES3A 4TMTA 3ILVA 1F6WA 3A4TA 2PO5A 4W9NC 1CFJA 4C2BA 4IP0A 1K8XB 2JLQA 2BVNA 2Z6UA 4DYDA 3PDUA 1C7QA 4X45A 3DBRB 4ZYXA 3CNLA 3ZJUA 1YFZA 3AF3A 1GZ4A 3N39C 1KARA 3A9SA 2W2KA 1PR6A 1WP9A 5C31A 1PZHA 3CH7A 3TPCA 1PYGA 1IBKB 2F43B 3H1BA 4BQQA 3RVJA 1SU6A 3CNNA 2XUHA 1RFGE 4GECA 1P1JA 4QLAA 1QG4A 2OCDA 2XCLA 2EJVA 4ZTZB 4HN2A 1WMBA 3THOA 2YNMD 1UJCA 2C78A 2PMDA 1U28C 1PGPA 3JYOA 3QEMA 1ZA2A 4B5LA 3GEGA 5EIBC 1QIIA 2ANCA 4P33A 2RHGB 1EUYA 3HYSA 4FQ5A 2Q6IA 4XZ3A 4P3PA 1CY2A 2V9PA 4EY8A 5B6JA 3RODA 1H1DA 2WE7A 3E15A 3RVSA 1XRJA 4E1AA 3QU9A 4ODIA 4AY2A 1JIUA 3MS7A 2C9DA 3F6RA 3ZXIA 5ALLA 5K3FB 3LSYA 3SXJA 4AG6A 4BNVA 2GTIA 2WINI 4LJ7A 4ECAA 4F6CA 1UJBA 2BE7A 4FYMA 4XB2A 1C2TA 1R5NA 1E60A 4YRRA 2J3DA 3IUBA 4QPPA 1CUCA 4MQ5A 1W9HA 5FPYA 3VPGA 3T4EA 2R6GA 1P60A 1MEJA 2NV6A 3A6GA 4OV6B 4JT4A 1T4CB 2P6UA 3KDSE 2P2CA 1QIJA 2V0NA 1SUEA 3DJYA 1KEPA 1BD3A 1ZMRA 2ZM5A 1H8HA 1U65A 1UMBA 1Q6YA 4IIFA 1ZN9A 2PH3A 2DETA 1GZSA 3PFFA 3M6VA 1OR8A 3BK7A 3PNPA 3KAPA 1P6UA 4P5PA 1N75A 1TU0A 1V3TA 5ALXA 2WJHA 4A4DA 3NUGA 4YUXA 4JUIA 2IUSA 1WZUA 3TM5A 2QTVA 3S27A 1EGHA 1II0A 3KQMA 1P77A 3N3BC 1UXJA 3GGPA 3WOHA 3CIFA 1WQ3A 4KLAA 3MT0A 4P34A 1FTNA 1H3EA 3Q3EA 3RG2A 1UDCA 1Z82A 4LWOA 3WHLA 2JH8A 2OP1A 3GA5A 4KXVA 1W34A 4YRSA 3U61B 1MAUA 1CQIA 2GF0A 2Z9BA 5LXTF 4F3RA 5DKFA 4H0FA 2ENWA 4KBGA 1PR3A 2BH9A 2W98A 4UBKA 3SMVA 1XYYA 1XZLA 1A27A 3L49A 3RC2A 1JE1A 1CUXA 3H11B 1FNCA 3NRJA 5AW2A 4KQCA 4V0OA 2X5NA 4IIHA 5WRFA 1KJ9A 1T2EA 2HCRA 4JFRA 2C9YA 4RABA 1ZSNA 1VGVA 3VBCA 1CUDA 4GVPA 2JJ1A 1BS9A 1U0NA 2Z5FA 2CV1A 4Q4JB 4UUOA 3SY8A 1USWA 2I8LA 1HL3A 4KVZA 4V0ME 3R7NA 4B4WA 4EW3A 2DWQA 1XZ8A 1YR2A 1SVWA 3IP9A 2NPIA 4JJKA 3T7EA 2WZDA 3UKOA 1PT9A 1N9GA 2D0PB 2PR7A 4G4JA 1O9BA 2IU0A 5F3WB 2IZ5A 3K0KA 2QK4A 3KIPA 4XGQA 4UDYX 1QSGA 2AYZA 1S2NA 4FBGA 3SHTA 5TE9A 5EHZA 3H5TA 1TJ5A 2XHZA 4QXQA 1NF3A 2F2TA 2VJMA 1E0DA 1U4SA 3TMYA 1POWA 1W4RA 3ZZUA 4UC0A 1GNQA 2AOXA 4ZU6X 2RG7A 1YNOA 4R54A 3WL3A 4X6YA 4H1VA 2CDNA 1QOZA 5ITVA 1WUTA 3ZCUA 4PLHA 1P5ZB 4QVGA 4EO7A 1BXGA 3HZHA 4NEGA 2IYQA 1J9ZA 1XVAA 3CR8A 1PRYA 2LNDA 3OM1A 4ID3A 4L0DA 1RQLA 1L7NA 1RTKA 3IURA 2B78A 1PQUA 3KVYA 4MUIA 3HYRA 3U4GA 5JXGA 1YA8A 4NXNB 4W7IA 3M4ZA 4O8CA 1RWOA 1SH7A 1SHLA 2DQYA 3BGVA 5SYMA 3UHOA 3I3OA 3RIEA 4N7RA 3IV6A 4PIMA 2BUCA 1FZQA 2Y6UA 2P68A 2O8VA 4WN3A 3D64A 2H1SA 1EK1A 4IZHA 4N12A 4TYNA 2RDMA 4Q3NA 2PMFA 1YZUA 1Z7EA 1P17A 1EFVB 2GF2A 4JCOA 4POOA 4JI2B 1IPEA 1K7YA 1YK0A 1GO2A 5A3SA 4V1CI 1MRZA 3DO5A 4KZPA 5K6TA 4PO3X 2WTMA 3NBZC 5HBRA 1SD2A 3ERCA 1GILA 1M5RA 3OZRA 3H05A 3K1AB 4D8WA 3L2OB 3M3HA 4NFSA 4HH3C 5LDGA 4PONA 5CXQA 1K8ZB 3IJRA 4QL3A 2WM9B 3GRYA 4YRIA 3RRYA 5TJHA 4NMWA 3TQTA 3BWMA 4CCSA 5H59A 2FDCA 4PLGA 4GMXA 3GJ8A 2FY8A 1L4UA 3WGJA 3WYDA 4BTEA 3AQIA 4DR5B 2CJXA 2HLNA 2YDYA 2H2WA 4JI6B 2V5AA 2XX3A 2CXPA 1DXOA 5J4KA 2I87A 4LUCA 4YRDA 4RMIA 5IZ4A 5FPSA 5JDCC 4PPYA 3IIKA 1E1MA 1B14A 2F8SA 1W36B 4ZC1A 4L28A 4TXNA 1UP7A 3LVBA 1OB5A 4HVAA 2X14A 4L8LA 4LV5B 2Z2YA 3PHIA 4RPHA 3W1VA 2GEVA 2EHJA 3A7EA 4BNFA 3WLQA 3KUDA 5LVAA 2X8AA 5K0SA 3R74A 1XNHA 1DV2A 2C4WA 1AF4A 2JAWA 4DJ5X 3AVVA 1QHSA 5LDDC 4DC1A 2PWAA 1YGPA 4DDUA 3P20A 4MARA 2PM8A 4GOMD 1XELA 2VT6A 3WBFA 1AQIA 2IDMA 4K9DA 4JV5B 4JBGA 3E8XA 3C39A 4K28A 4ZAFA 3Q0EA 1HT0A 3VJKA 4EFNA 2D3TA 1Z0DA 2AOTA 5AHKA 2H2DA 1L4GA 2IY8A 3I37X 4J0JA 2C7PA 3FYTA 4YP5A 2I91A 5IAKA 3O82A 1T1JA 1ZP6A 3J81A 3PUYA 4CKXA 2DY1A 5BSUA 1H22A 2LP4Y 2R7KA 4LGCA 2OA0A 3RUHA 1TVKB 1SUCA 4IOKA 3BD8A 5JRDS 1JEEA 4JLMA 1DE0A 1RI5A 4ERXA 1X87A 4GEKA 4ZAGA 2WHXA 2C4HA 3QQ5A 1V3QE 4G9GA 3F1LA 4CR6A 2NQTA 4C0SA 1I2MA 1SBCA 1WDLA 3I0ZA 1RJGA 3IJ5A 2VZLA 3NEAA 1CZNA 4DA7A 4OFXA 2GVNA 4WCDA 5JEEA 1AIPA 5CT5A 2WTXA 4N01A 4QBTA 4J7AA 3WAGA 1XCOA 5BMVF 1OX6A 4ZD6A 3GJZA 3EVGA 4LDAA 4UNRA 5DF1A 4YN3A 3O9VA 4FSDA 2H1HA 1E1DA 2QM8A 2QR2A 3AETB 3QE0A 5LA6F 2B1JA 1OT3A 1PL6A 2CUNA 1DC6A 1QIGA 2DSNA 1TUBB 2GBCA 2IWRA 3RS2A 3UKJA 3PHGA 3V4VB 5G0UA 4ZZ1A 2H8KA 1JWAB 1U8FO 2BMAA 4G9EA 5HMLA 3WL5A 3BMNB 3P5SA 4C7JA 1XQYA 5CBPB 3VR4D 4FMCF 4CFYA 3B5EA 4HX5A 4D46A 3QV1A 1OU4A 4R1NA 1XEFA 4WY5A 2Q2OA 1ST2A 1WPQA 3A2LA 1JIIA 3BULA 3RLFA 3DGEC 4G89A 3GJRA 1UZUA 1R9NA 2J9XB 5AM0A 3I34X 3VDMA 3ROZA 2WZCA 3PIIA 1P1HA 1WJGA 1L7DA 3GFGA 4Q39A 4B3HA 1DPFA 4RM3A 1JKFA 2XUIA 2FA9A 2X76A 3CVWA 5DCUA 2P67A 3ZIDA 1AG9A 4OO3A 3UHJA 3VUEA 4NK4A 4ASUA 4P2BA 1P7YA 4JUCA 2ZZNA 1L3IA 1XZEA 3DWFA 3LF1A 4ZRNA 5BNFA 1K4YA 1UMKA 3D6AA 3CUTA 2ZIXA 4OTZA 1L4FA 1L4HA 2HJRA 2V6GA 3MCZA 2PVPA 3OLCX 1T9GS 1IY2A 3OC0A 3QF7A 2RJOA 1JQLB 2FN9A 4N3GA 3R5HA 1R0ZA 2XDWA 3OEYA 1IG0A 4CM1A 2EFHB 5E4YA 2ZKLA 3VJLA 1SQ6A 2Z6AA 1RPJA 1YUMA 4BNGA 3G0GA 3TLMA 4O5OA 4XIJA 1XGKA 2UYYA 3MK31 4Q1DA 5E6RB 2P0AA 3LTEA 3PPXA 5K9ZA 3LZDA 4Q9NA 3HDQA 3HKDB 3V00A 1GR0A 1WSBA 5H02A 2NUTA 3OF3A 2C1ZA 2ZS8A 3Q2KA 3QKIA 5JDIC 2FPUA 1C4XA 3MUNA 5AP9A 4NCNA 1JHYA 2N42A 4WERA 2AYYA 4N6OA 2BONA 4C2AA 1PJCA 1PWZA 2NM0A 3U7QB 4AURA 1WMSA 2ZPTX 2GJSA 1E9DA 1XCLA 2VF7A 4GR4A 4HLQB 5T67A 1RQNA 2EV9A 3QXJA 5LR6A 2DR2A 3MQ4A 3LUDA 2FPOA 2H29A 1B2LA 1F4LA 4DA8A 4ZKDA 4A6PA 3HKEA 4OGKA 4K0KB 3MWDA 4ZCLA 4Q00A 1AMUA 2BJVA 2BBTA 5KSYA 2ID7A 1RJWA 5LQSA 4YT8A 4LF9B 1V4NA 5AOVA 2QL5A 5DLQC 3TUIC 3GJ6A 4HWKA 2QLFA 4B45A 2SBTA 4Y2RA 4MEBA 3T9FA 3GVCA 1K7XB 2JLSA 5CEEA 1E96A 2J6BA 5I51A 3PWKA 1NX6A 4DLNA 5I47A 1BVHA 3R4CA 3B78A 3NT2A 3ZQJA 1RT9A 4C29A 1AURA 4RY2A 4XTCS 1MZPA 1NMZA 3HB5X 1J1IA 2HJGA 1KA9H 1GZUA 3JR3A 1KSFX 1OAAA 2C3UA 4KKVA 1G7SA 1ZK3A 4Z9FA 5LU9A 4CMBA 4CDRA 3U4IA 1DJPA 5D7NA 1VKZA 1VG1A 3QRWA 3TTSA 3OOHA 5KYVA 2IHNA 1UKZA 3NBAA 2GHRA 1DXYA 2IEAA 2Q4OA 3DVQX 4YXWA 3CINA 4DQVA 4CQLB 3G0IA 1FP7A 4PLPA 4V1CA 1G4AE 3ISVA 3R5SA 4XM2A 1DINA 2QUZA 4PG5A 1CR4A 3EYWA 4CGYA 2BD0A 1J5XA 2BUAA 4HNHA 4QAJA 1YVDA 5CFOA 3QKRB 3FVWA 4X7BA 1KAQA 1QH1B 2CY0A 3PE3A 3RAGA 1F17A 1SMKA 2BDEA 3L07A 4DDMA 5AICA 4BX8A 2X86A 1ZL2A 3SJAA 1G8KA 2JJMA 4LGYA 3ESQA 3Q8KA 1HFEL 2IDJA 3RUCA 5AH0A 2OZLB 2GAAA 3FWPA 3GFBA 1AMOA 2VYND 3BFJA 1WKBA 1Q0ZA 1PW5A 4FINA 4LYAA 1GSHA 1IOLA 3TTXA 1LX7A 4AO7A 1T3LA 2C5BA 3F5DA 4O33A 4JGBA 3RRFA 1MX1A 4KNYA 3F4LA 4AT1A 5K6AA 5T8KC 3UAOA 3UENA 1IJFA 2H06A 2ZTVA 2NW6A 4J0QA 3NQ41 1K0UA 4YRNA 5J58A 4CCYB 4WLVA 2I29A 4QOGA 3MRVA 2AMJA 2YY7A 5KNBD 3IVAA 1L3CA 3QG5A 1NDUA 3C3XA 4RO0A 5HM8A 2RKWA 4NE2A 3IAS1 5KSWB 2VYVD 3C3BA 1EK6A 1RZ3A 3PIRA 3HJNA 3QLVC 4GP6A 2WTAA 5KYWA 3VNVA 3MN1A 1AK2A 3G9TA 4TV8A 1FNNA 3ASZA 3MUFA 2AXQA 5A62A 2QE6A 2VNSA 5A9SB 4MP3A 1VE3A 2ZYDA 2DU8A 5AKLA 3TDMA 1NJ5A 2HJWA 5CMLA 4MQUA 2X22A 2FEOA 4L0QA 1EX1A 4PLCA 5DU2A 1QDUA 2R8XA 2FUEA 3IB6A 3TG2A 1NZDA 2FHSA 1KKMA 1P1BA 5ICFA 1G3MA 4DLVA 1LLDA 2OWDA 2YXBA 3L0YA 5CVCA 1JKJB 5HKKD 1VSUA 4LV6A 4X60A 3JR7A 2SKEA 2OMKA 2FG7C 1H3NA 1XALA 221PA 3HXMA 4Q7EA 2O8CA 4D9BA 1I51A 2IYLD 1QAOA 2ISQA 3T1VA 3CLSC 1FIUA 4D9KA 3U80A 3EA0A 1EGVB 1IG3A 1UMDA 4LJ9A 2Z30A 5T3UA 5JQGA 2H2FA 2IHVA 1XRRA 2A5DA 5AVOA 3ICEA 3VNBA 4YIKA 4F5WA 5L4LA 4KH1A 4J0GA 5BXYA 1IAVA 3ROMA 4GAEA 4XR9A 4OFWA 2WIJA 4KYUA 1IJEA 3NX4A 1NVVR 2VNJA 4KWHA 4HEHA 2XUKA 4G63A 3V7WA 1KYXA 5EXDA 4TOIA 1MORA 3OURA 4V0QA 2UZ0A 4UCXA 4JD5A 4M53A 1XL0A 2AEJA 3EXHC 4BNDB 1RIFA 1X7HA 2XDYA 4F46A 4K6MA 2UXCB 3AVOA 2O5RA 1KNXA 1XROA 1ZKMA 4U9UA 5BSRA 2BH2A 4AUKA 2HIGA 4HXEB 1US8B 3EXHA 4R3NA 1TK2A 5ENVA 3P5BA 1KDPA 3HUUA 4GZ3A 4HQFA 4HQLA 4KFRA 3UMJA 5H16A 4XFKA 1N7GA 3KPVA 4YROA 5B1DA 1DRKA 2NTNA 1Y4SA 3E2PA 3NOQA 3AR4A 3ZKWB 4QG7A 1E69A 2H2AA 3EXFA 4INOA 1J70A 4MRPA 3PF8A 5CB0A 2A84A 1I1HA 4E33A 4O29A 4B3IA 3D4IA 2WEKA 4RV9A 3UOGA 1ML4A 3PYMA 1EBBA 3ED5A 3BHNA 4OHOA 2BFCB 1G5FA 5KVSA 4TPKA 1A95A 1QB8A 3TQSA 3CF4G 3IRVA 3WYCA 2O50A 5JD6A 1OGJA 1T0PA 2Q8PA 5FQOA 4AAYA 4EY6A 1W73A 2HSGA 5LOVA 2DR0A 2P5SA 1MP0A 2AF3C 3DBLB 2C9CA 2DM6A 3GFTA 3TD9A 1Z74A 5FXMA 2XQJA 3QHPA 2CL7X 1O57A 1OZ0A 4PX5A 1O4WA 2I3BA 4MQEA 1W44A 4CPDA 2HWKA 1DOHA 4JGGA 3DBHA 4NV0A 2RGXA 3W2TA 1NNI1 1QRAA 3VNQA 3U13A 1TX4B 1YULA 3FNHA 3N59A 1KU0A 3M5DA 3WL6A 3DVAA 3E2IA 3I5YA 4ZV7A 2VHCA 3OM0A 3QJGA 3ZR4B 4HADA 2XEDA 3L4KA 3T0GA 3HUEA 2J0UA 4YGXB 3JQQA 3O4RA 1TKRA 2O4UX 2YJ3A 4BVHA 3QUAA 1R64A 2R8EA 4LZPA 4NLLA 4R7TA 1X0VA 2YN4A 4RTLA 3OQNA 2EX4A 3V1NA 3ZCQA 4EHNA 1NQOA 2NNLD 4ABYA 3AHIA 2UYOA 1H9AA 2EG9A 2V7PA 2ZSKA 4BQOA 1OF1A 4EHBA 4BZPA 2BMVA 1X1EA 2ZTLA 4B82A 1V5WA 2WMYA 4R81A 4F6RA 1V1MB 2NYVA 4JLOA 3FPFA 4FSXA 3ZDYB 5JAOA 1Q7RA 4DMKA 1OLUA 1EWVA 1B74A 4MXDA 2PKEA 1L4MA 1WXGA 2SKCA 4C21A 5BSHA 3RGWS 2ODAA 2WAAA 1KR2A 3CPHA 4ZT2A 4BWGA 4LF8B 3MOSA 3TNYA 1UPCA 3VU9A 4CLOA 4G1FA 3QHQA 4X20A 1FVXA 3TFWA 3FRJA 2QW1A 3SSNA 4EGFA 3UJHA 5HRUA 4NKRA 3EJWA 4MKHA 4L15A 3IMFA 4MW5A 3GZNA 1NN0A 1QDEA 3I5MA 3B8HA 3NHLA 4ZAYA 3FTCA 3Q0TA 1MF7A 4QOHA 3A6JA 5C7IO 1H6BA 3DCIA 5FV4A 2WD7A 3G59A 3M83A 1KP9A 1NLUA 1N0IA 2XNHA 4RV4A 1IUOA 3D7SA 4RTKA 3NYRA 2NO0A 2A3NA 4GZMA 3O90A 1L4EA 1E94E 2ZG6A 3R5KA 3WWOA 2JFUA 5AKEA 5F9MA 1N5MA 1ODFA 4E08A 4MRRA 2ZT7A 3JQAD 4LYHA 5DM2A 3UJAA 1TPYA 2LWIA 3CONA 2A59A 3PS9A 5A3VA 3D6TB 3DXYA 4I4IA 4R6XA 1WZIA 1ECFA 4DF3A 3AR3A 5ITZB 4NMXB 5HMMA 3UGQA 1OLSB 4BAZA 4DXDA 2J3JA 3ZZ1A 3KB8A 2VDJA 4ADSG 2C99A 1M5TA 5I9TA 4BVAA 1T43A 5IYZF 5JSZB 2G70A 1I2DA 4LCEA 4Z86A 1YHYA 5JECA 1S0UA 3IV7A 4I55A 1XBTA 2D2VA 4V0MA 3RC3A 3WTBA 4QEDA 1YO6A 4XUEA 4Y6LA 1UWLA 3EF1A 4HO1X 1KI8A 5K3FA 4KQWA 3ZBQA 5H3HA 3EB9A 4KHPB 4XRGA 4LYDA 1A9XA 4S1VA 2DOKA 1YUBA 5JCXA 5E38A 1UPTA 2BP7B 4YJFA 2DPYA 4BL5A 4PYNA 1P3Y1 2QN2A 3UWDA 1GGHA 1JECA 1KZGB 1L7AA 5AK6A 4DR6B 4GI3A 4RH3A 3ZVKA 1DCFA 1OASA 1TDJA 4Q93A 4Z9YA 1WHSB 4K6FA 4ZO4A 2H5IA 1NULA 1MA3A 3U62A 3U9LA 1IATA 4PTLA 4NPCA 3ZWVA 1EFHA 3LBYA 4NAUA 1BMFA 3F6BX 4F56A 2W2KB 3U9TA 4E1BA 4C6TA 3OHPA 4ENVA 5C9ZA 1NMQA 1T8UA 2D13A 3HJAA 5EZSA 3FYUB 4G0YA 1EJ6A 2EWMA 2JKZA 1CZUA 1PFKA 1TZKA 1YU6A 3IT2A 3O1HB 3G79A 3NO4A 1GY8A 3PXCX 2JVKA 2XQVA 5EE9A 4YASA 4DR1B 1KDOA 4TV8B 4PYKA 1P44A 1MABA 2QN9A 2VIIA 1UFOA 3QBJA 4PNZA 5FD8A 3RU7A 3QE9Y 3M6XA 4DEVA 4GUDA 4L8WB 4IVNA 1TQHA 1M1ZA 3RFCA 2ADOA 5GIPE 4LMPA 1JZSA 3H2YA 3KL2A 1ECPA 2QSUA 4MMZB 3WNCA 1U7PA 3DYIA 2C04A 3CB2A 3OECA 3RW9A 4C14A 4MX8A 3NGXA 3E3NA 2NSJA 3PYXA 2R4QA 3R7BA 3I2KA 3HLYA 2BHRA 3AEUB 4B6RA 3RUFA 1QH0A 1PTJA 3GRVA 5EZ6B 1XPRA 3RT9A 3MQ2A 3Q9NA 1JWBB 4AKSA 4FGZA 1E3DA 3MTAA 1UFVA 1HLPA 3E82A 4LWQA 5E6UA 3THRA 1VPLA 1EDOA 4TTTS 2Q50A 3HL0A 2FNAA 4NV3A 1KZYC 2VF2A 4LDRA 4JQSA 1DIGA 5H68A 5A4MS 3N28A 2BHTA 4LJKA 1LXCA 5EQDA 5U4XA 3TFQA 4EFLA 2I55A 2WVJA 3BJZA 1Z45A 4RQBA 1M66A 3L3BA 1Q15A 3VC2A 1UBHS 4PNHA 2M9MA 4LKRA 4J3NA 4JI0B 1JVNA 3A3PA 4AK9A 4O4JB 1HT2E 4J03A 3PJGA 5I6DA 1C80A 2BWJA 2X0KA 1PLLA 1TJ4A 4HDQB 1CQZA 3PQFA 4IS3A 4WI1A 1EUDB 2VOJA 1KEKA 2CFRA 3L8CA 3BMQB 1DQYA 3FHLA 4N39A 3NHKA 1ENYA 1KMMA 1YA4A 4I36A 4HLUC 4CDMA 3EG9B 3D54D 4GLLA 4XOUA 4LOKA 3JQ8A 4KFCA 1WULS 1EJ0A 4KCGA 1LTKA 1ZNWA 2FK8A 1DOZA 2IXFA 3GN2A 3HN2A 3U0VA 1D7OA 3B7GA 3EF0A 3RT7A 4DVJA 3DDCA 5BR7A 5IH7A 1FU7A 2NO9A 3H5AA 1F3LA 2H07A 4Y2VA 2WFAA 1YD7A 1X8LA 4WH0A 4L8FA 5AVSA 1P9WA 4RYDA 3H65A 5G2OA 3L4EA 2FTKE 4QA9A 3SEQA 3BJMA 3UVEA 1A50B 1QFSA 4DLYA 4XOIA 3CPSA 3V55A 5EUCA 4EJ6A 1S6YA 4H7KA 3ZYCA 2AEFA 2BW0A 3NPAA 3GLHB 1JEOA 3H42B 2GQ0A 3DLAA 2QRHA 1IRIA 1VL1A 2OB1A 3R7LA 4UBOA 5K7SA 3FHTA 3EARA 1UUFA 5E7MA 3Q1KA 5NLLA 4BCCA 4DQKA 4C7BA 4D8YA 2JFQA 1BOFA 3AO0B 3F5SA 1EX7A 3FJ1A 4IIYA 3T1YB 4B9EA 5HPYB 3A9TA 1L9XA 4ZA2A 2QG4A 3PEEA 5DGXA 1CLEA 1ZISA 1JTFA 4EKGA 1NX9A 3FUWA 4UUQA 1R0YA 4QRHA 1SVIA 2ZK7A 1W5SA 3LHIA 5FBZA 1FRNA 4RKQA 2ZIUB 1OYYA 3MCUA 3QJ5A 5T41A 3A37A 4EI9A 5BV8A 1Y6RA 4LQCA 3SC2B 4MI9A 4ZIRA 2A1TR 5JMTA 1ZUIA 3ZWXA 4ZVRA 4HYQA 3A4VA 4NS1A 2BEUA 3OWXA 2KB0A 4KV9A 5E3JA 1VP3A 1KYWA 2PLNA 3MMPA 3PXEA 1X7YB 4J7UA 5DVZA 4NP6A 5KNCA 3K9NA 1JDSA 2NXWA 2RGNC 2XNJA 4GLBA 4NU0A 3NH6A 1ISPA 4XLLA 1L5SA 1D2HA 1SXIA 2VYQA 4BJ6A 4ZI7F 1G16A 3Q3CA 2C5SA 1ZIOA 3LUKA 4BNLA 3B9PA 3DG9A 3ZJTA 3MJRA 4CEJB 4DA6A 2JW5A 3B51X 4H1HA 5KBYA 4EABA 4IO1A 4CMJA 1STOA 3DEYX 4GP7A 4PSAA 2HTFA 1YZYA 2VPPA 4O4HA 3FGNA 5H1YA 2HN9A 1GNTA 2D4AA 2JJYA 4HQ6A 4I19A 5T4EA 3ZHQA 2CB0A 1V7ZA 5DBIA 4EPTA 2AI3A 4DCJA 4I1OA 4Z3KA 4JAVC 1ACLA 2AS0A 4AZTA 3U56A 2MYPA 2GCEA 4II7A 4EI7A 4WEOA 3KU1A 3EVBA 2GK4A 4X5OA 3WDMA 1NVUQ 4C2TA 2GZ1A 5KYWB 4YJHA 1NVWQ 2R7LA 3G5LA 2QJFA 3G9UA 3JPWA 4BB6A 1Z4JA 3IKMB 1OH8A 1M1NA 5I5GA 1TEHA 5T6MA 2FFJA 2MWMA 1GITA 2YJ6A 1YS6A 3LUGA 4QQFA 2EFDB 4OB6A 1HC7A 2NU6A 2WU8A 4WCVA 4KQGA 2OCXA 4M7PA 4WESA 3UOAB 3HCOA 1DNPA 3JQPA 4UHJA 3MLBA 2CVFA 4H7EA 1ZH6A 2XPCA 3Q7IA 1XNJA 1ZD8A 1T0IA 2XR1A 2ZWMA 4MWEA 5ALDA 4Z1MA 1L5KA 4I0WB 4A5SA 1V0JA 1FTGA 3ZE7A 1G20A 4RC9A 3G2NA 3WWYA 1E7YA 3OPMA 2H08A 3PFCA 1J2EA 1LDBA 3WGZA 4LF6B 4ZN6A 2CNLA 1WUIS 2IYZA 2GI4A 4HGZA 3H7IA 4QGFA 2F48A 3PC2A 3W78A 5LSAA 1UC8A 2P9HA 3K70C 5IKPA 2GEUA 3GRRA 3TTTA 3R6DA 4M3NA 9GPBA 4RHUA 1TGVA 3OM9A 2P2NA 4H3KB 1BG6A 2H3EA 1JDVA 1MRSA 3QYPA 4Y1FA 1M7BA 4BNYA 2OGUA 1R9GA 3DB1A 5H8WA 1SVLA 1K27A 3K6SB 2XXJA 4J1TA 5ALMA 3BWXA 3OSUA 3GXOA 3PLNA 4GYKA 1C3XA 4XEUA 4MVJF 3O8BA 2OBNA 4HLCA 5AK5A 3VGJA 1CKEA 1QP8A 1P8AA 2CXOA 3VR3D 4UTRA 4JXZA 1K1EA 2DBYA 2CDCA 3KUCA 2XZLA 4HVCA 3K4QA 3O4VA 3SE0A 5ITSA 3GWGA 2FFRA 1UXKA 1KJYA 3D2CA 2RHRA 3LP8A 2F3TA 1HQYE 2UUPA 1RQPA 1Z4IA 1IIRA 4FCWA 4LQDA 1YS2X 1CTQA 1ILWA 1FPMA 1SQSA 2AWNA 1Q1EA 3NT5A 2VTBB 1O5IA 3QNUA 3RIMA 2ZB7A 2YR0A 4U2CA 4UE3S 3DLTA 4WRRA 5B1SA 4RZHA 5KYXB 1W1UA 5AM1A 4LFBB 1F2VA 2ZI4A 1GUBA 1SC1A 5EQTA 5CLJA 1EWTA 1S89A 3L1UA 3DYVA 2WPDA 2DECA 3D7RA 1W85A 5AUOB 1Z2CA 5B7PA 1P0FA 1KDTA 3NM5A 5EXEA 1HE3A 1V4VA 1E3SA 1I1OA 2F8MA 5I9MA 4FMDB 1GZ5A 3NC4A 3ORHA 4F2HA 3G85A 4BO0A 4QPCA 1K6MA 4P4LA 2HH9A 2PS3A 2P6RA 2A5JA 2VK8A 4NF2A 4PX3A 4FEYA 5F52A 1M8PA 4Z9BA 1H2XA 1B42A 1Q0RA 1UZAA 4Q4AB 4B6PA 3DFIA 3G6KA 1Q1ZA 5KTOA 4DVGA 2X8WA 2JJ2A 2ONJA 5IXSA 3QIVA 2FEAA 1GV0A 1MXFA 3KZVA 3OCXA 3LGXA 4MI6A 4QREA 5JD3A 3I2IA 2C7RA 3PGVA 4S1WA 2JJ8A 4DV2B 4GKAA 1XTVA 4GPAA 4QDTA 5I8WA 1SOWA 2DFTA 2QVBA 1OXSC 5L3SB 3NDBB 3M4XA 4MUAA 3K94A 5HNKA 1K7EB 1QH9A 1VMIA 2ONYA 2GCIA 2ZIFA 2R7MA 5AI8A 1DBPA 3S6JA 2A92A 2VP6A 4WUTA 1NP6A 3H2JA 3IA2A 1LS6A 5K0GA 2PIAA 3PG5A 1WBBA 5KNCD 5IZCA 2I03A 3TX6A 1NI5A 4XIIA 4RVOA 4WWHA 2HDNB 2J48A 2GOYA 3E9RA 1FEZA 4ZYLA 3LX8A 4LRUA 5LNK6 3DTYA 4RSMA 2C5EA 3PIDA 4RH1A 2CBGA 2B6NA 4DDHA 5K0BA 4OQYA 2OKCA 5EJAA 4E5KA 3ADCA 1OBOA 4D3FA 1N9GB 5A9TA 2P9ZA 4H17A 3V1TC 2H1FA 2X42A 3DB2A 3O8OA 3VHQA 2DFVA 1RYZA 1EFPB 2NV2B 4XB6B 2Z6VA 1Z73A 4D99A 1VB5A 1XZQA 2D4HA 3LPNA 4LTNA 4RBNA 4Y6QA 4CUKA 2D1FA 4L0CA 4PTZA 1PNRA 1P1RA 1N2GA 4IJWA 1GCOA 4WKOA 4O3MA 1ONPA 2GEKA 4CLHA 1CHDA 5C51B 1H0SA 3ESCA 2H85A 3RS7A 2HQ1A 3PVSA 4LZAA 2OCPA 3EIXA 3OT5A 5LJLA 1XK7A 2D8AA 3AGPA 5DISB 2BN4A 2HRDA 2WFMA 3A4YA 1UM8A 1IK6A 2W2PA 1GTZA 1K5HA 1V1RB 4G26A 5CX1B 5KVQA 4GG1A 4CV2A 2XOKA 2B5OA 3M3PA 4TL8A 4FOTA 1TLFA 4J7CA 2O8EB 5G4KB 2I54A 4E70A 4EK9A 1W5EA 2R60A 4JL5A 4W63A 1U0BB 2PGXA 2XMZA 3ELBA 4MRNA 1U80A 3PKIA 4ICIA 3DULA 1DFIA 1NQUA 4KR0A 3F5QA 5IH3A 4S1PA 5TB5A 4ZDKA 3MWFA 4ZYWA 4KMSA 3G9ZA 1J20A 5B3AA 1NKSA 1VBKA 1U2RA 3ZLJA 5EP4A 2HQRA 1BXKA 3D59A 3N74A 3EGWA 4TUYF 4U6NA 1GL3A 1J21A 2J3MA 4OOEA 1CJVC 1UZLA 4URHA 1VKRA 5AW9A 4Q05A 1FSGA 4ENUA 2MMCA 4QYTA 2IUUA 1ZH8A 4KO1S 4EHJA 1C1HA 4OQXA 4OJYA 3Q1LA 3BB4A 5EL0A 1QHFA 2OL4A 1YE8A 1U2DC 3C3DA 3DOCA 3I30X 3K2EA 5DI3A 3VPSA 4DRXA 5LQCA 3QE3A 2ZAMA 4Q16A 1MUUA 4K9KA 1ISGA 1ZIYA 1XZBA 4QPDA 3FTNA 3BHJA 4Z1MD 2AN5A 5CK4A 1YQGA 2QW8A 2YWDA 3HI6A 3RSZA 1B41A 4PYJA 2CJFA 2B6HA 2JJ1D 2XTZA 4PPGA 5BN4B 2J0EA 2PUBA 1GLGA 2PZMA 2ZYUX 4ETMA 1T4CA 5E95A 3WO1A 4ZC8A 2A5LA 4YDSA 1ZK4A 3ZGZA 3OU2A 2AFRA 1RS0A 4MH0R 3QVXA 2JHPA 2V3VA 1NW4A 1SHKA 5JSKA 3RUIA 4F5DA 3FTPA 4FHZA 1EGAA 2OHGA 1KSJA 2OKGA 4IXTA 2P69A 3QEAZ 1JXOA 3ETHA 1E7SA 2VP9A 4G0NA 1S8NA 3F5MA 2TMDA 3SQMA 3DL2A 4DTIA 3I62A 2ZBUA 4L85A 1NUUA 1P0PA 3G7NA 1QIMA 1TYDE 1OWNA 1AGYA 2NQ8A 2ZSBA 3L0ZA 2QZPA 1CY8A 3H2SA 3HDJA 3M7IA 4E5UA 2QRQA 5EHIA 2CL0X 3INYA 4PLVA 4U02A 1UH5A 3R44A 2CV2A 3TVDA 1N2OA 3CF4A 2V7GA 2IZ0A 1UWKA 1AE1A 4JKYA 1D1PA 3HSYA 1G1MA 3C7DB 4MS4A 4PE5B 2E5WA 4RPIA 2ZRPA 3LLSA 2UU9B 5F33A 3UFXB 1BXRA 4ZVTA 3LGAA 1FRFS 1LRKA 1DKLA 3Q7RA 4FDLA 4FGUA 4OJKA 4PINA 4ZICA 5BVGA 3PT5A 5JRZA 1B8PA 3CJTA 1QTIA 2JFPA 4LNAA 2V0CA 3TK1A 1WXWA 4MVJD 1HZZC 1ZI8A 5DI3B 1RCFA 1S8FA 2PUWA 2XYRA 1KSHA 4Z9AA 2A5GA 4I4TB 4EJFA 3DH0A 2CEKA 3PQ2A 5COBA 5JMOA 4IGAA 1NMEA 1NM5C 3C1OA 2PGAA 3SD7A 4LCBA 2H5JA 2PKQP 1UDXA 2JGDA 4JOCA 2R65A 3BMOA 4UNSA 5EXSA 5E0OA 1SZCA 4QWWA 5BQXA 1YB2A 4BC1A 3WLFA 3WKAA 1GL7A 3JD4A 4Y9SA 3BGWA 4M98A 3TG8A 3FVRA 1TC2A 1G4UR 5D3ZA 3NHSA 1B8OA 1FS5A 2AG6A 2SCUB 4WFKA 3M9LA 4UEOA 1G55A 3FPBA 3G5MA 1JHRA 1H1TA 3GBVA 4Y1GA 4BIIA 1QFXA 3QW4B 1QFZA 1LPBB 2AJDA 4M0CA 1D4FA 2ZSFA 1PX0A 4Q4DA 1T1RA 3RO7A 4IQGA 3PGXA 2D2XA 4B2LA 3NOXA 2V7BA 2QXYA 4D0LB 1W76A 5KKCA 2IPXA 1BMQA 4YFYA 2FHPA 5INTA 4Z3OA 3HA2A 3WHIA 4KE7A 3PTLA 5IC6A 1EM8B 3RIYA 2C4MA 2OBXA 3B85A 1UOPA 4KMRA 3VPFA 4GL2A 1BQEA 4JJIA 2ZRHA 3GCGA 1JKIA 2C3MA 4ER5A 3SZ3A 3ZCPA 1PV4A 3RCBA 5LUAA 1YKGA 2WZQA 4R8LA 1ZR2A 3ZYZA 5F78A 3W2HA 2VXOA 4CL3A 5K0EA 2FFAA 2VZ9A 2XB9A 3I6YA 3MILA 4B43A 4G4GA 1NNSA 1GCGA 1WSDA 1OLXB 3TRKA 3VZBA 4B7UA 1YL7A 1DCKA 1ZW1A 3O4FA 3ZQ4A 2P9YA 5K4GA 1BXRB 3WLEA 4FGWA 4RGYA 4X6LA 3CH6A 4MWOA 4QQRA 2C4VA 5EJGA 4UZSA 1R50A 3DHEA 3KOXA 4KP7A 4TX1A 5HIJA 4DY6A 1ZGHA 4J9UE 3O3OB 3IIEA 1VG8A 3CEJA 2OCGA 3EXHB 3LRTA 4IQFA 3B5JA 2WSMA 4JQZA 1O9GA 4URZR 4GD3Q 1KAMA 2J85A 3DEIA 3LT2A 4K5QA 5EIHA 5FR1A 7MDHA 4ZMBA 1KPIA 1SCAA 1XTBA 2XLBA 1BE8A 5E2AA 3AJDA 4I99A 5GJWC 4MOWA 4HF7A 2J5RA 2QZ9A 4J1NA 2EP5A 4J1QA 3MGCA 1UJ2A 3M70A 4RDXA 1N2BA 3A1EA 3VZRA 1FQWA 2UZ4A 1Y4DE 4AX8A 4ZHSA 2J08A 1E3WA 4FYKA 5LA6B 4AUNA 1PNQA 3U4CA 3RREA 3KQNA 4OGFA 3AEQB 3DZFA 4HZUA 4JBYA 2V7WA 3IVMA 1RMQA 3KQVA 2CZGA 5DGCA 1CUEA 3UMVA 5J2UA 2WUFA 1R27A 4TWIA 5DHSA 1TQ6A 1XN4A 3FN4A 3ZD8A 1KI2A 3HU1A 1EWQA 2V9CA 1TOAA 3CSUA 3KKNA 1XUOA 3N6VA 2E4AA 2IBTA 4DZZA 3OOWA 3HXKA 1I30A 1Y6JA 4FCCA 1RCUA 3LCMA 5J1TB 4OVKA 3UQYS 1HQCA 3AEZA 4D3DA 3TUJC 2F1KA 3FLMA 1UPAA 3ZWBA 1GR1A 4HQKA 1AVTA 1Q14A 3GJXC 4NAHA 4YV0A 4V24A 3KT3A 2WA2A 4JI8B 3T3EA 1YQ9A 2JHGA 1ULZA 2BMFA 2XGOA 2ZJOA 2VQSA 5T64A 3T3DA 1AS0A 2FPKA 1H66A 1QVRA 2FUNB 2DWUA 3AVQA 4O8ZA 2GRUA 2DUWA 1WNTA 4FC7A 4RCYA 3MB8A 3BWCA 3ETGA 1U3TA 2YZGA 4H3HB 2W0MA 1L7EA 3DMTA 4TLLB 5CM2Z 3V4PB 1R0LA 1Z75A 1ZA1A 4E4TA 3U3ZA 4KX5A 4G24A 1S2MA 4MWDA 3MGBA 4RNDB 4GT1A 4CV3A 5DASA 1EFAA 3N2KB 1DB3A 4KKXB 3D6HA 4GWGA 3IMGA 2GZ3A 4ZQHA 1EK5A 3L7KA 2I6TA 1J2YA 1R4MA 4LXIA 4IHQA 2WIGA 4FD2A 3B36A 1BHQ1 1EVEA 2E4VA 1Y7HA 2ZROA 3PWZA 4FMCB 4RA6A 5EEHA 2Q2WA 5P8WA 2WU3A 5K01A 1JQJC 4YQZA 2PUEA 3SICE 5K0FA 1RRGA 2WTUA 3SFVA 4TVSA 3LJKA 2VT2A 3L6RA 1BWPA 2JFBA 5EHGA 4ER6A 1H4VB 3OSZA 5SY4A 5KNBA 1HTBA 2QMHA 3L79A 1J0XO 2ADMA 2FP4B 3WNQA 3M82A 3OIVA 3IOMA 4EI8A 5BW6B 4XLZA 1H9BA 3EA4A 1OH6A 2ZT8A 2EVWX 1LCIA 2O2JA 2ZQ5A 5JH7B 5LIRA 4BEJA 3T5PA 1PV2A 3RUDA 5C80A 1DAGA 1RJ9A 2XGGA 3DZCA 4FXPA 3S40A 4F7WA 1T5OA 3DTVD 3EXG1 1C9DB 1TTQB 5IWCA 1V37A 3TMKA 3TUZC 2ZJZA 5FPQA 4RTOA 3AM1A 3BPSA 4UPEA 2CHGA 3QA3E 3TVTA 4FHDA 3R2JA 4UTVA 4M0LA 4YUWA 1T35A 5IU6A 4FWTA 2JGIA 1PKXA 2Y71A 1YDEA 3FGOA 4DZTA 4Z4GA 3UHPA 1K9SA 4GLFA 4DLUA 4FGSA 5HIMA 3P1JA 1K68A 2OCBA 1JDJA 4I9GA 4QOJA 4RZSA 1SBQA 2Y27A 3GJSA 5CT4A 3PHJA 4YLGA 521PA 3BG5A 3FLBA 4C1BA 1W75A 4I50B 5DW0A 5CA0F 2MSEB 2PFGA 1LDNA 1R4ZA 4I5EA 4ZDIA 3OX1A 3W7VA 5HILA 1PX2A 3BWBA 1VIVA 2O0HA 4H0NA 4O59O 3ZHBA 1K5GA 4KQJA 3E0XA 4S1NA 2CGEA 1WR8A 2JAHA 5DULA 1JSCA 3S68A 4CU5A 3CIOA 4BQEA 2HSJA 3B1FA 4HSEA 4JT2A 2WF9A 2QMOA 1GAQA 1O6FA 1ZKDA 2GZ2A 5IMSA 3R5XA 2ZIZA 2RKBA 1UOEA 1XTPA 2NUBA 3OE5A 5FV7A 4BVKA 5J1SB 1T2NA 1LVGA 1V6AA 1DUIA 1HDGO 3JASB 3JQAB 1VMEA 2GAFA 3C6ZA 3F46A 4U7GA 2X2EA 3JQDA 3V6MA 3ZCXA 4LK2A 3RRJA 2MR5A 3OQJA 3PWSA 2FWNA 4XCXA 3TLEA 5EE1A 1R66A 3CZ4A 1Z0ZA 2BLNA 1QG6A 3SQNA 1YB4A 2I78A 2P6OA 3DT9A 3KQWA 2G04A 5BR4A 3K1JA 3QQPA 3VO1A 5KNDA 1UT8A 5F12A 1EK0A 3JS5A 2ZKIA 3LQ2A 3KKPA 4D9JA 5AXCA 4UM9D 2CMDA 3GLQA 3B1WA 3MMNA 3PZRA 4FDMA 4A3SA 4C05A 2KX7A 3GYBA 1PQ4A 4RHTA 3UIEA 4A8TA 3IBTA 3IKLA 1XYGA 1YQUA 5KX5B 4YCSA 1XLTC 2Y0EA 3NGLA 1RXIA 5G02A 1OYWA 4N3BA 2ATVA 1V71A 3A14A 5HKAA 4IILA 1FVHA 5JRJA 1N8SA 2DJ5A 1SG9A 1VIDA 4IIEA 3BB3A 3HBNA 5JAIA 5BURA 2C7VA 4HX9A 2XT6A 3GP5A 4PO1A 4B76A 2MU1A 3W5VA 3X1JA 3IPAA 3HBMA 3VC1A 4L72A 1DQZA 4PZ0A 4QDZA 2ONZA 3NVMB 5B6IA 3UMRA 4F4IA 1G6HA 1OI3A 1SULA 4UD2A 5KQPA 3X1XA 4AQDA 1IJBA 1I80A 1E2UA 4ED9A 3QU2A 4CE6A 1M6EX 3LA8A 4RGVA 1F8YA 1GKKA 1SHZA 1VHLA 2NACA 2WU1A 3LPMA 4ONEA 2I7DA 3FSJX 5DYNA 5LZ7A 2AN3A 4YCNA 1AXGA 1E9VA 5FAKA 3HC7A 4JX8A 1RRMA 1XD2A 3PQ7A 4LVNA 4MUMA 4YJ2F 5EOVA 1KFBB 5C4IA 3L5OA 1CUZA 1HT3A 1TZ2A 2Q07A 2RMKA 5AKZA 1ZM9A 3C7TA 3UC5A 1VCIA 4X91A 4LTMA 2VKQA 2NQ2C 4KUEA 5JSHA 4HXGA 4PRZA 4MVJE 3R0ZA 3AC0A 1RCTE 1F0PA 3A7DA 5BPFA 2OC9A 5A0VA 2YKGA 1ISIA 1M6NA 1RAGA 4J0IA 4KWCA 4RFSB 3ABZA 4Y2SA 2OK7A 1H5QA 3GLTA 4EYGA 3GLFA 3DBOB 1L8QA 1TCBA 3G2LA 3PI7A 4OMUA 3OU7A 2MCFA 3AESA 1ODJA 5AKHA 3UW1A 4OHPA 2O52A 4DBVO 5K5EA 3DZIA 4M8SA 1KJWA 4NZOA 3HU5A 3MJSA 2QYOA 3R75A 5BRJA 4C07A 3EVDA 1KOGA 3TCXB 3O2JA 1TB4A 3RK1A 4DIUA 1VLMA 1UT6A 1KJIA 5HF8A 2Y76A 3VR4H 4ZT3A 4DV1B 3CLUC 1T5TA 3LUPA 2P0YA 3QM1A 4DPLA 2E1PA 1TUBA 3P4UA 1D09A 5DHPA 1J7KA 2RH5A 2YYSA 3AETA 5AVJA 1CJMA 3NTXA 1E9FA 2FW9A 5B12A 2NSLA 2OFWA 3AYZB 4J4BA 1U94A 4BZZA 2ZZMA 3REOA 4NHEA 1P72A 1K2WA 3A0RB 1JE0A 1SQ0A 3N5KA 4N0MA 4E5DA 3I8XA 3ON5A 1DEHA 4IOJA 1Z8NA 4A8HA 2IYPA 3UANA 4M2LA 2VO1A 4RF3A 1IY9A 3TBFA 3HABA 3QEMB 4OIFA 5HS4A 5LMUB 1G21B 3CFYA 5E7QA 3FDIA 3KZMA 3TLJA 3RKUA 1PEYA 4K46A 1AA6A 5TC4A 1JL3A 5EZ5A 4H18A 4BNKA 4GBED 4WA7A 2H1IA 1V8PA 1X80B 1CUAA 1E7WA 1NXXA 3HJHA 4CKEA 5DNCA 4KU4A 1Y3FE 1VGRA 1W581 3TNLA 5CVJA 1NR1A 4CN9A 4G1EB 3QKSB 1C0LA 4NYIQ 4IWXA 3HPQA 5I9SA 3R7DA 4XGKA 2P41A 1I3LA 1XZAA 5DLPA 1K5PA 3HG7A 3HGMA 3VSEA 1MO4A 1DQNA 1E1YA 4NZ9A 1WB5A 3OE4A 1UMCB 5D01A 3ASUA 5REQB 3W5CA 2ZUFA 3ENKA 2FW7A 1K97A 3WHPA 1KYTA 5IF3A 3MB5A 3TXYA 4ZVQA 1ESEA 4HQRA 2VT7A 4Q4AA 5TIIA 3BHIA 2WM3A 3KOZA 2OBLA 3VU0A 1Y1KE 3EN0A 1CJBA 1CSEE 3JAWA 3FKSA 3NMUF 1Q0SA 2ZSEA 3PNMA 3IQEA 3PNVA 3R3XA 2PX2A 3QKUA 2H63A 5KDOA 1KYZA 2WUGA 2WF6A 4B48A 3MFQA 4NCHA 1GQRA 2WKWA 3O31A 4FUTA 2AEMA 5FBHA 3FSEA 2HPHA 5TMDA 3K6RA 4ESEA 1P6QA 3DKRA 5JS2A 4GSLA 2ZI6A 2A88A 1KDVA 4UDNA 5E9AA 4MSUA 2QVLA 3IQZA 1SUSA 3T9CA 2ZWVA 4A8JA 4ZI2A 3B1YA 2EZ4A 2HC9A 1I0ZA 4GWKA 1A82A 2BC9A 3U7EB 2QTZA 4I08A 2XBMA 1VJ1A 4GQAA 1B4DA 2H4XA 3B82A 3VKHA 3H9JA 4OAOA 3LV8A 3STWA 5JTTA 5HOEA 3P2OA 1VYHA 3E7PA 1U1EA 3W9UA 3F6CA 3PITA 4AYXA 4DV7B 1S1MA 2HU5A 3CZRA 3VU8A 2D5CA 3SEAA 1KP3A 5EA2A 4QC2A 4NWIA 2P35A 2G1PA 1HGXA 2WAMA 2V65A 5EPEA 1DUSA 3B2QA 3B2EA 3HB0A 3N0WA 2HA0A 5JZOA 2BGGA 2O3UA 1TW2A 1ORWA 2CD7A 2C7BA 2WD9A 3D6VA 5BMVA 2Y1FA 5BSGA 1NMSA 2VUTA 4LJAA 4AECA 3DDHA 4GOND 3RC8A 1VSQA 5IXYA 4NIMA 1XMQB 4QYSA 1DKNA 1P7ZA 1TVMA 3A26A 5FWAA 1QTQA 1MJHA 3EGIA 3FDZB 4RVGA 4TXLA 3R9WA 3P0JA 5FORA 5CA0A 5CLHA 2I76A 5BR8B 2H59A 3OKCA 1RWPA 1V96A 4FSHA 1Y4ZA 4ECEA 4GLJA 1I4WA 3UK0A 2R79A 1UXHA 1ZN7A 1NXSA 2GYYA 1ONSA 2ZQYA 3AXTA 1HDOA 4I14A 4N0DA 4NYMQ 2BKUA 1DEAA 3OMWA 3WRVA 4NSNA 4HC4A 2IYWA 1G3QA 2BZ1A 2W6PA 2J3HA 1MX5A 1K7SN 2B25A 1WEKA 2QTNA 1OXVA 1R37A 1Y9AA 2IYSA 2OV6A 3IMCA 2OQVA 3VYUB 3NV9A 1YJ5A 2E49A 3TR5A 1O6GA 3UT5B 1MQAA 3MCWA 1DRJA 3K0CA 2VHJA 4G23A 2JGKA 2X9GA 1T6BY 1Z17A 4KC0A 5HEKA 1XA0A 4TUYA 1VE9A 2CXSA 2ERYA 3DJFA 4A26A 4FZRA 3U16A 4YAIA 1ZMOA 2BIFA 3JZFA 2L18A 3I0MA 4MA5A 5KNBH 3FVVA 1HFWA 2A9FA 3DWEX 5ARCA 1M6VA 2Z98A 3S3TA 1WXQA 2QAJA 4ZFNA 3TZQA 4F2PA 5K8TA 2WMNB 4HUQA 3RGGA 4XCQA 1QO0D 1EVQA 3E9QA 2P3OA 3HJCA 1E61A 3UTDA 1QDLB 5JSQA 4INJA 3WBBA 1JG4A 3MINB 2F59A 4MPRA 2C8LA 3V2UA 4BFUA 1H05A 4I1UA 1LQUA 3A6DA 3L8MA 3WJAA 1F38A 3MTDA 4PAOA 2ERXA 1JLSA 2HPZA 1WHTB 2ESRA 2XF8A 1XLWA 4ZQCB 1UK6A 3QMMA 2H1VA 2C3YA 2RHBA 3DPSA 4DJAA 1UPXA 3NJ4A 4HEJA 3F3SA 4C6HA 3D9QX 4MI1A 1I7LA 4JQYA 3E53A 1GGKA 4O5AA 2HA3A 4DWVA 3OD1A 4R1QA 1OZGA 1P31A 4XJXA 3UCFA 3VH3A 4KG7A 2FUG1 3AERB 4FKZA 2WYHA 1DEOA 2FKAA 1JS1X 1X70A 2CE2X 2CNNA 2OO5C 2Q5OA 1CULC 1G1AA 4J16C 1OV6A 4NCIA 5AM5A 2RBGA 4CMAA 1E1QD 1ORVA 1EFTA 1V5FA 2P6PA 3NV7A 1W52X 1WCIB 1YACA 4OI1A 2Z3VA 2VHZA 1JBQA 4IWNA 2NZWA 4A23A 4I55B 2PO7A 2HWUA 4KLZA 4LSZA 4NZZA 1GP2A 5JXWA 4J07A 4X3PA 2XTNA 3WLTA 4GKKB 1YVUA 2QDKA 3SDZA 4D9GA 4OI0A 3ANMA 3C1AA 4AZ3A 2QBYB 3FTFA 5D00A 4HV4A 1I9CA 5E6SA 1RWWA 1UWVA 4YJFB 1OFTA 3AUTA 3NTQA 4QUEA 5ALNA 3DNFA 2G71A 3STTA 1S7CA 4ZJUA 3I6QA 2BGJA 3S5JA 3WFJA 5CDSA 4KGZA 3ROGA 1TO2E 5AI9A 1N9ZA 3OOSA 1L3BA 3D6JA 1ILEA 1H85A 1VG9B 3PXDA 4RF5A 3VKUA 2VF4X 1PK9A 5GZ6A 2Q27A 2ISSD 1YSCA 3AQ4A 3MRXA 4G1UC 4TN5A 2R4TA 1ID8A 2YVLA 4M55A 1DG9A 1QIDA 1FRZA 1PJ2A 3UJDA 2ACEA 5FI1B 4AZVA 3L0CA 2WUEA 2FI1A 3ZLBA 2ZRDA 1FP4A 2NT3A 3COVA 5PNTA 6ABPA 3ZGYA 1W88