2PUWA

The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
352
structure length
340
Chain Sequence
PYKHFMQKEIFEQPDSAFNTMRGRIDFENCVVTLGGLKSWLSTIRRCRRIIMIACGTSYHSCLATRSIFEELTEIPVSVELASDFLDRRSPVFRDDTCVFVSQSGETADSILALQYCLERGALTVGIVNSVGSSMSRQTHCGVHINAGPEIGVASTKAYTSQYIALVMFALSLSNDSISRKGRHEEIIKGLQKIPEQIKQVLKLENKIKDLCNSSQKSLLLLGRGYQFATALEGALKIKEISYMHSEGVLAGELEDLPIIAFATRDSLFPKVMSAIEQVTARDGRPIVICNEGDAIISNDKVHTTLEVPETVDCLQGLLNVIPLQLISYWLAVNRGIDVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords isomerase domain of glutamine-fructose-6-phosphate transamin
publication title The Crystal and Solution Studies of Glucosamine-6-phosphate Synthase from Candida albicans
pubmed doi rcsb
source organism Candida albicans
molecule tags Transferase
total genus 120
structure length 340
sequence length 352
chains with identical sequence B
ec nomenclature ec 2.6.1.16: Glutamine--fructose-6-phosphate transaminase (isomerizing).
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01380 SIS SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2puwA01
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2puwA02
4YY3B 4JI6B 4B3MB 4DV0B 4AQYB 2XHZA 2E5FA 5BY2A 2WU8A 4DV3B 4JI4B 2DECA 3QKIA 3TRJA 3Q88A 4DV5B 2ZJ3A 3HJBA 3KNZA 5LL6P 4YHHB 3PR3A 1C7RA 1HR0B 4X65B 2UXDB 2CXOA 4OX9B 1HOXA 3BJZA 1VI5A 1J5XA 1VIVA 3T1HB 1GZDA 2DF8A 4JI2B 1Q50A 3FF1A 3LJKA 3G68A 1IBLB 1NRIA 1X9IA 5I01A 1XNQB 5IT9A 1HNWB 3NBUA 2UXCB 1ZZGA 4JI5B 1G98A 1X9HA 5IWAB 1M3SA 3BCHA 4DR1B 3OOJA 1IATA 2CVPA 1IBKB 4DUZB 2F4VB 2CB0A 3CVJA 2UU9B 2O2DA 2VQFB 1KOJA 1WIWA 1J5EB 1HM5A 4JV5B 2PUVA 3FXAA 4LF7B 1MORA 1NUHA 2PUWA 1JEOA 3J7AC 2ZJ4A 4U6NA 1MOQA 4B3SB 3M5PA 4B3RB 2UUBB 1N33B 4DV4B 1JXAA 3EUAA 1U0FA 4LF9B 4DV6B 5LMNB 4DV7B 1VI6A 1IBMB 4JI0B 1X92A 2UXBB 4IVNA 4LFBB 3OTOB 4DV1B 3ETNA 1GZVA 3J81A 1TZCA 2XBLA 3JX9A 5LMUB 4JI7B 4GKJB 1HNZB 1HNXB 2CXQA 2ZM6B 1JLHA 3JAMA 4S1WA 5A2QA 4GKKB 1MOSA 4JI8B 4DR2B 4DV2B 4LF8B 1I94B 5FLXA 2VQEB 4S12A 2E5LB 2CXNA 1N36B 3T1YB 1IRIA 2PUTA 4EM6A 4X66B 4DR3B 4B3TB 1U0EA 1TZBA 4NXNB 4DR5B 4LF4B 2AMLA 2POCA 3IFSA 5BR8B 2VF4X 4AMVA 1TK9A 4M0DA 1N8TA 2UUCB 2Q8NA 2A3NA 3ODPA 2CXSA 1C7QA 4NXMB 2CXRA 4LZJA 3J80A 2CXTA 1FJGB 3FKJA 2VF5X 3SHOA 4K0KB 4DR6B 2J6HA 3I0ZA 3TBFA 4TOIA 2CXPA 2HHHB 4DR7B 2I22A 3C3JA 4KHPB 1JIQA 4LFCB 1DQRA 2CXUA 3UJHA 3FJ1A 4DUYB 1XMOB 2I2WA 1XMQB 1N34B 1N32B 2O2CA 1XTBA 4JYAB 4JI1B 1XNRB 1X94A 2X3YA 4LFAB 3Q7IA 1T10A 1VIMA 2PGIA 3HBAA 1U0GA 4LF5B 4LF6B 4JI3B 2YVAA 4DR4B 1B0ZA 4X62B 2UUAB 2V4MA 4X64B
chains in the Genus database with same CATH superfamily
5COQA 1NQXA 5HKBA 2CUKA 5EIXA 2DETA 2IFTA 5CH8A 3RHZA 2OBBA 5ADHA 5JCOA 3MWLA 3UMVA 4E08A 3SD7A 3BL8A 3ADCA 1MDFA 3FUXA 3SEAA 4PSAA 1N2EA 2DBZA 3NUZA 3C3AA 5IT5A 1J4AA 3OM1A 2WE8A 3VR6H 2M1XA 1A98A 2VHCA 3OOSA 1P1FA 4KYVA 4M89A 1K7FB 1QF7A 5DGDA 3S1SA 1VJGA 1DDOA 4R1QA 2NSLA 2YR0A 4B6EA 3QOWA 2DQZA 3JYHA 4NECA 2MCFA 2IK8A 1G38A 2QYTA 1KIFA 2ZJYA 3C87A 3NHLA 4GLBA 2Z8YM 4LJ5A 3V4VB 4CLHA 1QMPA 4X6LA 3AZOA 1UFOA 4V02A 4E33A 3B38A 2XD9A 3HJUA 5LD2C 4J1SA 3NBUA 4LSZA 1ZITA 1K7CA 2C5BA 3O90A 4D46A 1F7VA 1XWWA 4FFSA 3UMRA 1F14A 4BO7A 3AMVA 4WEQA 4GI7A 1GGFA 1A50B 3QQPA 4IEIA 3PT5A 3CVJA 1YGPA 3DLCA 1BJKA 4ARAA 4BOYA 5SY6A 3G2MA 2DUJA 3DT8A 4K1XA 3ZUPA 4JLNA 3I53A 4TKMA 4MW9A 4B76A 1JMKC 4CM1A 1HORA 4OQFA 1WVMA 2PYIA 3RT1A 3O0DA 1DAEA 1K4YA 2H18A 2Q6TA 4J16C 4QHYA 4CMIA 1ZXBA 4C89A 4DLUA 4C7VA 5EHZA 1G9XA 1T5IA 3TSAA 3SYNA 2DBQA 2W6IA 3A1DA 3CLUC 2QB5A 4XD7A 3AZPA 5DEOA 2Z6UA 4GXNA 3NHRA 5CGZA 1A69A 2X5OA 4TV8A 3SJAA 5YASA 5L4LA 3TXXA 3LXXA 2EVWX 4FONA 3PNOA 1ZQ9A 4NYJR 1Z8HA 4PAMA 1QNLA 1EJ2A 4XUDA 2HK7A 3DBLA 3SZRA 1GU7A 2BOVA 4AF6A 2RG1A 1VGRA 5H80A 3HCCA 3HH8A 3JX9A 5HS6A 1V3TA 1DRKA 3QLJA 1W30A 3P45A 4B3DA 1F17A 1XVIA 2H2AA 1C81A 4XRRA 3IBCA 3UENA 4MXDA 4WOBA 3HWSA 1WRBA 3DLAA 1WETA 1LTQA 3LUKA 3OCWA 3P9CA 5A2QA 4ARZB 2O8EA 3LOUA 3GMSA 4JROA 3ZX5A 3M70A 1RKBA 4YJGA 1GR0A 5H9WA 3SDZA 1IRIA 1QIJA 2AUNA 2CCJA 2AIRA 1VI2A 3GJRA 3I9MA 2ZYSA 2R7KA 3GLQA 3LWBA 2CYBA 3F2VA 3M1LA 4RUKA 1Y7PA 4LYDA 4EMBA 1TF7A 4KTVE 5KWIA 1KJIA 3R7AA 1K8RA 4UAVA 4Z0TA 3OSUA 2IYPA 2Z43A 2OQVA 3WRYC 3VNVA 4C1BA 4DE5A 1E2BA 2CK3A 3INTA 1IZ8A 2RFLA 5B1SA 2I6QA 1IN6A 5L4NA 2YRFA 2P9TA 4LG1A 2XEDA 1S8FA 5FBHA 3UUEA 2IF2A 3HLKA 3Q85A 2VHUA 1F06A 3MQ4A 1E4EB 4PRLA 2YYSA 1L0BA 1Q14A 1RMTA 1E9DA 2OSBA 3IR7A 5A6VA 1QG4A 4TMTA 1OB2A 1L4MA 2VYFA 1WBJB 4U5QA 1XKLA 1XMVA 5KNCH 1KEKA 3UA3A 3X1XA 1ZVQA 1O94D 2QX9A 1T9GS 1EGHA 4FXOA 4DARA 4E5NA 1PV1A 2C9YA 4YRBA 1LNSA 2QMYA 3IPCA 3NYRA 4D9EA 4IJ6A 1DPFA 2CSXA 1NSYA 2FPPA 4MP6A 4W63A 3EXG2 3Q1LA 4H3HB 1M7GA 5DX0A 1WMBA 3UYKA 3DNMA 3K30A 4M55A 4EJSB 4HI0E 2J3DA 4PG4A 1L7NA 4JT4A 3GGPA 3AIMA 4BECA 5FBKA 3JD1A 4Y2RA 1KDOA 2A0FA 5CMLA 1YH3A 4YQZA 4RFSB 2WZBA 2FSFA 3AP1A 4X1YB 1PP4A 1B1AA 2LD4A 2QN6A 3GJ3A 2W71A 4RTOA 1BO6A 3BH7A 3KR9A 4MW6A 2WVAA 3ASVA 4MR8A 5LOVB 1OV6A 1SBIA 2FSGA 1E1DA 2ISQA 3ZTTA 4TM8A 4XIGS 1OX4B 3BIOA 4E2WA 2ZRKA 4IFEA 1Y42X 4G1BA 5H3CA 3VHRA 1OH5A 1PFUA 4P54A 1E7MA 4DUGD 3OX1A 5KJ6A 2PUGA 4LJRA 3Q40A 4QBHA 3RQSA 2UDPA 5KTRA 4NENB 3NYIA 4EHAA 2XXAB 3LTNC 3Q8LA 1S5PA 4ZFNA 1MEEA 1ZD8A 1K7EB 4XFJA 2H7CA 2H4XA 1YK0A 5AW6A 4C1NA 4JLBA 4JVLA 4XDHA 3Q0TA 3FN4A 3H2YA 2JJ8A 4KH1A 4B09A 1WW3A 4M1TA 3A0UA 1WUYA 1SD1A 2EGUA 1OILA 2AE2A 5AR1A 2ILVA 4OJQA 3AVTA 4AZ0A 3BRWD 3CF4A 3NTXA 4I55F 1NBIA 1USGA 3VOSA 4C0JA 4DVGA 5E7IA 2OUKA 1BTOA 2ZT6A 2VDQB 3PCTA 4LC0A 4MVJF 4MH0R 1U0RA 2ORWA 3BAZA 2EKZA 3GLTA 4YO8A 4QHSA 3ETGA 2OFOA 3JWGA 1XJCA 4GLFA 1WZ2A 4K6HA 4Y18A 3F1LA 2ABWA 4ZMBA 3ANMA 2QTMA 4TTIA 4Q21A 1HDEA 3DEZA 3BREA 2E4VA 2ZETA 3OC6A 3PIRA 1FLNA 5EJIA 4QXOA 4EHIA 1FJ2A 3GMIA 4ZCTA 2NM0A 1E0KA 2DQYA 4WHMA 1A7KA 1TL7C 3SQOA 4I5IA 3SU8A 3GLFB 3ETEA 4XGQA 2NO6A 3KKEA 1GITA 2BFFB 2X6TA 3KKZA 2NU7A 2ZRGA 4TYMA 4BMNA 4L8LA 1UWCA 1MP0A 3E22A 3NPMA 1J2EA 4M46A 3BXPA 2PUTA 4D5EA 2YS6A 2QEQA 4MV4A 4GR4A 4BUCA 1IC6A 2WU3A 3H4VA 4CLRB 3PKJA 3RDPA 1UKAA 1XPUA 2F1JA 3A6JA 3TZKA 3A7EA 3W4KA 3Q9UA 2L18A 4EUEA 2JLYA 4FMPA 5U9CA 2Q8QA 4XM0A 3C1UA 3OCZA 1LJ8A 3AKCA 4X3OA 3KYCB 2P6NA 2J46A 3CA8A 2JA1A 3IHKA 1N25A 2TECE 1OXUA 3OZEA 1FUUA 3DNPA 5DWQA 1NXWA 1O96B 3AFHA 2QTVB 5LIPA 3FTEA 3OQIA 4PVDA 3FDIA 4ZK6A 2FUG6 3AOEC 2CEKA 2BDTA 4YRSA 4RKEA 3BPSA 1LJUA 3EGIA 3M6AA 4DBLE 3VR4D 2WQ7A 1SCBA 4EB6B 3FGNA 4BNGA 4PYRA 3FDZA 5CK5A 2ZUSA 4FI3F 4DMCA 4MOWA 2GD6A 1J8QA 2VJQA 1J21A 2HMVA 3EFEA 4ZXPA 1N2CB 1NMSA 3DB1A 4FWBA 4NZNA 1CZHA 2A14A 2WPDD 4MWGA 5LKAA 3SVLA 3D2CA 1E63A 3M6LA 4OB6A 2Q3DA 4ZANA 3UFXA 1QIDA 4OHZA 1QYRA 2OGSA 3PE4A 1JSRA 3TNDA 4B4DA 3AF4A 1L4LA 3NNDA 3R9XA 4YQYA 4G4SO 1GDDA 1H66A 5C53B 1E6UA 4MMYB 1R66A 2GKOA 5L7YA 1Y5NA 3NV7A 2V97A 2VCYA 5EAIA 3EQZA 1GV0A 2QRZA 1E6KA 3ZQ6A 4WASA 1ZO8A 3DPIA 3N1UA 4EEZA 5G0UA 4TPKA 2RGUA 4F71A 4N8EA 1WP4A 4FBGA 3JYOA 4IDHA 3ZZTA 1MEJA 2ZJ6A 1TEZA 1DOAA 2AR7A 2RGBA 2Z3VA 1AGRA 4BMSA 5JC1A 4RCVA 4WLVA 2L0XA 2C4MA 5HW0A 4TX1A 3OLZA 3FHCB 3WZLA 1MJHA 4AZVA 4Y1RB 1FFAA 5IULC 2R8PA 2PX8A 3L7YA 1J2TA 1TQ2A 2A94A 1UOEA 4L2IA 2CNBA 4LYFA 5GZ3A 1RJ9A 1Z73A 2UUPA 4QUDA 1MQ9A 4Q7EA 3DJYA 4IP0A 3A6ZA 3IUNA 3K20A 4JQZA 2VZ0A 4QXMA 1L5ZA 5FLEX 1QF6A 4PQEA 2VPXA 4J7AA 3C3DA 2PUVA 2VAXA 2VN8A 4D80A 1QS0B 1Y1SA 2VG8A 1LD3A 4DIUA 1GTZA 1XMPA 3CW2A 2H4YA 1PUJA 1N5OX 3E3AA 4M2LA 4YRFA 3DZFA 4U1RA 1P0IA 1QMGA 3CZCA 1QHHB 4Y9UA 3O9MA 2UYYA 2R8OA 5FYDA 4N18A 2G1KA 4K26A 4HTFB 3KQPA 4HVTA 4HMPA 4K6MA 5FI5A 1RRVA 5K0CA 1F8GA 2RSLA 4XB1A 2AMVA 2ZB3A 4P3PA 4JP5A 5ELXA 1B2LA 5ALTA 4D41A 4CQNA 2I6TA 4BCCA 3OQMA 1NOIA 1CVRA 2GTHA 2XRYA 4HR7A 4N0MA 2Y76A 3PX3A 2DUMA 3MOSA 4J7XA 5DI3B 4M6WB 2QZ9A 2A9VA 4ZHQB 1IK4A 1Y8RB 3CJTA 3FHJA 2X9NA 5LNK1 4PO1A 3GJXC 2CUNA 6CHYA 3FTNA 3OA2A 4TQ9A 4IJWA 4TGLA 4FBLA 1GDTA 3F8WA 1RZVA 1E4OA 1WX1A 2GR9A 3KKQA 3NIFB 3DZDA 4K6KA 4NMMA 2JW5A 3E18A 5JMPA 4ZMRA 1DIOB 4BJHB 2CJXA 3ZGYA 1IN1A 4UHCA 3BMNB 2F59A 3V3TA 3VZPA 2O9JA 4J9UE 3ZIDA 3IT0A 2B30A 1LUAA 3INGA 1GXSB 2VF4X 4MCAA 1LTKA 3NBZC 4AMVA 3B3AA 3PC3A 1SCKA 1MMFB 4YS6A 1KZ6A 1DEOA 1W1UA 2FVYA 4LAFA 5LBUA 2FFHA 4FR2A 4AWXA 1GNTA 3N5CA 5ADUS 1GAXA 1KQOA 1LPSA 1DCTA 1VLJA 2JAWA 4CM4B 1E1MA 4EFMA 4Q66C 6ABPA 2AWNA 3WGVA 2LGJA 1CC1S 1T6NA 3OUTA 2D2IA 3KHTA 2HIHA 5K3FA 2V74B 3QVGB 2QRKA 5BV0A 3UAXA 3ZI4A 5KNBH 4RPCA 4XARA 5GAJA 4BNDB 4ZCMA 2BBOA 4JJ6A 5JOQA 3HPQA 1KQFA 2HSEA 4OATA 4DWJA 2F9FA 3BJMA 1UINA 3LVQE 3W2EA 4AKTA 1GDHA 2GUGA 3G7UA 3NFRA 5K3OA 2RGRA 1TCUA 4U7HA 4R8MA 5DRTA 2ID7A 1B76A 3CLRD 3DA8A 1SBZA 3HJHA 3HV2A 4HUQB 1KJZA 5FL7D 2GBFA 4EO9A 3H5AA 4HQLA 2YJ5A 4TL6A 3EHEA 2BGNA 3OM8A 4N7MA 2HRDA 4N5HX 2QTFA 3WNVA 4PZ9A 5LDDC 4DMRA 1EQUA 3MT9A 2ZIXB 1LI4A 1DJQA 2A58A 4OBEA 1JSZA 2VSOA 3KP1A 1WJGA 4J4HA 5JD4A 2ATXA 2RGNC 3GFPA 4HHEA 4HB4A 2ZPUA 3L8ZA 3OLYA 4F2DA 1I1QB 2QTNA 4RZUA 5J5AA 1RHJA 5T57A 4KXLA 1EFUA 1XRJA 4B4KA 4Y1GA 4OMCA 5IBPA 3VPGA 4E88A 1VFPA 1L7XA 3HY3A 3LF1A 4RABA 1D2AA 4YT5A 4B3HA 1YL7A 4CHTA 9MHTA 4AKIA 1GZDA 4TXNA 1R4MB 4CQLA 1XDWA 1B41A 2EZ4A 1U8UA 2AWOA 3NTQA 4N9WA 4AUNA 2IDMA 1VRVA 3IBFA 4C06A 5A5FA 5IKMA 4DSAA 1CQJA 2O7VA 3JQ9A 1W6RA 3B2EA 4ECAA 5B1YA 1NRJB 1CPYA 1VBKA 2X0JA 1U8TA 3AO0B 4UTVA 1U0LA 3CZ9A 3HKCB 3TLGB 4MKZA 1Z2PX 3U19A 3PRYA 1OWOA 2NAFA 2YFHA 1QBKC 2CWDA 5BN3B 2MR5A 3O8CA 1DG9A 3DMNA 1WUJS 3LQ2A 3R3UA 2FMXA 4B85A 3PX7A 3K7EA 1KJNA 1RYHA 1WXGA 2I6UA 4XX1A 3I73A 5B3JC 5K0FA 3BD8A 4J1NA 4B0PA 5JT1A 4O08A 2W42A 5E4TA 3VJMA 2DLNA 2F8MA 1JG6A 2ONCA 2A0KA 3MINA 3OZAA 4ME6A 4MJ3A 4NICA 2PNFA 4PIMA 4YMIA 5AHOA 4EGJA 4NBUA 5CB4B 1VXOA 4JEUA 1BQEA 5K4AA 3JQ6A 3TZHA 3H4MA 4DUPA 1RI3A 4LRTB 5HDQA 4COOA 5K01A 2OBFA 5IVPA 5T5QA 1ZJ4A 1LBSA 2H11A 5EN4A 3U4CA 3DLHA 1JQAA 2G4LA 3HCRA 4YCAA 3RVDA 4MQLA 1W36C 4V1CB 3OQJA 4KXMA 1F60A 3QEJA 1CP3A 1FVFA 4KRFA 4LDZA 3T7KA 4OBBA 3WK9A 5KNDH 3GD5A 1Z6QA 2L42A 3BGVA 3F47A 4INOA 2O1SA 2VHTA 4BP9A 5J4LA 5JJKA 4XIFA 3FPFA 1ZM3A 2CSUA 4GX0A 5AJZA 5I4IA 1B73A 1XZGA 2V65A 1STOA 2EW8A 3L7DA 2NSYA 3AUTA 3FZEA 4YRLA 1CRQA 5DHQA 3GLIA 1XTUA 3B6IA 3M9WA 2XGOA 1S7GA 3URKA 1AK1A 2NU8B 4BQEA 1QH8B 1T4DA 5FDFA 2NTYC 2PCLA 3ANLA 3G49A 3OPMA 4L5JA 2CXTA 5DGIA 4J07A 1QE5A 1VCIA 2GZ3A 2PYZA 1E2HA 2NZ2A 4LRUA 3RUDA 4EQ6B 1PS0A 2A2ZA 1M9NA 4LRXA 1YDGA 2C95A 3ZVLA 1GPLA 1LRKA 2WINI 4V0OA 1MG0A 3IXMA 4F85A 3DE6X 2Q4DA 2XMCA 1XMOB 2B82A 2HA0A 1E4VA 1U2TA 4HADA 5DKFA 2HLPA 4N3NA 4P38A 4CV1A 3I9LA 4I4TB 3K15A 2XLCA 1RQGA 2GXUA 2VDPB 1YZUA 2D5LA 2Y1LA 2ZG6A 3K9BA 1E2IA 1TM5E 2A9JA 3THXB 2G25A 4FDVA 4JJ8A 5HRCA 4CLXA 1KWGA 3FETA 5K3EA 2ISSD 4HO1X 1BC5A 4PRZA 4UUNA 2PSEA 4YTEA 3WLKX 3IUYA 2H2GA 2XSZD 3JZIA 3KPWA 2AN1A 2H2WA 3W04A 3D64A 3WHIA 1H9CA 5JY1A 1SBQA 1NOKA 3HJBA 1YNOA 1C4OA 1Y9EA 4LJAA 2C3YA 2VK2A 5AVJA 1SKAA 1MX5A 1UBUS 2ZJZA 1D7AA 3RO7A 1LVUA 1C3VA 2RDMA 4ZVKA 3MUOA 4EG3A 5LIRA 3RRFA 1HOXA 5BSMA 5D1HA 4DG5A 1HXHA 4KSBA 3IT3A 1RZRD 3B9QA 3CB4A 1WPRA 2QD1A 3O1JC 3AETA 4U63A 4BX2A 3RAFC 2BW0A 4DMKA 2OSVA 4OLBA 1Y48E 2F3UA 4NESA 2H9YA 5TNXA 4OGLA 2Z30A 4YJ3F 1CDEA 1HG0A 1NONA 1SUWA 3BRCA 3IR6A 2IBSA 5CW1A 1FDOA 3SVTA 2GAAA 2ZEJA 4QUAA 1H8EA 3E7WA 4TWZA 3TTTA 2ANBA 5JNSA 2VJBA 1NJ8A 1U9IA 4UZEA 2PJUA 1TNDA 3KB6A 4MROA 4UU1A 1OYVA 1Z75A 5JSQA 1PV4A 1J2RA 2FNAA 3AUFA 3CF2A 3ZDBA 2CLFB 2IQ5A 3IAEA 8AT1A 1TU0A 1TX4B 2PKRA 4RBNA 5K8CA 2H0RA 2A1TR 3GDOA 3IMGA 3QP9A 4AXXA 3K1TA 3MMNA 3GG9A 5IJ9B 1N2CE 1TECE 2GPAA 1KMNA 3CVUA 4LDRA 4BUZA 1JSLA 1M2WA 1U1GA 3HHEA 3ILXA 4DYDA 3Q41A 1NW5A 3HI4A 1J2JA 3LPNA 1UJCA 3ZDQA 4DC9A 5I7WA 4D42A 1ZWLA 1AKEA 1YI1A 2AJTA 1D5WA 2B6HA 3AH8A 1B7GO 3CGWA 3IEKA 5IABA 1UBJS 1Z74A 2RHDA 3EXFB 1UQUA 2CXQA 4DCOA 1IEVA 2X8AA 4JWKA 4LEIA 1E5TA 1L2TA 5FQOA 1ZOSA 1YMQA 2OYRA 2WJZB 3BK7A 2AMFA 3BC1A 3R1IA 2VJAA 3VYRB 3CRZA 4QTZA 1ZRSA 2JL1A 4NL4H 4R8RA 5FADA 3WLOA 3TK1A 3I45A 1SULA 4BCBA 3FCAA 2A35A 2QVZX 3E05A 3KAKA 2WMYA 1ZIOA 3MUNA 4KU4A 4N1AA 5L45A 3DE3X 2O8FB 1FNNA 2WILA 4JC0A 2F43A 2B4TO 3BTUA 5TMDA 3A1TA 3SF0A 4JLUA 4GPIB 3OPYB 3EUWA 3QNWA 2PPVA 4QAQA 4J43A 5HGXA 4X44A 3O73A 1YGYA 2PZ8A 4I4IA 2QM7A 1UAYA 2GX6A 3OE4A 4NZ9A 3PUHA 1Q1BA 5DCUA 3SXUA 3SHFA 1KJWA 2YMQA 1EIZA 3VAYA 1DV2A 2WA1A 3CR7A 4DV2B 4I55B 4EABA 1YVPA 4U2EA 2FYTA 1KHTA 1II8B 2YVKA 3A6KA 3W3AD 4W5RA 1OWLA 1MPTA 2CLDX 2HSJA 3D7LA 5KWVA 1M0WA 3CCBA 3MTDA 3WLEA 3UTCA 1EFKA 4Y2SA 3DKRA 3QTTA 1IWBB 2R5NA 3ZNNA 1OX5A 1Z6TA 2BSXA 2QV7A 1TJNA 2ZJBA 4JUDX 2V96A 4M1ZA 1QSGA 2AJLI 1GN9A 2J5KA 1PG2A 3GZ4A 1ZHFA 1USWA 1VLMA 3I28A 4OQEA 1UK9A 2QN1A 1JDSA 5GINE 2B1RA 1G3MA 3IRUA 5LA6B 4CNQA 2YTZA 3TOXA 5K9ZA 4L76A 1BWRA 4PCLA 3UUWA 4ZZ0A 5A5GA 1Z47A 3F6RA 1E1QD 3KEFA 5JV5A 3EEOA 5AXDA 2XOKA 2H1RA 3OCUA 2XKAA 5C5IA 5LQNA 1U2ZA 5EL0A 3AUJB 2GEUA 1Z29A 2BFEA 4BNZA 3ND8A 3Q6NA 1QRTA 3IOBA 1JI0A 3H1TA 2VHZA 1YCFA 5BYKA 5CDHA 3T3NA 1T3TA 3QE9Y 3KQLA 5AK4A 1U3FA 1NBME 1VKNA 1YUBA 4WCVA 4U7TB 5JZMA 1W4RA 1ZUD1 2FCRA 3OZCA 2OE2A 1NKSA 4HDRA 4DDMA 4F1WA 3DXFA 4QL3A 3IUBA 2G09A 3S3TA 1T3SA 3S68A 1UODA 2QAGB 4KKXB 3CRW1 2OCIA 4I1PA 2XXBA 1SIWA 4RIHA 4AJHA 2G9NA 2XY4A 3M9XA 2ODTX 2CV2A 4WKPA 2WT8A 4JOCA 1MG5A 5TJHA 3MXOA 3PNMA 4QUKA 1E1LA 1Z06A 4HPJB 4L57A 1FXWF 2F2TA 2IYLD 2J48A 3ICQB 2P9BA 3NKFA 4X8MA 3AR2A 3PC6A 2X1LA 3LT5A 3O9ZA 2BLLA 3GCDA 2XT0A 3VPFA 1T2DA 3PXDA 1NNEA 2ZB2A 3UXYA 1U7DA 1GADO 1GPAA 4UHDA 5M04A 3FBTA 2GD2A 1L7QA 3BMQB 2YMLA 4UE6A 3M4ZA 1ABEA 3CEAA 3UV3A 4BFXA 3V48A 3QV2A 1QGYA 2XKBA 4FOSA 3DM5A 4J4TA 4PSDA 5C1DA 2NUAB 1KL7A 3OETA 5AICA 2C5EA 4R9SA 4TTPA 1BDMA 1W6UA 2JBHA 2OBNA 1X13A 4A8JB 3U6BA 1M67A 5FNVF 3RYHB 1FDWA 2WD7A 3EGVA 4UHJA 1U2SA 1LBHA 1R18A 2D0PB 1WQ1R 3FZYA 4QYTA 5CUQA 1GUYA 4C43A 4CT5A 3RIHA 2W6MA 4E14A 2GPNA 4HDCA 5CM2Z 5BPHA 3RRZA 2JI9A 4ER5A 3N2LA 3GRUA 3CGGA 3GNLA 2ODNA 4JJZA 3HU2A 4LC9A 1Z34A 4JFAA 2IT1A 3MFQA 4L72A 1G8FA 1QCZA 4OP2A 2AI2A 3C3CA 4TSKA 3W5DA 3ZW8A 2JCGA 3AFIA 3JQEA 1Z3IX 2IXFA 3CVVA 4YIHA 3FDJA 3OQ1A 3RTCA 4HVCA 2G67A 2V7WA 4OU4A 2ZTVA 2IPAB 3KEGA 1OC4A 5L8VA 4UZSA 3EQ2A 1JLSA 5H4HA 1YQGA 3NHJA 4CKCA 4IMPA 4MQEA 4F3NA 3PGVA 4FIZA 5K3CA 1WXFA 3M6FA 2MOKA 4H6XA 3VKVA 4CUKA 3GUZA 2I8CA 1Z7GA 5KVCA 2YW2A 3QYPA 4ZVMA 3MXTA 1N9ZA 2BEVB 1H1LB 2MJLA 3HLYA 3HGTA 3D02A 4KUEA 5DHFA 2DT5A 4MGHA 4YUVA 5AVSA 1K98A 1H85A 1YA8A 2XHZA 4DJAA 3TECE 2WI8A 5IT0A 3RYIB 4KFTA 2PRJA 3LRTA 2GLXA 1NVVQ 3Q5DA 1MABB 2B8WA 3GELA 1L6IA 1WZEA 3V97A 3F1KA 4RTQA 1U1CA 3ZBTA 4REQB 1JX6A 1W7AA 4MQFA 1E2QA 2QIPA 1T9ZA 3VNAA 2C99A 2VUSA 1SXIA 5HXAA 1SFRA 3D4LA 1EFDN 3V8MA 4B32A 4US2R 3EPLA 1JHQA 3B1XA 3DMGA 1CF9A 3G68A 4NAVA 1RE0A 4NBSA 2HXYA 4KAJA 4XGRA 1N1GA 1DAHA 3LUJA 1FFXA 4NCNA 2UZ1B 5FOXA 4AI6A 2C78A 1N4DA 2WC1A 1Y6ZA 1DTWB 1UDBA 1V26A 1U31A 2Q4BA 3JVEA 2K7FA 5JS2A 2J5RA 4IKEA 3ZJUA 1DIAA 5IUKC 3E5HA 1D0IA 4J29A 4HEA1 4UBKA 2C7OA 1SG9A 4AECA 1JPNA 4PWZA 3SQMA 1T5TA 3WL8A 3EASA 3MTIA 3TL6A 4QREA 2Q1YA 3A9RA 3EFBA 3HXMA 4U7WA 1A04A 2O0MA 1RWPA 1CDOA 2HFJA 3COWA 3L1JA 3NGLA 4GAEA 5CXSA 3SNKA 1F12A 2BM0A 1Y5MA 3QTBA 4X1KA 4ZVOA 3LL7A 2HADA 3HLTA 5I9MA 3EEQA 4R31A 3TMAA 4BMVA 2JDIA 2Q2VA 3AJAA 3E27A 1MV8A 3PXXA 4Q05A 3TTVA 2I4MA 3AF0A 5H81A 4N7BA 1GFZA 3IEIA 4GH5A 4MPJA 1TE2A 1YL5A 4XM1A 4QGSA 1P6UA 3ZU4A 1UFRA 3Q3CA 3EA0A 1C9YA 3OG9A 2CZGA 3FMVA 5LMUB 3DGFC 3K9CA 1PYDA 3N87A 4O33A 2YHIB 3S2ZA 4F56A 5B7NA 2SKEA 3OKCA 4LZPA 5G0TA 5DK6A 2V1UA 3N6XA 1JA9A 2FG7C 4NBKA 4WPGA 4X7PA 1T2NA 2Q5EA 3LPMA 4HH4A 1E58A 1GYPA 1KMMA 3QPDA 1THGA 2VK8A 3QWBA 4H6VA 4D9IA 4Z9FA 1Q77A 4YRCA 1ADGA 1JMYA 1XMXA 2YMPA 3OIFA 2IDKA 1VL0A 1UC9A 5F9FA 2C29D 3V1NA 3QBEA 3V4OA 1I1OA 4FT4A 2JHGA 2XVYA 1IQRA 3KCQA 3V3KA 3IAXA 4HVLA 2O1WA 2UUCB 1HC7A 2ZSFA 3I1JA 1QDEA 1E0JA 2VTBB 3UUFA 3DL0A 4J0QA 3F3SA 1AB5A 3UVEA 3FVQA 4MQ5A 3ESYA 4W9NC 2UZ3A 4O59O 4FD2A 3PE3A 4GP7A 1FFWA 1GRCA 2J87A 4TOIA 4D92A 1ISJA 5L7TA 3CR8A 3JTEA 1C2TA 4H7KA 2QGNA 3Q8WA 3W6UA 5JDCA 2F3SA 4EG6A 1QB7A 4J3FA 1TCVA 4E32A 1SCUA 1YBHA 3N2KB 1NQWA 3U4IA 4JX8A 1Y8QB 1VPDA 1C50A 2QSUA 4GOMD 4A1FA 2BFWA 3I09A 3BHMA 3GEDA 4HB0A 5EEHA 2X13A 3S55A 3JWJA 2IXAA 1NG9A 4UFOA 4WNAA 1MX1A 3VPCA 1YU9A 3GUCA 5B58T 2WJIA 3GT0A 5H7XA 3K4HA 3LBAA 5TQJA 4EI8A 2LTAA 1ISRA 3O2JA 3WBKA 4YMGA 4YY3B 2O48X 2OCGA 3CFYA 1RYYA 1UT6A 1Y37A 3HO6A 3O83A 4BMOB 2BFNA 3GGCA 4IWNA 4OB7A 4TYPA 3W8RA 1GM5A 1ZVKA 3TLBA 2WDPA 3ZQKA 1WVIA 3HRHA 2H5LA 3AF5A 3B7GA 4LHVA 1PHPA 2ODBA 3EZ9A 2HLNA 1EK2A 1IE3A 3ZDCA 4GVPA 1SIUA 2W8BA 2NACA 3EWIA 5CEFA 2OCBA 5JQWA 3HDVA 1WHSA 3GVCA 5AJVB 4ZODA 3TRKA 3DOJA 4KR7A 5IN5A 3LD9A 4FR0A 3L92A 4I9UA 3FSJX 5TV2A 2R6R1 1HPLA 4DIEA 3NBAA 1I7LA 5K09A 1FPQA 2CE7A 4JDUA 4QNNA 4KOAA 2R7MA 3HBMA 3KK0A 2XDQA 3O8OA 3WE7A 5GJWC 4C0BA 1EDZA 4DIOA 1K0UA 5CLGA 5FPKA 5AK5A 4ZYVA 3KUKA 2E4ZA 2PKXA 5TS3A 1HURA 2D1YA 2UU9B 1GNRA 2C9BA 2W6PA 5C2JB 2XB9A 1SVOA 4I50F 4D0LB 2QW0X 1JBKA 1QNFA 3MTAA 1SXGA 3DE1X 3SEFA 5JWHA 4Z7OB 3THWB 4P7FA 1NLUA 4YA6A 1ESCA 1OF1A 2A1TS 2HSDA 3JW8A 4JC8A 1Y8AA 4XDGA 3V4SA 1XQ6A 4LRSB 1EK6A 5AM2A 1B8NA 4PNZA 4WH0A 1OSNA 4AX8A 2RI0A 3CINA 2VCHA 4M1WA 1G64A 2OZLB 2W2OA 5FPPA 3HB1A 4W5JA 5LDGA 1UZUA 3BD9A 1JP7A 1RLOA 2E1PA 1IH8A 1YMVA 1EK0A 2B61A 1O7JA 2GEVA 5M34A 2CV1A 2G5PA 2CKMA 1MJGA 5K05A 1BQ4A 3SGLA 1DHTA 1ST2A 4AJJA 4QLAA 1OJ7A 2FSVA 4G23A 1YC2A 4L9WA 5REQB 5EZ5A 2IE8A 2FUCA 3CE6A 1UOPA 4O4HF 1AZLA 1OZGA 2P1ZA 2PS1A 1Y7LA 5BXQC 1H9AA 2C96A 2HEIA 3F3MA 3QVOA 4EB3A 3FNQA 2FR8C 3ZKWA 4G6ZA 2NTEA 1GNVA 2K5UA 1Q92A 1Z4KA 4JEMA 2XB4A 4TTJA 3UY4A 3EAGA 3VU8A 2HRRA 1TAUA 5EP4A 2A78A 2XHEA 4DR3B 2XUJA 1W75A 1F9EA 1A4UA 2BMWA 3AV0B 4OQMA 1WL8A 3QF4B 1QG2A 3TR6A 3F78A 1TK9A 4UQPA 4F45A 3WIVA 1HFEL 3SLRA 4EYOA 2W93A 2Z0MA 3AHCA 2YHAA 3HXPA 4KEAA 4NMHA 4YJ3B 1E4YA 1YRQA 1EM8B 3IS3A 3N70A 4QTTB 3I62A 1RM3A 2P4HX 4CTOA 1NAHA 3R5SA 3MGGA 1ORTA 2K7ZA 7MHTA 1JKJB 4KBYA 2ZUTA 4GQIA 3O2QB 5DGXA 3IHWA 4BATA 1OGIA 1W29A 4UDYX 4NLLA 3D8UA 3BBPA 4V0QA 3WB1A 4Q9AA 1PUIA 5B6JA 1IVNA 4Z4FA 5KAPA 5ABPA 1BU8A 1KQNA 3PXGA 1J8VA 1L5RA 1JZQA 1SUPA 3DO6A 3JATA 4Y6LA 1NJ6A 3CUUA 2C3MA 3CLKA 3STTA 4C4XA 1NOJA 2WWYA 1NW6A 1V0JA 4Y30A 5BSVA 3FCXA 1Z07A 1KSHA 2Z1DA 2OEPA 3KD2A 3UMSA 3PQ5A 4LFAB 1C41A 1NPYA 1L7DA 4XCXA 1U2GC 2RBGA 2QGFA 4LBVA 1ESEA 2VNJA 1Z68A 1V8FA 4PX2A 2F55A 3DO8A 5JAZA 3EEYA 4J7UA 1R5NA 2P78A 2JZCA 1QCCA 1U2QA 2MMCA 2P91A 3SYTA 5CFMA 2WU8A 3VO1A 3TGPA 2XECA 4XJXA 1QJ4A 3NALA 2MYPA 3OEYA 5DM0A 2HHJA 2W2TA 4Q3AA 1ZN8A 2A6PA 3W79A 3FTFA 4EMTA 1BGVA 3ADDA 1A5TA 3MC1A 4LI0A 5D6OA 1EXWA 1XRMA 4LJKA 4RQTA 4Q3DA 1DZ3A 1T2AA 1R0XA 3D54D 3OJFA 3R6TA 4U2BA 3WVNA 3FWKA 4GM4A 1XP5A 2VOJA 4XLZA 5ILOA 4BLVA 5B4TA 1NBOA 2FXIA 3LWDA 5D7NA 1DLJA 4YXWA 3VTAA 1T8YA 4DZRA 3C5EA 2LVBA 3GLHB 3HFRA 3PXUA 1DUIA 1YZNA 4MS4B 4ZDWA 3UANA 2QQGA 1US8B 1A4XA 2ZXEA 2D5AA 3PKIA 1UMDB 1UKYA 4GYJA 4W5TA 3OD5A 5PGMA 1N6PA 3AYZB 2G9VA 3EIHA 3LU1A 4ZVVA 2C58A 3TDMA 1XV5A 2ZRJA 4TRNA 4DUZB 1DQPA 1TD1A 2FN7A 3CNOA 3JAWB 3KFLA 3TX6A 2AXEA 2WYIA 2AZMA 1EP1B 2XTAA 3C8ZA 1B93A 4UREA 2ZJ5A 4F96A 1KVRA 3D2BA 2PMWB 3G0DA 3NP9A 4DLBA 3PB3A 4M87A 5KTTA 4D74A 3BDAA 3L0CA 3VHXA 1BVYF 4KQ9A 3W5IA 3HU5A 3C74A 1KH2A 5DZSA 2O8NA 5BV2P 1SURA 2Q6LA 4LJ8A 3K1AA 1KHHA 1HH4A 5DH9A 1F3LA 3DOHA 1QPBA 1Q19A 1S8AA 2DKOA 2Y1CA 4I1VA 5EXEA 3C1OA 3ZY2A 5BW8A 5A71A 3G1TA 4QU8A 2Q3EA 3NJ4A 4RGBA 3IAM1 3NT2A 1CUJA 2AXPA 1UFKA 4C4ZA 2QT0A 3SZGA 3O5AA 2YN0A 1XTPA 2W0SA 3OEWA 3FGZA 2Q28A 4K9NA 4WCFA 1NJ2A 3WOHA 1WCV1 1HRDA 2ZXFA 4G0MA 4GOOD 4I7EA 3A1FA 5EJ4A 2DJ5A 2I7XA 1SU6A 4KR2A 5HZHA 3GCWA 3AF6A 5AVYA 3EZFA 1J90A 3K2BA 4PTLA 1JLLA 3JTMA 5J63A 4MRNA 4OQNA 2HTFA 3B70A 2HM7A 2G0AA 4JMLA 4J2OA 5D85A 5GONA 1UJ6A 4G1CA 1KMIY 4ZJPA 3OE7A 4UCQA 5BVGA 4BNFA 4RZSA 2YY5A 3Q98A 1IHUA 1P2FA 3JQ8A 1BX0A 4Q1VA 1N1MA 4FLMA 4R2HA 4JVOA 4MAAA 3ER9A 5FWYA 4RJ2A 1FU8A 1MNQA 1EJBA 1II0A 3RVOA 1E1NA 4LNHA 3L7AA 3TW4A 3M49A 3O1IC 2QAJA 1IQ0A 5I3ZA 4AX4A 3OWOA 4QYWA 4HJRA 2ZKIA 3RC9A 1ZUIA 1K7XB 4JB3A 4UE3S 3T3MB 2VJMB 2JHCA 2HGZA 1V7CA 2QKYA 1BW9A 5KEIA 3KOMA 1Q91A 4QE3A 2V8BA 2VYVA 2FVXA 3AT1A 5ERYA 1QHNA 4RLFA 3RU2A 3W6PA 2SCUB 2QMHA 2WJ4A 5B58C 3BSSA 1GYRA 5H5JA 4FEYA 4N47A 2Z8XA 5JH7B 4BAUA 3PLAE 4UHFA 3ICWA 3R7FA 1YB7A 3DHEA 4L73A 5D3MB 1W9HA 2M6KA 1Y4AE 1UK7A 3HUTA 3OJWA 4JELA 4M0PA 2CNWA 3VVLA 3HFGA 1TAGA 5HJ2A 1PQYA 3LBNA 3VR2A 1GTJ1 4RADA 4XYBA 1PIWA 4MUHA 5CCEA 3I05A 4OI4A 1O4VA 2RCNA 3K6KA 1RHQA 1RLJA 3QLTA 3SDBA 1KRWA 1PDOA 3R24A 1JE0A 1Y7HA 4IVPA 1SVLA 5FNVB 5T3UA 3SY8A 4QAJA 1G6HA 3CXUA 1VKJA 1EP9A 3NZEA 4PS1A 3WGGA 1V7ZA 1ZBQA 2XTNA 2YNMC 1R4AA 3GOQA 5FPYA 2OB2A 1AM4D 1G8MA 2GN9A 5LQDA 1C9DB 5KYNA 1CQZA 2YUIA 2B4QA 1Z2OX 2RHCA 3KZOA 4RY0A 2PBLA 2C2HA 3LG2A 2OFWA 1SXJB 2A9FA 5HBGA 3U9SA 4CHGA 1T3ZA 5HF8A 2P30A 5CX1B 3ZPXA 3X2EA 3DAYA 2ECFA 2HCJB 4PGHA 2W6ID 4XD7D 3U0VA 2PZJA 3M6XA 3RYTC 3H8JA 4AJNA 1RBMA 3LYUA 2ZI6A 4BS9A 1ICEA 1IHXA 1OVMA 3L1VA 3A1WA 3FDXA 4IWYA 4N0QA 3MT7A 5DNVA 5AYVA 3ZVNA 4DPKA 4GKAA 5HUJA 4XIYA 4LNAA 1U3VA 1N0UA 1W5EA 5H70A 3B82A 3WKAA 4CV2A 1TVMA 1CJUC 2NSJA 3CIOA 3G2KA 1UWKA 4N0EA 2XJ4A 1RXCA 5AP9A 3X1YA 3GLSA 1YFZA 3JWIA 1GTL1 4M98A 3CF4G 4DV7B 2ORED 1ECCA 2YASA 2R3SA 4ZEOA 4NHOA 4KI7A 2D7DA 1D1SA 4HDSB 2LCIA 1N5IA 1GEEA 2VJKA 4QRHA 1K9SA 3V8NA 1IBRA 1FS6A 2GPBA 1D04A 5SZIA 5AWFC 5K6AC 1BQ3A 4L9RA 2PSHA 2JGFA 5JFOA 2OBYA 3UOAB 3OBIA 5HFNA 1YB1A 2CK3D 3LVBA 1BXZA 2P3OA 4IFBA 5AQEA 1EFCA 4G5OA 1XWIA 1NC1A 2Z5GA 4NU5A 1EA5A 1KI2A 1CVLA 2BMDA 4Z3DA 4BMXA 4D8XA 2HU8A 1UBMS 1PF7E 1NLZA 1IFXA 1QG0A 1BZYA 1Y4SA 1WD7A 2GBLC 2XRFA 2G40A 2PAFA 3F2IA 2W83A 3H9BA 3QVSA 1Y6RA 3P1JA 1H2AS 1EX6A 2C2GA 4OUDA 4B8YA 1NM5A 4NCIA 3NH6A 3F6EX 2GOYA 4LE2A 3UAWA 3UHJA 4XEUA 1AKMA 3LLCA 4I0WB 1YIOA 3BB1A 3AR8A 5FOTA 5DTJA 2DPXA 2VT6A 1DIHA 2YJZA 4EI9A 2O2YA 1P81A 5HE9A 2QLFA 3N2NA 1XUOA 3HP4A 4CEIA 2JHAA 2REQB 4BWGA 3CYFA 4LMBA 3M2PA 4JQCA 4MRVA 3VO8A 1PR4A 1VMEA 5CFLA 4D81A 1NF2A 1R12A 3AR3A 3LCMA 3NEYA 3PL1A 1QIIA 3LFUA 2SKDA 3SZMA 3QU9A 1JRLA 4JA2A 4UBNA 2AZXA 5JE8A 1QYVA 1R0KA 4D3DA 4FCVA 5FRDA 5GOZA 2F1IA 3KSZO 4WTOA 2HK6A 3RVKA 1P3Y1 1C3JA 4PGGA 5BSUA 4ZT2A 2F4NA 3O47A 4N03A 4JI6B 1YS6A 2QTCA 4I14A 2H1FA 1DFIA 5B30A 1Q1QA 3KE9A 5LZ4A 2BMEA 3FE2A 1L5NA 2ARKA 1XXHE 5AKLA 2P0YA 1EWQA 2XCUA 4MIOA 4Q3NA 2Y1FA 4RMJA 2P5SA 4TL7A 3WP0A 1N5RA 2X3UA 1V4BA 1WDTA 3H2JA 3A1EA 3W9SA 4AZTA 1FFHA 4WZAA 1FXSA 5I9SA 1UKBA 3E8MA 4BNLA 1AA9A 2ZE5A 1UC5B 4KO3S 4O6VA 1NN3A 2PZMA 4P83A 4TN5A 3SICE 1GG2A 1YKFA 4QBIA 4NONA 2XUGA 2JIMA 5HIMA 4OHFA 4X85A 4BKRA 3WGTA 5GQSA 2Y0PA 1JHOA 5IWCA 3FM9A 3EEIA 2VXBA 4LGYA 2QX6A 4UJ5A 3Q10A 4YBRA 3WMEA 4JY7A 3SS9X 3AFNA 2D13A 1WW2A 1Z88A 1GAJA 2DQSA 3L6UA 4PPGA 2IHUA 3WXMA 3OTIA 1M74A 4UOEA 2REBA 3I3OA 4YREA 3W2FA 4F2HA 3JQQA 5F9HA 1SRQA 5JATA 1X1QA 2IYVA 2NNWB 2PQ2A 3QELA 3I0NA 3DMHA 4IMRA 5AM5A 1QVAA 4OHPA 5DK4A 1SHKA 1A9RA 4DLNA 1CJMA 3ZD8A 5LWQA 1MFPA 3J7AC 2WP8J 4OUKX 1GPYA 2QTHA 1G20B 4M7WA 2GCPA 4NG4A 3JY6A 1VJ1A 2PKCA 1QZTA 3CH5A 5EGSA 3GGSA 1ECLA 1N2OA 2IS2A 2Q6KA 2HGSA 3DOIA 4QWMA 4FHFA 5NULA 3FIJA 3R20A 2Q1SA 4HZGA 4K46A 1K6MA 1KA9H 4R1SA 1Y9JA 4HDMB 3P2YA 2F48A 4Z9BA 4XTCS 3BCUA 1WF6A 4OQQA 3AVYA 2ZSJA 4M0UA 4GMKA 4BLUA 5EA2A 2ID4A 3B52X 4IIBA 1B74A 3CXRA 2D1RA 4EA7A 1E0AA 1BS2A 1PJZA 3ABZA 1ONOA 1G17A 2HD4A 1U7OA 2C4NA 3MWJA 4K3VA 4FB4A 2P9FA 4RKFA 4WVLA 4YYEA 3AHDA 5J58A 3IEUA 3OF5A 5E0OA 4V3BA 1F38A 1VCOA 2BISA 2CXNA 4F8EA 3PV0A 5LQJA 2OXFA 2FFAA 5JQGB 2P9QA 2B98A 3E35A 1T9BA 4OIFA 3HN6A 4XJTA 4BQNA 3BF7A 2HK9A 1HMPA 1B15A 2QTBA 2VRCA 1GT6A 4K5QA 5FLKA 3YASA 2B2XA 2W0MA 2YXLA 3ASYA 1FX1A 3CX8A 5JSKA 2W6JA 3U5ZB 3A6FA 1Q6YA 2I3AA 3BWMA 4LNUB 5IZ4A 2GRJA 4E15A 1IDN1 2NN3C 2C3UA 2WYHA 4JP8A 4DR7B 3W7BA 4Y2GA 2P40A 2YVQA 4I50B 1T4MA 1M2VA 4O4IF 2M2IA 2HQSA 2JFBA 4KUGA 1XEXB 1KE1A 5AIBA 3G85A 1G291 4IXTA 2FW0A 3EXG1 1CIJA 2JJ2A 1VGVA 1JVSA 1TCBA 5B12A 1H6AA 3QFTA 3TQRA 3W78A 1QHGA 3D6AA 2ZSIA 1MAVA 3W0LB 4B4UA 4FOLA 1REQA 2YQ4A 3ST7A 4PYMA 3RVJA 4K6GA 1YD7A 3W5HA 4L6AA 2BF7A 2GF9A 3NT4A 4EB8A 2O23A 4EF6A 1FMLA 4I8IA 4E5MA 4X94A 5A9TA 3S2EA 4EECA 3VVCA 2VVTA 1E7SA 3FD8A 4AJIA 1M1YB 1XWFA 2BJVA 2HA6A 2M1ZA 1S7CA 2AN3A 2IYXA 2FPUA 1Q1ZA 1Z6AA 2V1XA 3PNBA 4XSGA 2OHXA 4O4HB 1A7AA 1NUAA 4ZP1A 3ISVA 3TH5A 2Z1MA 4H3KB 4Q15A 1J8YF 2MYUA 4JB0A 2I1LA 2OC9A 4RXTA 1L8OA 3ZCVA 4Q82A 4WLOA 1CRWG 1QP7A 2YUTA 4E30A 3QF7A 4ALIA 3VZSA 4YCJA 4RAOA 2R62A 2X9QA 1P4HA 1T15A 4JSTA 4PPNA 3ZXXA 1NVBA 2LNDA 4ZDJA 5CBPB 4FB5A 1FJXA 4PFKA 2AQKA 2B8TA 10MHA 4X7MA 1GP2A 2WMOB 3GK3A 3AHIA 4L4ZA 2EZUA 4DREA 1MO4A 5C0OE 5A9SB 2QP4A 3LF2A 1GV1A 1AUXA 1PT7A 1JMVA 2HLDA 3HEBA 2FRDA 1J0EA 4L8WB 4YRPA 4O3MA 8ATCA 4B5KA 2Y3IA 5ALYA 3R3HA 1G66A 1PK9A 2H3EA 4DQKA 3WL4A 4E7PA 2CB0A 5B7QA 5JLAA 3RC1A 2QMQA 2IYRA 3NTVA 2RAVA 1D2EA 3REFA 3TLMA 4MVJH 4OKIA 2VQFB 1XZJA 1C7JA 4IQ4A 5CG1A 4W5WA 1T3LA 2FOXA 3U1BA 3T1TA 1XTKA 4EUNA 1KP9A 1OZHA 4LVCA 4IGAA 4G5GA 2DFTA 4B40A 2O3RA 1PJ2A 4RIFA 1GKUB 3PD0A 1CZUA 4OREX 2ZZNA 3EUAA 4RHXA 1RIFA 2E2WA 1ITZA 1SOWA 1XRPA 1KAQA 1XZPA 3T41A 4Z4HA 4LSMA 3RYCA 3ZHCA 3EY9A 3C3MA 5CITA 1PR5A 1DC5A 2GN0A 5AKGA 4PG8A 1KYXA 3IQZA 3RS9A 2J0UA 4GKJB 1E3WB 4Y6RA 2WV9A 5KDLA 3DVQX 2G8NA 3KKMA 4LV5B 3FPEA 1YBVA 2NW6A 3RKSA 2ZJOA 5KPDA 4Z3OA 5KTOA 2GCGA 3D8RA 4KNWA 5FI1B 4CTMA 2IA5A 1ZX1A 2BYTA 3NDJA 1YC5A 1SVNA 1NJSA 2FWIA 2AW5A 3H2BA 3UF0A 4AIRA 1XTRA 4AKGA 1M0EA 4DMGA 3PC8C 3M5CA 4AO7A 5DW0A 3A26A 3I5XA 2P4UA 4W99A 2YRXA 5DHSA 4C01A 2P4QA 3DKKA 4R7GA 3FTPA 4KXVA 5AKXA 3QV1A 2RGWA 3BXOA 3MTJA 4D6XA 1CQIA 2BEJA 1AQLA 1PNVA 1TO6A 2FN8A 5FBVB 3WGLA 4KQHA 1G7TA 3FPCA 5HF6A 1ZC4A 3T38A 4UM9B 4E2XA 1MV5A 2ZJ1A 4OL9A 4W7HA 1F1JA 5I3CA 5I48A 1P8AA 2B35A 5KYYB 1CY0A 4WZZA 4U2CA 4O2AF 5JAIA 4IZ6A 1Y3AA 1QKJA 1EVKA 1Y1KE 1E9EA 2VWPA 3TR5A 2CFIA 2QNIA 2BR4A 3QE4A 4EYSA 3E7DA 4RDCA 3HDYA 3LC1O 3TQFA 4QTYA 4BLPA 4W82A 4EJ6A 2OLKA 4NV3A 3AF1A 3EVZA 3KTAB 1GCGA 2DOKA 5F2KA 3MA0A 2HMWA 2QLNA 1OIXA 1WW8A 5GV8A 2X0FA 2AK2A 4EY5A 5AW8A 4PG5A 2OG1A 4FDTA 2BHNA 4BDSA 4KZKA 5LQSA 6PFKA 2BVNA 1PZXA 2QD3A 2ZJ3A 1EQ2A 2BLNA 1NZDA 2NX2A 2P3SA 2DH6A 2QR3A 4P3NA 4WJLA 1YJCA 1QF9A 2AFVA 1H6DA 2Q6VA 2R7LA 3L9XA 4M9XA 4QELA 3DV9A 4TXLA 1XZ8A 5AK6A 3RHTA 4BB5A 4WE3A 4F7WA 3O8LA 1Z0IA 5A0VA 1ZZEA 3CEPB 2GYWA 1Z08A 1P0CA 2ATCA 3T7AA 4AN1A 1V4NA 5BNWA 4RTNA 1DGQA 2UKDA 2VO1A 4IINA 1JG3A 3MRXA 3NTOA 2BGLA 2Z6VA 2B78A 4GOLD 4RS3A 1TVKA 1FDUA 1YS4A 3CIFA 1W9MA 1XYVA 4P93A 3TNJA 5IAOA 4AY5A 1KYTA 4LY0A 2RKOA 2ZBVA 2ZJ7A 1IHOA 1ZJWA 1XVLA 2HJGA 3L93A 4OXRA 2R751 2BM9A 2GRAA 3ICEA 3D3EA 2CHEA 4LZZA 2C8LA 4TXHA 2IU0A 1ZSYA 4BMPB 1B3BA 2GHIA 4GMHA 1UBRS 2BF4A 2Q9BA 2GEDA 1H0KA 1MC4A 5EE1A 1O95C 3MCUA 1ECGA 2F1KA 5IC5A 3ZQJA 4V3CA 3NRJA 2WYVA 4AJPA 1G6Q1 3T3PB 1W1IA 2ZE7A 3THYA 3QKRB 2IY7A 2IE0A 3MJVA 4E3ZA 1X7XA 2OHIA 4KMMA 4FDMA 4NU8X 2W2MA 3ULKA 3PZRA 3W1VA 1VI6A 4IIYA 4RF4A 5GY7A 2I78A 3GFRA 2KYRA 3K2EA 3VI4B 1PSZA 1L3CA 4KG7A 2GZAA 4S24A 4R1LA 3EVDA 1NWCA 1XPOA 1EFTA 4KODA 1N78A 1A76A 1P2GA 1TZCA 1CP2A 2OHHA 1RMYA 3NO4A 4HAOA 4X20B 1M1NB 1W8DA 4RYDA 3CWQA 2YJ4A 3PFGA 2FK7A 2JGIA 4G9BA 4XVUA 1O97C 2WFZA 2ZWIA 3I2GA 2IW3A 2Y4NA 2ZB7A 2C03A 4QTXA 2D0OB 2Q7XA 4F9TA 4P5PA 4BNWA 4LF8B 1W73A 3OWXA 4Z51A 4J1QA 4KQMA 3Q12A 5EUMA 4CDGA 2C61A 3DFIA 3MWEB 4B33A 4ED9A 3L1HA 1G4AE 4S1PA 6REQA 2A84A 1T0IA 5CCXA 4NZYA 1EXDA 1EK1A 4DLXA 3ZJ5A 1VHLA 2V3CC 4ADSG 3AP3A 1NRXA 1BE0A 3KWMA 3KOZA 5CA1F 2EGGA 2IUFA 4BLTA 2LRHA 2QRPA 1W5FA 3D8SA 5FXMA 2JEYA 4OHUA 4F4UA 2ODPA 4MCIA 1O03A 2C2MA 3NR2A 2P4SA 4FSXA 1ELOA 2C0QA 1UBFA 4OSPA 1JXMA 2CHGA 1P72A 3B6EA 4CIWA 4AY6A 1U7TA 2GKSA 1J07A 1PN3A 1VHTA 3ONVA 4BY9E 2EQBA 1DG3A 4PYOA 1YV9A 1ZWKA 3FCYA 3TIGA 3MS7A 3OBBA 3PDJA 4P98A 1JFFA 5KQLA 5FPHA 1U6IA 1Y9AA 4XQCA 1T1SA 4B6OA 2GPTA 3EHDA 4WJKB 3QLVA 1J9GA 5JZ9A 1N57A 1V8DA 1NR1A 2YDXA 4BLRA 3U9LA 3CPSA 1TGVA 1P3JA 1R6VA 2GBIA 1X0XA 3OJLA 2ZRLA 4TMXA 4WFIA 2IU3A 3TAXA 4DY4A 1KH1A 5D00A 2J6BA 3N86A 3NBYC 1DJPA 5IZCA 4LA4A 1EKXA 3H8WA 3OHSX 3L6CA 2XWSA 3VZDA 3T1OA 2O2ZA 4D3YA 4DRYA 1V5EA 3DKIA 4WI1A 5LXTF 3IIKA 1THTA 3GXOA 3PJEA 2GFHA 1KGDA 5C31A 5TT1A 4YWJA 3RASA 3QG5A 1BMTA 1H8ED 5E6RB 4BO6A 1Y3BE 3C6MA 3Q6MA 4DGQA 1NDUA 3S44A 3GUUA 3O94A 4TM7A 3ZHQA 4D96A 4HH1A 2O7QA 2OO3A 1SY7A 1K9VF 2BL4A 3GDHA 1E5VA 2AUMA 2GO7A 1EX9A 4IV5A 4HUTA 3NQ41 4RTKA 1A9QA 4FYXA 4AMGA 4E5UA 2Z8ZA 5C3UA 3L4SO 2PNJA 3AF3A 1W2HA 4GS5A 4JYZA 1E9BA 1HDIA 1FRNA 2YFQA 4HWTA 5MF6A 2DTEA 2MSNA 1L5YA 2C5SA 4IDFA 4AB1A 5L4SA 3GG2A 1J5EB 4AY2A 5B1EA 1XPJA 3SR3A 1WNTA 1FB5A 2J9YB 2GBGA 2X7HA 5AOCA 3U7FB 4CFZA 4OLJA 5G0SA 2OYCA 2XTZA 4OAPA 1JEYB 1A9TA 2C2WA 1JXQA 2HL6A 2LPMA 3OEEA 1QLWA 4WLNA 1K68A 1H0RA 3GUHA 1DB3A 1MB3A 1A5ZA 4TKUB 4D9MA 3ZR4B 1JEDA 2D5CA 4U02A 4B43A 4LV6A 1E2PA 1UFQA 4YDQA 1M1YE 3WL7A 3R41A 3AM5A 1ZNWA 3Q2KA 1M6HA 3KQYA 1BHJA 3HYNA 2WAAA 3QE2A 4UUOA 4RF5A 2A5LA 4XA8A 3DOUA 5D3ZA 4YPFA 1NT2A 3LUAA 4DA9A 4PPQA 1VECA 2O52A 1V43A 2KQUA 4DLWA 2WLTA 2EERA 5MFPA 4QBTA 2C2OA 3F7TA 4OXNA 2YY7A 2Y71A 1BVRA 4RIGA 1I2CA 2YFKA 3PNVA 1U6KA 4UEKA 1FY2A 5CVTA 3VKGA 1FMTA 3SI7A 3ZCXA 3MT0A 4QPDA 2JLUA 2GA9A 2Z2XA 4W1PA 5AW7A 4F4IA 1NW8A 4LHWA 5B55A 1WLSA 1ZDMA 3F8SA 1Z0JA 1FDIA 2IV7A 2CXRA 3EXHA 1RJFA 4BB6A 1E6MA 4CLDA 5ICGA 2PJRA 3PLNA 1IBSA 3BXZA 4X3CA 2X76A 3RCBA 1IK6A 3UOWA 5ICMA 5J2UF 5IAAA 2C57A 2DKNA 5KWJA 4GT1A 4FC7A 3EFOA 4FYIA 4YMWA 5LC1A 2VLBA 4RESA 2ZIVB 5KI6A 2FAXA 1KAOA 2QR2A 1E89A 4M53A 2R6AA 1EU1A 3FVWA 3T4XA 1O08A 4GP6A 4CN8A 1Q44A 2I65A 2IYAA 3GEIA 4IMIB 4II2A 3SF8B 3UIEA 1GCAA 2KJQA 5DBGA 5KJFA 3TGLA 1T4CB 3K9WA 2XOKD 1VIMA 2PPLA 2DHEA 3SM9A 3WJ1A 3WSTA 1QC5B 1WTCA 2R5WA 5AJUA 2F3RA 2BTQA 4ABYA 5DLQC 3TTWA 3U3JA 5J2TF 1YE3A 2IOFA 2JFPA 5HK9A 3X43A 1VL6A 2YRWA 3GQBB 4QXRA 5J40A 3OLVA 2CFRA 4QECA 2BY4A 4TS3A 3LPLA 1QWOA 3H97A 3SBEA 2H4HA 1IAQA 2WT9A 2GK3A 3IIMA 3PUJA 3HYCA 1Z4PX 1HR0B 1UMBA 4I9FA 5IFLA 2B8EA 3RI3A 2J0EA 1SB8A 1AN9A 4PS0A 4ZYUA 5JVDF 2FV8A 2VTVA 3HS3A 2VF7A 1PNOA 5C5DA 3MOGA 3B13B 4IRUB 5B3LA 4DCPA 4M8LA 1TKBA 3MQ2A 3QU2A 3P19A 2QZ4A 1TJ3A 2ZQ5A 4CR8A 3WTCA 2H29A 1GNLA 3GP8A 1YRWA 4EJMA 4P5DA 5F9MA 4PU0A 3UT5B 5DXJA 8GPBA 1QB8A 1DX6A 3EH1A 4XYGA 3E9ZA 4FGKA 4QULA 5ELMA 5IUNC 4MS3B 1LF0A 3O4VA 4QFMA 3D0RA 1JR3E 2BEUA 2BFCA 1MX3A 4O4IB 3WOVA 2X2EA 1SA0B 1Y89A 2I4IA 3DDUA 4QRDA 4W7IA 3TIIA 4ZVSA 521PA 3UH1A 2D5BA 1UBTS 4C6HA 4HNQA 3H6HA 2B37A 3QEKA 4CCAA 3DE0X 1U2PA 2BFMA 2P1RA 3IDOA 4QYSA 2ZYIA 1J1IA 5B5SA 1QK4A 1VPLA 2X0RA 3HYRA 4ACBA 4AM8A 3RRNA 4J1TA 4S04A 1R6DA 3L6EA 2P2ZA 3IDQA 2FPIA 3UGJA 3HKDB 2G72A 3SIWA 3TUIC 3TPFA 4L8VA 4NFLA 4ALKA 3S2FA 3LC0A 4J91A 3GIDA 2FHSA 4A0QA 2RGAA 2CDNA 1X70A 1A77A 5EMKA 3S70A 5DBFA 2XOXA 2BKXA 3TCNA 4GPZA 3CLSD 1L5LA 2HMUA 1D4AA 4MZXA 4Y9SA 3T7DA 4EO4A 3FBGA 1RJWA 721PA 1P45A 5H0IA 4G3XA 3A1VA 4HXGA 3UB2A 1AF4A 1TZKA 1VE1A 4G01B 4E4TA 1G41A 2FX5A 2WWXA 1X80A 4PY2A 4PIVA 1H3NA 2JKYA 1K92A 2FKAA 2H4FA 1C1YA 3HWRA 3LA6A 1EJ6A 3N74A 3WWPA 1M5UA 4RA9A 3W9YA 2POCA 1RYNA 4MICA 3AUSA 3GARA 1J00A 1DXYA 2IYYA 3A36A 4GMXA 4P4LA 5TRTA 1WPQA 2IGTA 4NOKA 1P6XA 3EIXA 4PG6A 3PI7A 4KLNA 5F21A 3UFBA 3RLIA 4AP9A 2ZTHA 2HJSA 5SY9A 3ZIUA 2EJUA 1OX6A 3OPXA 4AMUA 1XDDA 1IZYA 2QX8A 1P73A 3EBLA 3BK1A 1N6LA 1XF1A 1WMFA 4KGDA 4TYQA 2VZ8A 3GGOA 5AESA 2QW8A 4TS9A 4FFLA 5C7LO 3QVXA 3OZTA 2C42A 3V7FA 1ISIA 4OLAA 4M9RA 1F2TB 4HYTA 4MMXB 2C5FA 2OR3A 1H93A 3HBJA 3WWCA 4CF3A 3C39A 5JO0A 2Q4EA 1I2MA 1B0UA 3IESA 3EDCA 3ZD7A 3PC2A 2VXYA 2PHZA 2FPRA 4JB2A 5K8VA 2PUBA 4H7FA 1IYZA 4YCMA 4IHJF 4RPLA 1SZPA 2JH3A 4B74A 2FOLA 4D3ZA 3C6BA 3F73A 1OBOA 1E3JA 3EPPA 3TL2A 2YWCA 1WOMA 3IEXA 4YCDA 2QE7A 2H2DA 1F2UA 3F90A 5F7OA 2B4AA 4DV3B 1VE9A 2ID9A 3EVGA 3PRJA 3ORQA 4WGGA 1JJIA 1ZKMA 5EXDA 4K40A 2I4TA 5KIAA 1FNMA 2FW7A 4Q4HA 1X77A 1G5QA 2JI6A 4CQMA 5AKJA 2VSNA 3G2LA 4C4YA 3N9IA 4QPZA 2EBFX 3SXPA 2NUPB 3LCCA 4ZI7F 2BM8A 2Q45A 4ZT7A 2CHVA 4GOKA 2CKDA 2HU2A 3OZXA 3RYFB 3WL5A 2QM3A 4DLSA 3H1PA 4RSMA 1XQ9A 2FB9A 3SBDA 4Y2UA 3QUQA 3OT1B 4PYNA 3HVUA 1VB3A 3TQSA 2MU1A 2JFYA 4QOHA 5CVVA 2D1TA 4R6WA 5C32A 1AV6A 2VWHA 5ALSA 4C29A 1S8NA 3FCCA 3E9NA 4IILA 1XVVA 4E46A 2GJKA 2HMAA 4RK1A 2RI1A 2QL6A 1VJ5A 3DTTA 1M2OB 4LISA 4O2AB 4ROTA 3QSYA 4GZ5A 3L06A 3RRBA 1O3YA 2CVHA 1DUVG 3LPAA 2H1WA 3U17A 3CJQA 3FWPA 3I04M 4HNAA 5A6SB 5KTPA 4JLWA 2H92A 4NTZA 5FHQA 5HKKA 3STYA 5ECYA 3DAPA 3T6KA 1CYDA 4WMLA 3RSLA 4LF9B 1AKYA 5DHRA 3SX0A 3Q2IA 3KALA 1S3GA 2VZEA 1L6RA 1SQFA 1KERA 1R4NB 1Z5WA 2CL0X 2IVFA 4MVYA 4HWKA 1A95A 4EEXA 3QMWA 4XTRA 5FAXA 1SCNE 3DE7X 2FW9A 3FWZA 3G6WA 1K6EA 2XWQA 1QFZA 1MENA 3PUWA 2CXHA 2OWDA 2YJ6A 3NTLA 4KMRA 5EOVA 1CR2A 3A06A 4TXMA 2WJHA 2BP7B 4GP9A 3ND9A 1H2YA 1YMUA 2YHUA 5E6SB 3QU4A 4P2BA 4FDAA 2HPZA 1JEYA 2QR5A 1HTTA 3FTCA 2HR1A 1GPMA 3G6KA 2Z9DA 4KJZA 3BWEA 4PC6A 4C0AC 3P26A 3CQ9A 1A7JA 3ZG6A 3DMTC 2QBYA 5HF5A 3MHTA 3BE4A 1Q21A 4R7TA 5P21A 1SWWA 3GWZA 3KE8A 3O8NA 4O63O 3VO9A 2O0KA 2ZBQA 1HO3A 2VSQA 4R9UC 3RT9A 1Q2UA 1OFVA 2OFPA 5EJGA 4CM8B 1Z7YA 1KBZA 1V9LA 2O4UX 1YR6A 1UOQA 1CLEA 2FPWA 3M9LA 4BMDA 5K8JB 4PCAA 3EF0A 4D8UA 4DDUA 2UVPA 2J6HA 3VJKA 3WGOA 4H1WA 4FD3A 4XIIA 3TTYA 3PX2A 1GL6A 1HZJA 1KARA 2VBGA 3PR1A 4KPUB 4YMTA 1SU8A 4RZXA 1LDYA 4P5EA 4W9MC 1QK5A 2AG6A 5IX8A 1H65A 2GLUA 1ENOA 2PKWA 3P7MA 2HOQA 4WK6A 4ZVTA 3R7WB 4AY3A 1WHTB 3BGDA 3I9KA 3PXEA 4TLCA 4DIMA 4EENA 1FA9A 1V16B 4JKIA 2ZIWB 5LYJF 4OY3A 4R9NA 5JJ5A 2RARA 4RJJA 4L8FA 2P67A 3FUWA 1Q95A 4QD3A 4XFKA 3SE0A 5MDHA 3I61A 2ZSBA 3HM9A 1EVQA 2J0QA 2B5OA 3M34A 3DBIA 4BX9A 4EKGA 5BUSA 2J9ZB 2PMBA 2G5GX 3M1AA 1LSSA 3B5EA 2B8JA 2HIGA 3NEPX 3P5BA 4BWYA 3EDYA 3I2KA 4HLDA 2HA5A 3ZX4A 4EW2A 5CXQA 4H0CA 1RYBA 4R5HA 5FD8A 1K3FA 4JNKA 2Q5OA 2MYNA 2FP4A 4YONB 3FOAA 2YJTD 3PS9A 5IMBA 3WWDA 2OECA 3AF2A 3MILA 3RT7A 1W0KA 3B5IA 1UOOA 2OKCA 2A86A 1XMIA 2IHYA 4IQ0A 1E9RA 3H1GA 2DR2A 2G7ZA 3W9UA 4UEOA 1YHYA 2GJAA 4NBLA 2VH2A 2HT6A 3TD9A 3JR7A 4JBLA 4K6CA 4YI5A 1T8TA 2VP6A 4WNYA 2V5UA 2WFAA 1Y6FA 2JA2A 3F6YA 3TM5A 4HAXA 3NEJA 3ZUGA 4A4DA 2UXCB 3AX6A 4FFBA 4R8LA 1V95A 3AP2A 4ZI2A 1YJ5A 3EVEA 2D62A 4ERNA 4DG8A 3D6TB 3IAS6 1J39A 5EINA 5BQPA 3DZJA 1GKIA 3C4JA 4LVNA 4DLPA 1HYQA 1UMCA 4JVSB 2V6IA 5K03A 2DTDA 4HGPA 4OJKA 4EK9A 1QFJA 2I1QA 5JJLA 6YASA 3P9ZA 1UL1X 2IXDA 1MB0A 2IUSA 4RM3A 4Q9HA 1J49A 4K2AA 3COZA 3AJDA 2JAQA 1A0OA 2ON6A 4DBZA 4URXR 3UNXA 1QDLB 1U28C 3L4EA 5ARBA 1Z8DA 1VRWA 2D1FA 2FWJA 2ZAMA 3ZGOA 5BW5A 1A8IA 3RFFA 4JITA 2WIKA 4KXXA 2I7CA 1TLTA 2I33A 2IIQA 1NI4A 3F96A 2Z9BA 1G16A 2H48A 2I4LA 1FRVA 1RU3A 4NWIA 2CLIB 4WADA 4PPYA 4GMGA 1TRKA 3ZHUA 3EIOA 2RGGA 4BC1A 4BKQA 1T8UA 3PUZA 1AS2A 3WNDA 3H5OA 1EP2B 2ASEA 3VSEA 3ITKA 4RETA 1OX4A 4F1JA 4ZJYA 2ZUEA 1OYOA 2JCVA 1YASA 4M1OA 4MYDA 1T1JA 5CA0A 3V32A 4BXOA 4FE3A 5TC4A 2XB8A 2FEMA 3P0HA 2CCKA 4HNHA 3UAYA 3EQ6A 5IK2D 4AZ3A 1Z18A 2XMDA 1KE2A 4EFDA 1BHQ1 1CYEA 2NZJA 1NTRA 1NXXA 1KQPA 5L3ZA 4BLOA 1LI7A 4KO4S 5CDGA 3LV8A 4CEJA 1L8XA 3PQFA 1QE0A 4YDHB 3ZVKA 2FMIA 2VA9A 4YP9A 2GAOA 5A06A 4KUHA 1KGSA 3IOMA 4YR9A 4B44A 1WDLA 3M1YA 4C7JA 2I22A 1LS1A 4FS3A 4M8IA 4BDTA 1M76A 3ZV3A 1D7OA 1NX9A 4XUEA 4ZZIA 2FZWA 3U44B 1M6YA 2ZWOA 2V6GA 4CKWA 3FJ1A 1UADA 1L7EA 4TQGA 2LZ0A 1S2LA 4YAIA 5CG2A 4FYKA 2HPHA 3B1WA 3OFVA 3PQCA 1QP4A 1RRPA 5EWMB 3P9QA 4XJSA 3U80A 3KDSE 5ELLA 5ESDA 3AEYA 1FNDA 5ITSA 3QITA 2OAQ1 4IOLA 5F5NA 5AXBA 5JXGA 5K1ZA 3O95A 4JQSA 3ROEA 4GU5A 1KMHB 2Y0DA 4XWYA 4B3MB 2ECKA 1CVIA 3L41A 1UBCA 4DY6A 4ZICA 4ZALA 3G1WA 1W87A 4ND8B 3GNQA 5K5EA 4WACA 4BVFA 4YXWD 4V0ME 2MWMA 2BZ1A 5BRJA 1JZSA 4QU0A 1ZOIA 3HVKA 4HK4A 4BQFA 2W6ZA 4DZZA 2AI3A 5I7HA 1JI3A 3G2IA 3WLTA 1H8HD 2XE6A 3JWEA 5FBLB 1ZI9A 5KUTA 1XU4A 3U1VA 4OX9B 1TA0A 2N42A 5IANA 4OYLA 1FX0B 5K20A 3GJTA 5I4BA 2ONKA 4GWGA 5EQTA 5A5VA 4U6SA 2G08A 4Z99A 4A0RA 1QAMA 3CU5A 2HDHA 3RC3A 4QHTA 1XZAA 3ONNA 1LLCA 2ZQZA 5FULA 3UMJA 3PIIA 2XCIA 4C7OB 4P4TA 4QVIA 3ZWVA 2VT3A 1BXGB 2PUFA 4ENSA 2NYUA 2GDZA 4L95C 5J2UB 2P6MA 4PF1A 3NVMB 3P9NA 4JXJA 4KYTA 1H2WA 3AC0A 3JAKA 2QJOA 4N40A 1Z0DA 2XUZA 3H0CA 2VP2A 1GLGA 3IV9A 2D2VA 2P6PA 2YY6A 3QA3E 1E77A 1TYEB 1XIVA 3C8HA 5ECDA 3O8DA 5E6UB 1BXKA 1R0CA 1EAMA 1YS7A 4NJMB 4R40A 1WU7A 1SKQA 2C7GA 3OAAA 3RU9A 1IXKA 3WWZA 5A0FA 3ESRA 4KIGA 1R15A 1EEXB 1D4OA 1Q74A 1T91A 3LXUX 5JRJA 1QU2A 3ICOA 1U0FA 1TFUA 3MTGA 1PI3A 1XRNA 1WF3A 4OGGA 3TZLA 2CL6X 5DXAA 1Y1QA 1YVDA 4CLOB 2ZBPA 3HN7A 3ZBQA 1RPNA 4P58A 1SUFA 4JUCA 4RPGA 1XZHA 5J2TB 2RH9B 3A3PA 4RYLA 1QRDA 4UMEA 3DTVA 2P6OA 1ZIDA 1M83A 3O2SB 4QPNA 3LYHA 4Z9XA 3ZU5A 4E3WA 3WKBA 2PGLA 2YJGA 3DAFA 1OLSB 1DC6A 1WXEA 4I5GA 2IGBA 3GDGA 3E23A 3CRMA 2EWMA 4MSUA 2EJCA 3N76A 4XCQA 5JVDB 1KTIA 2Z95A 2E5LB 4E31A 1EUCB 3RTEA 1G8PA 3ZV5A 1FYFA 2VOEA 1JH8A 2FMHA 4UMFA 4B6PA 3WLNA 3IODA 1KEVA 2RHGB 2VYVD 3GEEA 2PGJA 4OMUA 5KMGA 5F4BA 3N07A 4OGFA 4UOZA 5IXJA 3T5AA 3GRRA 4RK7A 2VTEA 3IJEB 5IH7A 3PPXA 3MB5A 4MQMA 4C6TA 2ZJ0A 4IIJA 3HBFA 1IUPA 2IODA 3K9HA 1M2NA 3O8QB 1K8YB 2EWWA 1ZI6A 3E48A 1PSDA 3OKPA 2JFXA 3AR9A 4KE8A 4QQFA 4WD3A 5AM1A 1ODFA 4MEJA 3RJTA 2DY1A 1AKUA 4JJIA 4OXYA 2G77B 3E0XA 4WBNF 5SZHB 5I7SA 1ZH6A 3UW3A 1QRUA 5IS2A 1SUCA 4KQ6A 1MO3A 5CPBA 5D01A 2B1QA 3NC4A 1TMYA 5IBQA 4D9CA 3TXAA 4GICA 5AVUA 4TMYA 1NAIA 3TKYA 4JR0A 1T5OA 4M0LA 1N0HA 5ES3A 5EXTA 3QPUA 3R23A 5JY6A 2EFGA 1JDJA 2D8MA 1UPFA 1QTIA 2WYWA 3UATA 2XVAA 1X94A 3OIYA 5E3HA 1KO5A 1ZJ6A 1PE0A 3BRSA 3DZKA 3FAZA 2SNIE 3BL5A 4GPAA 4J76A 4TMKA 5GIPE 1CS0A 4UPDA 4GUAA 4D9HA 2X15A 4OYYA 3C3KA 3ZWNA 4EGAA 1QYWA 3NXKA 3D4BA 1Z0UA 1CJTC 2IYTA 3GU3A 2TMYA 2GDJA 2X9LA 3KFXA 4R54A 4JC4A 4BPRA 1RKUA 2H8GA 3AY7A 1SUBA 2CJFA 3GR6A 3KU1A 1Y3IA 1NBMA 1OBVA 1LF5A 2O0JA 3OOWA 4JYCA 2AOXA 3KZXA 4FW8A 1U7HA 1VLHA 5ADVA 1A97A 4KFSA 3VU9B 1H4TA 1VJ0A 1I4DD 1Q0SA 1I6WA 2W6QA 1EFAA 4E4YA 3EAFA 3EDRA 1CZNA 1NUTA 1LZLA 1QO7A 4INPA 1S2MA 4LCEA 4RC9A 1KFKB 5CH5A 3WYNA 5IDQA 3DYIA 3INNA 4BNNA 3Q3EA 2JFGA 5IWAB 3BCHA 1GOTA 5JSHA 1H0HA 1YDEA 2CFOA 3N7UA 1IMJA 3IJ5A 1IVSA 1GAWA 4YALA 4P9NA 2I2DA 2PDAA 3SCZA 3SZUA 1LPOA 4Y2QA 1LQ2A 1PZHA 2EHDA 4GBJA 1QRSA 5EJMA 1YDHA 5JECA 3NHSA 3MNFA 4HUQA 3AVUA 2WD9A 4OQZA 4UD6A 3U9TA 1C7ZA 4NNJA 3PZBA 4IHJB 3FZQA 3OA0A 1ZPDA 4NH4A 3RJMA 4OI2A 2VJLA 1CRPA 5EP3A 3LHDA 3F97A 3PWTA 1I8TA 4P1ZA 2AG5A 1MC5A 5BSTA 4L5AA 4IOMA 2KSQA 3ETNA 3GFTA 1M2HA 1QYXA 3ELDA 1PTJC 2BCEA 4U6QA 3UJHA 4CG3A 5FB3A 4OHWA 3I2IA 4TT3A 4G0UA 4Z0NA 4PHHA 4H3SA 4YRKA 2VDWA 2AFHB 4LXYA 3PQ2A 2J33A 4DIFA 3SR0A 1T6XA 4EG4A 2ZYDA 5EWJA 5L6MB 4QOIA 3AW9A 3JZDA 4LHEA 3X3HA 4RHYA 4ZQHA 3WGZA 3DDCA 1UEIA 3DTNA 4CR7A 4HLUC 2GFIA 3CVYA 4LZLA 4KK4A 4R8SA 3PNYA 4JBGA 2J59A 2D3TA 3S28A 5L3QA 4BQQA 1MIOA 2QMUA 1ZLXA 5ITZA 3SAJA 1J7JA 4FQ5A 4WK0B 3JYQA 1K8QA 3A05A 3DD5A 3GDWA 4WESA 1ZK4A 3ZV4A 3QBDA 2FUG1 2B0JA 4BX3A 2X6QA 3W06A 2ZUUA 1KDTA 3NORA 3R3VA 5KYUA 4YP6A 5AVRA 3MGAA 2HZ7A 4RKRA 3WGJA 3CNEA 1J1ZA 3KYJB 3M89A 3LHKA 2X2OA 3PFKA 2PWBA 1IJBA 3D31A 3IA7A 3JU3A 4U7PB 2Z4RA 2OXTA 4GBED 3ZXIA 1A9XB 1JAYA 3A7DA 1P7VA 3RU3A 1M8PA 2HRCA 2OL4A 3K0BA 1SHZA 4UNSA 1SBNE 2GK7A 3RFVA 1JDPA 1U5BB 3LKBA 4O8CA 3HBAA 3UMBA 3IVCA 4BP1A 5HHTA 2IU6A 3UKOA 2BKEA 2AYYA 1IN4A 1WR8A 2GN6A 3FWYA 2JLZA 4TUYA 3WGMA 4D9JA 1JXOA 4HZUB 5HJ7A 4PAWA 4RVHA 1AMOA 3FFXA 2G9QA 1VKRA 3KQOA 2TS1A 4G37A 1F0NA 1NBEA 4FFVA 3UJDA 4XB6B 3LCVB 3U3KA 3KBBA 1IULA 4HSGA 2HLHA 1OXMA 1J06A 1E2GA 3DKPA 1IG0A 3AUYA 1DQSA 5FF9A 3TW6A 1I4OA 2PFSA 1GGEA 1H22A 2NQTA 1V1MA 3PEFA 4X7BA 4XZ3A 1WSAA 3BCRA 3FUCA 1XL1A 4CV0A 1X3SA 1NXQA 3ANXA 4Q3LA 3OZ7A 4YXFA 3AHJA 2ADMA 1CJCA 4JGGA 1Q0HA 2WJPA 1QV9A 3V1LA 4D4IA 2OM6A 4EP1A 1JQ3A 1E64A 2HSWA 2O7NA 3BRWA 3D5EA 3UV7A 5JALA 2FGJA 3BIXA 2O2DA 3DOEA 3NUGA 1P39A 3PDUA 4IX1A 3TZCA 4D8VA 4CVNA 5JAMA 2CLSA 1THZA 1Q17A 4YMSA 1K6XA 5DSTA 4IXWA 4DLVA 1ZEMA 3MHPA 2I6FA 1Z5OA 4F06A 4FKMA 2BKUA 2BMAA 5AVXA 2J7PA 1Z38A 2PUJA 1YRHA 3OVMA 3QXHA 4PR0A 3V7WA 3FPJA 4EY4A 1NHGA 1FDSA 1SUEA 2DFNA 3FPKA 3GEHA 3PWZA 4LY6A 4QVGA 2QRVA 1QIFA 3S0JA 3VR3D 4JI0B 1VPTA 1T4BA 3QQ5A 3QRWA 3CONA 1HSOA 4ZTUB 3GZNA 1E6WA 4JL5A 3OIUA 5IJ0B 1Q7BA 4W1QA 3KVOA 3DXZA 1R6UA 4LOKA 2VRCD 5EKTA 3NLLA 3LSYA 5DT9A 4GKVA 3R5FA 1TVEA 2ZIEA 5HQJA 3OQNA 1ENPA 2BHSA 4A15A 2GN2A 2CJWB 2GARA 1NJ1A 2HF8A 4R8KA 3QOFA 3M6UA 3RAPR 3SQNA 4ZAVA 2ZPAA 3OU2A 2HKIA 3Q4GA 4ZO4A 5K2OA 3D2LA 5IUJC 5GADl 5K45A 4PTZA 2RGXA 5CVDA 2XMRA 4DEVA 3C5VA 1W88B 1DBRA 4CI0B 2NU9A 2JJ2D 5TGZA 4IDGA 2RAFA 5ESXA 4KQKA 4GGMX 1WXDA 1VP9A 2P7HA 2FFRA 2HBZA 3LM8A 3WLPA 3PJGA 5KOHA 1E3SA 1BYUA 2GKGA 1W59A 2IOHA 4B73A 1TYAE 3LX4A 2TMKA 3LQFA 2I62A 3D0KA 5HE8A 5CDYA 3K5HA 5EPUA 1J8FA 3H83A 3PXBA 1WV1A 4K03A 3K70D 3HL0A 3MT8A 2AW3A 4EFKA 4Q4AA 1LRLA 2WPDA 5IJ9A 5KYGA 2E1RA 3RG8A 5FFMA 3NJRA 3TE6A 3O8BA 4UUQA 5L53A 4RCZA 4HGQA 4XGKA 5KDOA 3QXXA 3W5JA 3KJHA 4XX0B 1ZMRA 3T3IA 1FP7A 2WNSA 2G0TA 3EQ8A 4YVFA 3VUFA 1NHWA 3OUZA 2WLSA 1CTQA 1W25A 3CUEF 4IYJA 5E2IA 4C22A 1OLUB 4EHFA 2RAPA 1SIBE 5DNCA 2CHUA 2R66A 2XX3A 3WGNA 2V5AA 4BX8A 3PA6A 1IMOA 4UTRA 1RFLA 1QFYA 3B1FA 3LE8A 1PWXA 3EXIA 2P0EA 4AS1A 4WIAA 2H4ZA 4PSKA 3DUFA 3F7OA 4J0FA 3Q88A 2F62A 4YAFA 5AIAA 3JQGB 2X7XA 2YWDA 2HLDD 3F6SA 4RO0A 2WUVA 2FPSA 2WKPA 3QBTA 2PM8A 3D7KA 3V2IA 1ESMA 2N46A 1IPFA 1A5AB 2AQHA 2E18A 3P97A 4E2YA 2C07A 1EWTA 3H7IA 4L08A 4N7JA 1U2DC 3E58A 4D4JA 4HAYA 1M34B 4HC4A 5CX4A 4GGPA 1V9CA 2HIAA 3B1KA 3LJKA 3CVXA 3NTUA 1XD9A 1QR2A 2FWNA 1RBYA 1X3LA 1WM1A 2YZKA 4F0JA 5BPFA 2VLIA 2VJDA 4AQ7A 1PGQA 4LN1A 3TG2A 1MT3A 4TROA 3I6QA 3GRFA 3QPCA 3PUVA 3RTBA 1VOTA 2ATVA 1IDOA 1X14A 1Z4MA 1UQRA 1DKPA 2R87A 3VI3B 3ZE9A 5IHPA 3E9EA 4AW9A 1QFSA 4UDNA 5FI3A 3RS2A 5IKXA 4D56A 3VSBA 3IHLA 2NV2B 4ID9A 2XLBA 4Q1BA 1JFTA 2O19A 3HA5A 3GB9A 2FSIA 2F1OA 4JCCA 1C9KA 2FR1A 3V1TC 1IB0A 1Q3HA 1CR0A 2F67A 4O4LA 2I67A