2PVDB

Crystal srtucture of the reduced ferredoxin:thioredoxin reductase
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
73
structure length
73
Chain Sequence
b'MNVGDRVRVTSSVVVYHHPEHAKTAFDLQGMEGEVAAVLTGWQGRPISANLPVLVKFEQRFKAHFRPDEVTLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-thioredoxin reductase, catalytic chain
publication title Structural snapshots along the reaction pathway of ferredoxin-thioredoxin reductase.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Electron transport
total genus 11
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02941 FeThRed_A Ferredoxin thioredoxin reductase variable alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2pvdB00
3QYHB 1GXIE 2ZPIB 3X24B 2DXCA 4OB2B 1UGPB 4RKUE 2QDYB 2ZPHB 4ZGEB 1UGSB 3A8MB 4OB0B 2CZ7B 1IREB 2DD4A 5L8RE 3A8HB 2D0QB 2PUKB 3WVDB 2CZ6B 2WSCE 1AHJB 4ZGDB 3LW5E 2PVDB 4OB3B 2PVGB 3VYHB 1JB0E 4KT0E 4FM4B 1DJ7B 2DXBA 3HHTB 2ZPGB 2CZ0B 4OB1B 1QP3A 3A8OB 2CZ1B 2WSEE 2ZPBB 2WSFE 2ZCFB 3X25B 2AHJB 3A8GB 1PSFA 4ZGJB 2PUOB 3QYGB 1V29B 2PU9B 3A8LB 4L6V5 3X26B 4XK8E 2ZPFB 3QZ9B 3WVEB 2PVOB 2DD5A 1UGQB 3X28B 1UGRB 2ZZDA 3X20B 4Y28E 3VYGA 2DPPB 2O01E 1QP2A 3QZ5B 2ZPEB 2CYZB 3QXEB 1PSEA
chains in the Genus database with same CATH superfamily
3QSUA 2E3HA 1GFDA 2KDSA 1Y07A 4OMOA 2LJ3A 4BUGA 2CP7A 1JJ2P 3CCRA 1H8KA 3QJ6A 5CKEA 1GRIA 3QKJA 1VQ4T 2VV5A 1XTDA 2BZXA 3OS5A 3DLLA 1K4US 2PNIA 1H92A 1FYNA 2AKKA 3OBWA 3JAME 1WXTA 1IRXA 3RBBB 3BDUA 5CKBA 2AIRB 2D0NA 3O5ZA 3VV0A 4M7AF 1AZEA 1MV3A 4M75B 5L23A 2V1RA 1BCMA 4M77D 3AT1B 1UEBA 2LCLA 4QW2A 1VQOT 1K8AR 1KQ2A 2RHUA 2NUTA 1VQOA 1AD5A 4DBFA 4XU0A 3G71T 1PNJA 1UHCA 2VKNA 1QVGA 4C92B 1D0ZA 2EKOA 3EHQA 2J6KA 1UB4A 2IIMA 4GY5A 3MPUB 2GBQA 1VOMA 2LQKA 1K9AA 3RMSA 3CCQQ 5LJ5j 3R6NA 3L2QA 1BCOA 2GQVA 2A7YA 2VGNA 2BZ8A 2P84A 4M78E 1K8AC 2YXYA 1Y96B 2J6OA 4RUGA 3BFMA 3OYEA 4RTYA 4C8QA 2DL7A 1ABQA 1KG1A 1AT1B 2HKNA 2ECZA 2H3EB 3CMAQ 2XICA 4A53A 3UA7A 3FDRA 3L2UA 2QK0A 1IHVA 2DE0X 1BI2A 1AEYA 4KGVB 2VASA 1BIBA 4J5YA 4HVVA 2LDMA 1D1CA 2JJ9A 2YUPA 1TH7A 2C06A 2VWFA 2K5FA 2EYZA 1W2BP 2DL8A 2F5TX 8ATCB 2O4XB 2DAQA 2COZA 2DETA 4M7AB 2I2LA 3REAB 2DILA 2CKKA 2L3PA 4RTTA 5GANe 3CCJT 2BKDN 3M0UA 3VS3A 3CCJA 1G3YA 2QAZA 3EFRA 1UDLA 5GANf 1M2OA 4DOVA 2XDBA 5CQXA 3NTIA 3LH5A 1VQKQ 2RHIA 3G6EQ 2L3RA 2DZCA 2K5IA 2P0PA 2EQJA 1VQMQ 2XI9A 5LJ3d 5KYXB 4J9EA 1U8RA 1YIJQ 4Y91A 1U06A 2KXDA 3L2ZA 4M75D 3TSWA 1VYUA 1YJNT 2BE9B 4FSXA 3VJPA 3CCVA 2FRYA 4KUIA 1YJNA 3SB2A 1QWFA 7AT1B 4PJMA 3CMAT 3EFSA 2CP2A 4F7UE 3JB9D 3MKDA 4JRKA 3E9FA 2JZ2A 3OB9A 1BK2A 2PVOB 2KEAA 2K57A 4C92D 2RQVA 5GAN7 1YI2Q 1U1TA 3JCMV 2RI3A 1WJQA 1GBRA 1CKAA 2LT1A 2GNCA 2CT3A 2DX1A 4XTUA 1VQPQ 5LJ5h 2E1HA 2EVRA 2PZ1A 3MP6A 3V8LA 3VU3C 1NLOC 1TWBA 1WZOA 5CK9A 2FRWA 5FWBA 4RCBA 4RTZA 4PJOG 1BKBA 1TG0A 4HT8A 2LQ8A 2RN8A 4KH0B 4BDYA 1QVFP 2DXCA 2LQWA 4OB2B 4C5GA 3M0SA 1OOTA 2MYSA 3EG3A 1WX6A 2CDTA 2KRNA 1G5VA 2DXUA 3RERA 1IREB 1C0MA 1QKWA 3CCUT 2WSCE 3RIRA 3CCUA 1UUEA 2LX7A 3PT9A 2QGFB 2JT4A 1JXOA 3QBYA 4FYXB 4M77C 1VA7A 1MMDA 4XU3A 3UPUA 2X4WA 4X9DA 5IHIA 3CXCP 1UFFA 2GTOA 2DVJA 2J7IA 1M1KC 4F17A 2HAXA 3AHUA 1V76A 5IXFA 4JZ3A 4M7AD 1LPLA 1OU9A 3QPHA 2EJGA 2Y4YA 1ZA2B 2HSPA 3G7ZA 4LDWA 1D0XA 3CCET 2EW3A 1PSFA 1NBEB 3QYGB 2GTJA 1V29B 3OS2A 2M9UA 2DYIA 4ZTJA 4V2SA 4EMKB 1R8OB 2H3JA 3GNGA 1YJWT 3WVEB 2LQNA 4C8QE 1ZUYA 4FSSA 4DEYA 3CPFA 2RMOA 4PNOA 1AVZC 3JCMX 2HSEB 2VC8A 4O6JA 2DL3A 5J39A 2CH4W 3LH0A 3L1AA 2OTJT 2O9VA 1RUWA 4J83A 5I11A 2OTJA 3MEUA 2YUQA 2QEXQ 2Y4XA 5IT9E 4XAXB 1SEMA 5LJ3e 1SHFA 5HK3A 3HP9A 1M27C 5HY6A 2FPFA 3CPWA 1VQ7Q 1ZHIA 5GAMj 2YDLA 2EBPA 3CCST 2XK0A 5GAOl 1I81A 2D0QB 3CCSA 1QVGS 4JJCA 1B07A 5FU7C 3JCMP 2JM8A 1PM3A 3TU4K 2LP5A 2QA4Q 5CCAA 4M77F 4OMMA 5IXBA 1EFNA 3CEYA 2RO0A 2W10A 5GMKl 5FWCA 1X01A 2QQ9A 1QWEA 4C8QD 1BI3A 4IUQA 4C5IA 2YRDA 3V7SA 3A8OB 3I9QA 1W2BA 2LJ0A 2EIFA 2MWOA 1Q82R 2YLCA 1PG5B 1RAAB 3X25B 4M75C 2KQWA 3HFNA 5KYWB 4DOWA 2CSIA 4JJDA 1U1SA 2K6DA 5GMKj 4OGEA 1KQSP 2K3BA 4WCIA 1V1CA 4QT7A 3VS0A 4D6WA 4XU1A 2CREA 5A0DA 1YJ9Q 3REBB 2EQUA 4F14A 5GAOq 3INZA 1SG5A 2OI3A 4CC2A 4C92C 1FMVA 4DBQA 2R5MA 1Q81U 1Y71A 3L42A 3OYAA 2FEIA 1VQNA 2DEUA 4RCCA 2VXFA 4RG8A 4XU2A 4AFQC 1O75A 1Q82C 5A0GA 2E41A 3DB4A 1TS9A 5CR2A 2F5KA 1ZSZA 2DL4A 1RAEB 5CVIA 1NYFA 1KK7A 1CKBA 4XTVA 3JCMb 4LUDA 5KE3A 3JCMd 2K2VA 4Q5WA 1I5OB 5LJ5e 4E2FB 3MEVA 3FLGA 1VQ6A 3NFCA 2P0QA 5GAOr 2EYYA 2OAWA 2VGMA 3BDLA 2HDAA 2FL7A 2HEQA 1NEGA 4KULA 1OYXA 3KBGA 3L2WA 4PJJA 1LNXA 3VS7A 4N0AC 2RQWA 2RH2A 3OS0A 5GAMh 1YFNA 1QQJA 4OP0A 4QQGA 3JCMc 2KNBB 4DBRA 2RJCA 2MWPA 3QDFA 3OBYA 1U5SA 3GNFB 4C5EA 4E7ZA 4M7AC 1YWPA 1VQ5T 2QTVA 4ZN1A 5CKFA 1NJIU 3EG2A 5GANg 1WHLA 2XG8D 1KC8U 1JBMA 5HK0A 1VQ5A 2J06A 3P8HA 3GBQA 1K73U 2DF6A 2VYTA 1IXDA 1VQ4Q 2QQRA 5GAOm 3I56A 2JN0A 1VQ9A 1KHCA 2A36A 3JB9F 2I0NA 4BY6B 3JB9I 2K2MA 2E5KA 2L5QA 2FZGB 5GJVB 3LGFA 5GMKm 2AK5A 1T3LA 3QXEB 2LCCA 5IN1A 1VQOQ 4LXCA 3CQTA 3HKSA 1C1AA 4DEXA 2P4TA 2QYZA 1ZSGA 4JRIA 3O8VA 1PD0A 2C0OA 1BYMA 3G71Q 5IAYA 1UGSB 1RLPC 2PUKB 3WVDB 2MAMA 2KI7A 3CC7A 3OYJA 4FT4A 1TOVA 3CCRT 4FYWB 1PRMC 4IUVA 2RJFA 4F16A 5GAOp 1I1JA 1IHWA 3I5RA 1NE8A 3P8DA 1M1GA 4O5VA 2KVQG 5AYFA 3OYMA 2DLPA 2HZYA 1BI0A 3FJPA 1RACB 2HBPA 1SKUB 2O31A 4PJLA 1ABOA 5KH6A 2OAUA 3T9NA 2DNUA 3P8BB 2EKHA 1OI1A 1BB9A 2DFUA 3EG9A 4J9CA 2KY9A 4BI4A 1IZ6A 4M78B 2OTLA 3BE3A 2ESWA 3CCLT 1JRIA 3V7RA 3U23A 1T3SA 1LVKA 3CCLA 2P4RA 1NZ9A 2NUPA 2EGCA 4XTWA 3JCMe 1G2BA 3EGUA 4XTZA 2E12A 3X26B 1NPPA 2B86A 4GBQA 1UGVA 4JUVA 2F2VA 2YRVA 3CPWS 3EGXB 4PKCC 2HBWA 3A98A 1K9MR 4MZTA 2QXFA 1OX8A 1UGRB 3MHXA 4WTOB 4Y28E 5GAN3 2DPPB 3CCJQ 3VS5A 1YHQT 3SDZA 3KUFA 2CYZB 2JXBA 1VIEA 1JXMA 1YHQA 1Q86R 2EJFA 1R0CB 1I4K1 4ESRA 2ZPIB 5LJ3h 4EMKC 1QCOA 4ELZC 5EC7A 3S6WA 5GAN8 2D6FA 4TVRA 3SWNA 4RKUE 3META 3PMTA 4JLIA 2L3QA 3E1SA 4ATOA 3VRZA 4J9HA 2E70A 2EQKA 5A0LA 2MIOA 5L8RE 1YJNQ 3L2VA 1I0CA 2JTMA 4RG2A 1XJWB 3C12A 3TQ7P 1W2BS 2QG9B 1JQQA 1QMCA 4XTXA 1YN8A 1B3QA 1K9MC 1X6BA 2JMAA 2RQTA 4KT0E 4WF2A 1G83A 3E19A 4FM4B 5FW9A 4BB7A 4C0ZA 4HVWA 1AZGB 1Q86C 1CSKA 1UECA 2D9TA 3OW2A 4LDUA 4F7UB 2CZ0B 3V8KA 1B34A 2YLBA 5D7UA 2DTIA 4C8QF 5KYYA 3M0QA 3CD6T 1Q95G 2ENMA 4M7DA 3CD6A 1FX7A 1YP5A 2XDPA 2FPEA 3H9NA 1O9SA 4A4KA 5GAMe 4PL6A 1I07A 1BIAA 2KRSA 2X4XA 4ZGJB 4HT9A 1T0HA 2PU9B 3A8LB 3QHSA 4L6V5 2DMOA 3VS4A 2X4YA 3EHRA 3OSSC 2RHXA 4ELYC 3CCUQ 4MZMA 1RADB 4M78D 5FU6C 3PGGA 4P5NA 3HRTA 2DD5A 2MI6A 2F2XA 2X9HA 4BE1A 3CCVT 1M90U 1M5Q1 2X3XD 4LUEA 4F04B 2RNAA 1WNLA 2QASA 4RMOA 2DO3A 2CS7A 2ZPEB 1PRLC 1PSEA 2DJZA 4ZTFA 2DJQA 5CKHA 3OQ5A 2KAFA 2NUTB 3DKMA 1AWXA 3EGDA 2E65A 2KROA 2AZVA 4LN2A 1D3BA 2JUFA 1WPYA 4M77G 1UGPB 2DKGA 2GGRA 2QDYB 2RF0A 3A8MB 1QVPA 4IUUA 1X2QA 2A3LA 1GBQA 4X1VA 1JEGA 2V8KA 2B8AA 2CZ7B 1XNIA 4QVZA 2AZSA 4L59A 5GMKe 3CCEQ 2OX7A 4OMFB 1UJYA 2DM1A 1F1BB 1H3ZA 2PVDB 2A08A 2LX9A 3HPWA 5IHKA 1X6OA 1JB0E 1AWJA 3CMET 1OULA 4ME7A 3GF5A 2HQXA 1YJWQ 3RESA 3VRYA 5FRMA 3CMEA 4FCYA 3MJXA 1DJ7B 2RPNA 2DVEA 1K1ZA 3EFOA 4J6YA 1OV3A 1GL5A 1M3AA 2CT4A 4C8QB 2OTJQ 3JCMJ 1N8RR 1VUBA 2WSFE 5J26A 5KYUA 1JJ2A 3S3NA 1QKXA 1VQKA 3NTKA 4M4ZA 4BI8B 3C0CA 3M4GA 4LDXA 1QCNA 2FZKB 1KIKA 3CCSQ 5C6SA 2E10A 2X3WD 2H8HA 1X43A 2RJEA 3NPFA 2ZZDA 2P0KA 3KFVA 1VQ8T 4PFPA 2QQSA 3H41A 2G6FX 2CP0A 1N8RC 1VQ8A 2ED0A 5IHNA 1RAFB 5DY9A 3SEMA 3M54A 1LJOA 3J7AF 4J9DA 3PTAA 4Z89A 3FEOA 4BY6C 1NPRA 2IVWA 3CCMT 3OS1A 4NL3A 3NHNA 1YCSB 1VQPA 5KE2A 3CCMA 1X2KA 3E9GA 2CZ6B 1H3HA 2RK1A 1PCXA 3UDCA 3OSVA 2CP6A 1MV0B 4GLMA 1C6VX 3C94A 3OYYA 5DM7R 2IPOB 4M75G 2NUZA 4YTLA 1K0XA 2NYSA 3ER0A 9ATCB 1VYVA 5LJ3f 2QGGA 4E6RA 1RAGB 1JU5C 3EAEA 2FB7A 2V8JA 3M55A 1TUGB 3DLMA 3ME9A 4M7DE 3M4YA 4CC3A 4IIOA 4R55A 1FXXA 1KJWA 4B9WA 1D0YA 1BU1A 3JB9G 1VQLT 2NLUA 1JO8A 3OYGA 4JDSA 2XHCA 2CZ1B 3TVTA 1VQLA 4HCZA 2COWA 4C92G 1SF9A 1AWOA 3A8GB 3FB9A 1IGUA 3URGA 2K3XA 1Y57A 1YITT 5GAN4 1YITA 2Y90A 2D8JA 3JCMh 2MF2A 4PJOA 1KD1U 3F70A 5FU6B 1VIFA 2RM4A 2EJ9A 4AFUC 1FMWA 3PVQA 3LWIA 5ECAA 5CIUA 2QDLA 4M78C 4R0KA 2BUDA 1K0SA 3C4SA 2O01E 1WA7A 1X6GA 1HD3A 2JTFA 1KHIA 1WHHA 2LTOA 1WHKA 2VVKA 4VUBA 2A0FB 1M1KU 2DBKA 8AT1B 1ARKA 2D8HA 4FW1A 2LMJA 3PVLA 2F1LA 1YWOA 3S3MA 1R77A 1RL2A 1S72T 3OW2S 2KK4A 3JV3A 1VQNT 4M7DD 1S72A 1SPKA 2DD4A 1OZ3A 1VQ5Q 4KBMB 2MMPA 3TEEA 2KXCA 1IB8A 4MDWA 4HCBA 1UTIA 3Q1JA 3LW5E 1SHGA 4KGXB 4M7AG 1WYXA 4OVAA 1N6AA 2O2OA 1ZLMA 2PVGB 1VQ7A 2DYBA 3RNJA 3LYIA 2LCSA 1N9RA 2LJ1A 4BI3A 4RTUA 3JRZA 1VQ6T 1GCQC 2QTXA 2GCXA 3QWXX 4OB1B 5GAOn 1N27A 4J8OA 1M1FA 2ZCFB 5LJ5f 2ED1A 2EAYA 3MCAB 4AMCA 1FMKA 2AHJB 5GAN6 2KYBA 1H641 4J7FA 3VUZA 1QVFA 2YWWA 2K9GA 2X4JA 1S1NA 1WDXA 3HRUA 4QVDA 4LDYA 4E7LA 4M75A 2AKLA 3RKWA 2L3SA 2ZPFB 2FZCB 4JS4A 3M59A 1G3TA 1ZBJA 2KT1A 4XTYA 3CC4T 3UWNA 4KUDK 1AWWA 3CCRQ 4M78F 1QW1A 2L2PA 3CC4A 4DBHA 2DIGA 3I56T 2A37A 1VQ9T 4BE0A 1PWTA 3HL8A 4B6MA 4JLGA 4NS5A 4C92A 3CXCA 2K5LA 2IG0A 3TREA 2LC4A 2RQUA 2MPXC 5CKDA 2JW4A 5DLQE 4NL2A 4OB0B 4JS5A 1W1FA 2DIQA 2FPDA 3CCLQ 3RKYA 2ROLA 5HKCA 4FIBA 5GMKh 2JVVA 1OU8A 3ZEHA 1HSQA 1JJ2S 1Y96A 2DBMA 2DRMA 1TUCA 4M77E 3QIIA 2LNHB 1EIFA 4E7JA 1ZQ1A 1LCKA 2CUBA 3HHTB 4D8DA 3CC7T 1X75C 4OMPA 1MMGA 1NM7A 1YHQQ 1G8XA 1M30A 4D8KA 1ACMB 1QP3A 1RI0A 3M5AA 4N0AA 5GANd 4E47A 2F69A 4E7KA 1Q82U 4J9IA 3QDRB 4EIKA 4PJOE 1ZSZB 3QO3A 5GMKi 1M90R 3L2RA 1Q7YU 4N4HA 1NEBA 2HCKA 1R0BG 3SWNC 1PKTA 2CP3A 2O4XA 1NG2A 2DTOA 4M7AA 1UG1A 4E7IA 1WJRA 1UE9A 4F7UF 3CC2T 3OYIA 2YSQA 5IH2A 1OQKA 4K11A 2L0AA 3CC2A 4C8QC 4UC4A 1TUDA 3QG1A 2OTLT 5I2MA 2FVUA 1WLPB 3VYGA 1MNDA 4AG1C 4MZPA 1VQ4A 2VB6A 2DERA 3I55T 1YCYA 3SFMA 5FROA 3I55A 3OYNA 4A63B 3MP8A 5KYXA 2LVMA 4ZN3A 3PFSA 4ANJA 4HVUA 3UATA 1UJ0A 3JCMf 1OX9A 3X24B 4BDZA 2YT6A 2V26A 1M90C 4MMKA 2R57A 3PIPA 1J3TA 2YUOA 2RJDA 1P92A 3EH2A 3TCJA 4OMLA 4EDUA 5LL6S 1MMNA 4AG2C 3M57A 3GOXA 3CD6Q 4QVCA 1SRMA 1PD1A 1M8VA 2F2WA 1W70A 3G4ST 4M7DC 4LDVA 4LD9K 3G4SA 2SRCA 4ZGDB 3QJYA 2J6FA 4MDXA 3SHWA 4DA4A 1UHFA 4C0FA 4OB3B 3G1JA 1KQSA 3G71A 4PJOD 4AFZC 2JMCA 2AT1B 1ZBXA 4OMQA 1WI7A 2KBTA 1SSFA 1E7OA 4LD6A 2GFUA 4A4FA 3CCVQ 2ZPGB 2LNVA 2K7AA 3UT1A 5D6WA 3LLRA 3CPWP 1RAHB 2WSEE 2CSQA 3JCMW 3RDVA 5LJ3g 4X34A 5GJWB 4M75E 5CAIA 5CO7A 5CQYA 1T0JA 3LX7A 3TSZA 2EQMA 2X35A 1EZZB 1WXUA 2MK5A 4J7IA 4FYYB 5EG2A 4J9GA 4HCKA 1W4SA 3C95A 3VS6A 2CP5A 4A54A 2KSSA 2DTHA 4BD3A 4C92E 2XIDA 3X20B 3JB9J 5DLOA 1PC0A 2NWMA 3CMEQ 4EMGA 2YHTA 2A28A 4RTXA 3KXTA 1M3BA 1GXIE 3OMGA 2RB6A 5GAMf 3CBOA 2EPDA 3EG9B 4IIMA 3H0HA 1WHJA 1Y0MA 1D1BA 2E6NA 2W0ZA 2C0TA 3CCQT 1D09B 4OF1A 3MP1A 2VXEA 4JRQA 1Z9QA 2EGAA 3CCQA 2OJ2A 4IURA 1E6GA 3V8JA 4EMKA 4M7DF 4LNPA 1BBZA 3OYHA 1M3CA 1OEBA 2NUPB 2GFAA 3RKXA 3MEWA 4PLIA 2V1QA 4NOYA 1QVFS 2ZAEA 2GF7A 2XKOC 2RI2A 2KYMA 3M58A 4CC7A 2DK3A 1RI9A 1WJSA 2RK2A 2O9SA 3JSCA 1WFWA 2QI2A 3LGLA 2E4HA 2Z0WA 4KGZB 1EX4A 4OGCA 1VYTA 4QQ6A 3ZBDA 2FO0A 3CMAA 2EYXA 4BE2A 1KD1R 3MO8A 6AT1B 1VQ8Q 3VUBA 2ZPBB 1HYOA 4M7AE 3OA6A 1B7TA 3NTHA 4MMLA 3SWNB 1K8AU 3V7CA 2PUOB 2VUBA 3EH1A 2QQBA 1M9SA 3CXCS 3A5ZB 3ASKA 3CCMQ 1M8MA 1M1KR 3PIOA 1D1AA 4FU6A 4OMNA 3RR6A 5LJ5g 1K9MU 1Z9ZA 5D6XA 1VQKT 3G6ET 3RMQA 1WQ7A 4C0DC 2PQWA 3N5BB 3OYFA 5FRNA 4RTWA 3G6EA 4C0GA 1Q81R 2CH4A 3M9QA 1VQMT 2D1XA 4IUTA 2L8DA 1OPKA 4XQ3A 1Q86U 1YIJT 3H0FA 3ZL7C 1KD1C 3H0IA 1VQMA 1M2VA 2ROTA 1HJDA 3QYHB 1YIJA 2J05A 2KMTA 2M0OA 1MGQA 1ZA1B 2JNGA 2M0YA 2R58A 1B34B 2RI5A 5KYWA 1U3OA 3GP8A 5AT1B 1VQLQ 5KYYB 4JPBW 2ZPHB 1WHGA 4ZGEB 2RQRA 4C5HA 4M7DB 2HL3A 2CUDA 1KQ1A 4BACA 2FG0A 2JM9A 1AHJB 2C0IA 4CI0C 1TTHB 1N9SA 2SEMA 1YITQ 2WACA 1X27A 1PKSA 3GLXA 1YI2T 2RHZA 2K4YA 3PMIA 2XDDA 2M16A 2COYA 4PJOC 1YI2A 1ZUUA 3VS2A 1KSWA 3I5SA 1Q81C 2JS2A 1Y7XA 1VQPT 2GQIA 4Y92A 3CCEA 4PJNA 3PNWC 3RUXA 5LJ5d 1GFCA 4HXJA 2PTKA 2DA9A 2M51A 3BW1A 2KR3A 2LRQA 3OY9A 2FYKA 1HK9A 4E7HA 2JS0A 1TSFA 4JZ4A 4M78G 1YJWA 3EG1A 3EGDB 1WQWA 1MUZA 1D3BB 2HKQB 1NJIR 1MMAA 1KFZA 4FYVB 4JRPA 1KC8R 4J9BA 4N4GA 1K73R 1TXQA 1S72Q 2E6ZA 3PE0A 1VQNQ 3FJ5A 3CBMA 4XK8E 1M4ZA 4FL6A 2E5QA 4M77A 3UF4A 2X51A 1PHTA 3QWYA 5GANj 1I5LA 5I21A 1A0NB 4N4IA 3FC3A 1HXDA 3NMZC 2QQAA 1ZSZC 4PK4A 1QLYA 2BZYA 2EYQA 1NLPC 4CC4B 1KQSS 2M02A 2EFIA 3DB3A 3EFOB 2XMFA 3SD4A 3M0TA 5I22A 4EPCA 1BI1A 1VQ6Q 2BIVA 1NJIC 3OYBA 4HKEA 1KC8C 3OYDA 5I2SA 4KRTA 1K73C 5KYUB 2LT4A 3FIFA 2JTEA 2MCNA 3A8HB 1G3WA 4FT2A 3J80E 1ZX6A 2G3RA 4Z88A 1QVGP 4E7SA 2KT8A 2V8IA 4AFSC 1M2VB 3JCMg 3THKA 3J81E 2YUNA 3OYCA 1LOJA 4PJOF 3R6OA 3IQLA 4ORZA 3CC4Q 1Q7YR 3CBPA 2QEXT 1N5ZA 4JJNK 1IGQA 2HQEA 2QEXA 1I8FA 1TU0B 2HD0A 4F7UG 3EG0A 1WHMA 1OPLA 2EGEA 2ZGWA 3D7SB 5M9OA 3OYLA 3I56Q 2XU8A 2RHYA 1N8RU 1VQ9Q 3FRNA 1VQ7T 1SRLA 4A4EA 1MNEA 1RAIB 4IKFA 3HFOA 4II1A 2DXTA 4GLKA 3OMCA 5KCOA 5D6YA 3HTRA 3M0PA 4RTVA 2RA2A 2ATCB 4HA8A 2O88A 4J6WA 1XOVA 2QA4T 5KYNA 3NGPA 3GIBA 3QZ9B 2QA4A 1WGSA 2KGTA 3JB9H 4EMHA 4IUPA 4DQ2A 1Q7YC 4C0DB 3I35A 4Z8AA 3X28B 3OW2P 1QP2A 1AOJA 4LE9A 1ZUKA 1YNZA 5FLXE 3ULRB 3QZ5B 4AT1B 1SSHA 4A4GA 2FHDA 2EWNA 3HRSA 2BTTA 2E64A 4M78A 2HQHA 3CC7Q 1FWZA 5GANh 4M77B 2DL5A 4Z02A 4KH1B 3GPLA 3VS1A 3M53A 3M0RA 4QKUA 2L89A 1RABB 3MEAA 4A4HA 3H6ZA 4B9XA 1YJ9T 2R5AA 1X69A 3LWHA 2HMAA 5GAMg 1YJ9A 3EGXA 1WXBA 1MHNA 4FW2A 2MOXA 3BY7A 1GCPA 4PJOB 4QQDA 3VYHB 4M75F 3CC2Q 3HSBA 1QCFA 2XD0A 4X9CA 3JCMQ 2DRKA 4PFZA 2OTLQ 2EYWA 2KE9A 2DXBA 3A1PA 2YRCA 1XQHA 1K76A 5J3BA 2ABLA 4HCCA 3H8ZA 5HCKA 3E2UA 4J9FA 1IO6A 4PFOA 5LJ3j 3I55Q 4C8QG 1G3SA 5GAN2 1W6XA 3OYKA 4ZNXA 3WXMB 4CRIA 3ZFJA 2M1HA 1OZ2A 2RD1A 4PLLA 4C92F 5C0MA 5KCHA 2CGHA 3S3OA 2HL5C 1GCQA 4R56A 1E6HA 1RLQC 2KRMA 4L5GA 2K79A 3QUIA 1NYGA 5GAN5 1WIEA 2BE7D 3G4SQ 3UA6A 2K3YA 5A2QE 2JOYA 2HNIA 4JJBA 2LZ6B 1UGQB 2DZ9A 1YBYA 3M56A 2E3IA 2EQIA 3VKIA 2DEQA 4F7UA 4M7DG 5GAMd 4J6XA 5FU7B
chains in the Genus database with same CATH topology
3QSUA 2QQSA 2VXFA 4RG8A 2KDSA 1N8RC 1VQ8A 1GXIE 1Y07A 3OMGA 1O75A 2RB6A 4XU2A 4BUGA 5A0GA 2E41A 5GAMf 5DY9A 1Q82C 3CBOA 3DB4A 5CR2A 3CCRA 2F5KA 3M54A 1LJOA 3J7AF 5CVIA 3PTAA 3QJ6A 2E6NA 3FEOA 5CKEA 4XTVA 3QKJA 4BY6C 3CCQT 1VQ4T 3JCMb 2VV5A 1NPRA 1XTDA 3MP1A 3OS5A 4OF1A 3DLLA 2IVWA 2VXEA 3CCMT 4JRQA 3OS1A 4NL3A 4IURA 3CCQA 5KE3A 1VQPA 3V8JA 4EMKA 5KE2A 4M7DF 3CCMA 3OBWA 3OYHA 3JCMd 3JAME 3E9GA 2K2VA 2CZ6B 4Q5WA 5LJ5e 3MEVA 2RK1A 3FLGA 3UDCA 3RKXA 3BDUA 2GFAA 3OSVA 1VQ6A 3MEWA 3NFCA 2P0QA 4PLIA 5CKBA 5GAOr 4NOYA 3C94A 3OYYA 3VV0A 5DM7R 4M7AF 4M75B 4M75G 1QVFS 2VGMA 2GF7A 3BDLA 2XKOC 4M77D 4YTLA 2FL7A 2RI2A 3ER0A 4KULA 3M58A 5LJ3f 1OYXA 3KBGA 1UEBA 3L2WA 2LCLA 2DK3A 1WJSA 2RK2A 1LNXA 3JSCA 4N0AC 4QW2A 2QI2A 3EAEA 3LGLA 2RH2A 1VQOT 2FB7A 2V8JA 3M55A 3OS0A 5GAMh 3DLMA 4OGCA 1KQ2A 3ME9A 2RHUA 3M4YA 4OP0A 4QQGA 1VQOA 4M7DE 3JCMc 4QQ6A 3ZBDA 4R55A 1FXXA 4B9WA 2RJCA 2MWPA 4XU0A 3CMAA 3OBYA 4C5EA 3GNFB 3JB9G 1VQLT 2NLUA 4BE2A 3G71T 3MO8A 3OYGA 4JDSA 2XHCA 1QVGA 2CZ1B 3VUBA 2ZPBB 1VQLA 4HCZA 4M7AE 3OA6A 4M7AC 4C92B 4C92G 2EKOA 1UB4A 1VQ5T 4ZN1A 5CKFA 1NJIU 3NTHA 4GY5A 5GANg 2XG8D 1KC8U 1JBMA 5HK0A 3A8GB 3P8HA 3FB9A 4MMLA 3SWNB 3URGA 1K8AU 2K3XA 1K73U 3V7CA 1YITT 2PUOB 2VUBA 2LQKA 5GAN4 2QQBA 2VYTA 1M9SA 3CXCS 3RMSA 1YITA 2QQRA 5GAOm 5LJ5j 2Y90A 3I56A 3L2QA 3A5ZB 3ASKA 3JCMh 2JN0A 2GQVA 2MF2A 1VQ9A 4PJOA 2A7YA 1KHCA 1KD1U 2VGNA 3PIOA 3F70A 5FU6B 4FU6A 3JB9F 1VIFA 2RM4A 2EJ9A 5LJ5g 1K9MU 3LWIA 4BY6B 3JB9I 5CIUA 4M78E 5D6XA 4M78C 1VQKT 1K8AC 3G6ET 3RMQA 1WQ7A 1Y96B 2BUDA 3C4SA 4C0DC 2O01E 2PQWA 3BFMA 3N5BB 3OYFA 2L5QA 5FRNA 3G6EA 4C0GA 2JTFA 3OYEA 3M9QA 1VQMT 1KHIA 3LGFA 4IUTA 5GMKm 2L8DA 4C8QA 4XQ3A 1Q86U 1YIJT 3QXEB 2LTOA 1KD1C 1VQMA 2LCCA 5IN1A 3QYHB 4VUBA 1YIJA 1M1KU 3HKSA 1KG1A 2P4TA 2KMTA 2XICA 2M0OA 1MGQA 2JNGA 2R58A 1B34B 2RI5A 4JRIA 3O8VA 4A53A 3GP8A 3FDRA 3S3MA 3L2UA 1BYMA 1RL2A 2ZPHB 5IAYA 4ZGEB 1S72T 1BI2A 1UGSB 3OW2S 2KK4A 4C5HA 1VQNT 1BIBA 4J5YA 1S72A 4M7DD 2LDMA 4M7DB 2DD4A 1OZ3A 4BACA 1KQ1A 4KBMB 1TH7A 2MMPA 3TEEA 2C06A 2PUKB 3WVDB 2K5FA 2MAMA 3CC7A 3OYJA 4MDWA 4HCBA 1AHJB 4FT4A 2F5TX 4CI0C 1N9SA 2O4XB 3CCRT 3Q1JA 3LW5E 2WACA 2DAQA 4M7AB 2I2LA 3GLXA 4IUVA 4M7AG 2RJFA 1YI2T 2CKKA 2RHZA 5GAOp 2K4YA 4OVAA 1N6AA 3PMIA 5GANe 2XDDA 3CCJT 2BKDN 2M16A 2PVGB 1VQ7A 1NE8A 4PJOC 1YI2A 3P8DA 3CCJA 1G3YA 1M1GA 4O5VA 1Q81C 2KVQG 5AYFA 3OYMA 1Y7XA 3EFRA 1BI0A 3FJPA 2HBPA 3LYIA 5GANf 1VQPT 1N9RA 4DOVA 2XDBA 5CQXA 3NTIA 5KH6A 3CCEA 2OAUA 3PNWC 3RUXA 4BI3A 2RHIA 3T9NA 3JRZA 2L3RA 3P8BB 1OI1A 5LJ5d 2DZCA 1VQ6T 2K5IA 2P0PA 2QTXA 2EQJA 3BW1A 3OY9A 2GCXA 2LRQA 2KY9A 4OB1B 2XI9A 5LJ3d 4BI4A 1U8RA 2FYKA 1IZ6A 5GAOn 1HK9A 1N27A 4J8OA 4E7HA 4Y91A 4M78B 1M1FA 4M78G 3L2ZA 1YJWA 4M75D 2ZCFB 5LJ5f 2EAYA 3MCAB 2OTLA 1YJNT 2AHJB 5GAN6 1WQWA 1H641 1JRIA 3CCLT 4FSXA 1D3BB 4J7FA 3V7RA 3VUZA 3VJPA 3CCVA 4KUIA 1QVFA 1YJNA 4JRPA 3CCLA 4N4GA 3SB2A 2X4JA 1NZ9A 4XTWA 3JCMe 3HRUA 2E6ZA 4XTZA 4QVDA 3CMAT 2E12A 4LDYA 3EFSA 3X26B 1NPPA 4E7LA 3CBMA 4M75A 4XK8E 3RKWA 1M4ZA 4F7UE 4FL6A 3JB9D 4JRKA 2ZPFB 2E5QA 3E9FA 3M59A 4M77A 2JZ2A 4JS4A 1G3TA 5GANj 3OB9A 4JUVA 2YRVA 3CPWS 1I5LA 5I21A 4PKCC 4XTYA 3CC4T 3UWNA 4KUDK 2PVOB 2K57A 4C92D 4M78F 4N4IA 1QW1A 3FC3A 4MZTA 5GAN7 3CC4A 2QXFA 1HXDA 1UGRB 3MHXA 1U1TA 4Y28E 3JCMV 2DPPB 2QQAA 5GAN3 2DIGA 2RI3A 5FU7B 1WJQA 1YHQT 2LT1A 3SDZA 2EYQA 3KUFA 3I56T 2CYZB 1VIEA 4XTUA 1VQ9T 1YHQA 4BE0A 1KQSS 2EJFA 3HL8A 5LJ5h 2E1HA 1I4K1 2EFIA 3MP6A 3V8LA 3VU3C 3DB3A 4JLGA 3SD4A 4NS5A 4C92A 3CXCA 2ZPIB 5CK9A 4EPCA 5LJ3h 4EMKC 4RCBA 2K5LA 4ELZC 4PJOG 1BKBA 2IG0A 3TREA 1BI1A 2LC4A 2LQ8A 4BDYA 4HT8A 2DXCA 4OB2B 3S6WA 2BIVA 4C5GA 5CKDA 5GAN8 1NJIC 4TVRA 3SWNA 2D6FA 3OYBA 4HKEA 4RKUE 3OYDA 1KC8C 3META 3PMTA 5I2SA 4JLIA 5DLQE 3E1SA 4NL2A 1K73C 4ATOA 1G5VA 4OB0B 2DXUA 2E70A 2EQKA 2LT4A 5A0LA 4JS5A 3RERA 1IREB 2DIQA 3FIFA 5L8RE 3A8HB 1G3WA 3CCUT 3L2VA 4FT2A 3J80E 2JTMA 4RG2A 2G3RA 3RKYA 3C12A 2WSCE 5HKCA 3RIRA 1W2BS 3CCUA 4FIBA 2V8IA 5GMKh 2JVVA 4XTXA 3ZEHA 3PT9A 3JCMg 1K9MC 3J81E 1JJ2S 1Y96A 3OYCA 1LOJA 4PJOF 4KT0E 3QBYA 3R6OA 4WF2A 4M77E 4M77C 3QIIA 3E19A 1EIFA 4FM4B 4BB7A 4C0ZA 4E7JA 3CBPA 2QEXT 1ZQ1A 1Q86C 4XU3A 4JJNK 3UPUA 2D9TA 2X4WA 4X9DA 3HHTB 2HQEA 2QEXA 1X75C 3CC7T 1I8FA 3OW2A 4LDUA 4F7UB 1M1KC 2HAXA 2HD0A 4F7UG 2CZ0B 3AHUA 3V8KA 2ZGWA 5M9OA 1B34A 2YLBA 3OYLA 2DTIA 2RHYA 2XU8A 4C8QF 1N8RU 4M7AD 1QP3A 1RI0A 3M5AA 4N0AA 3FRNA 5GANd 4E47A 2F69A 4E7KA 1Q82U 1VQ7T 3QDRB 4A4EA 3CD6T 3QPHA 2EJGA 2Y4YA 4PJOE 4M7DA 4IKFA 3G7ZA 3QO3A 3HFOA 1FX7A 4LDWA 5GMKi 3CD6A 2XDPA 3L2RA 4II1A 3CCET 1Q7YU 4N4HA 1PSFA 1O9SA 4A4KA 5GAMe 4PL6A 4ZGJB 1BIAA 2DXTA 2X4XA 3QYGB 3SWNC 4HT9A 4GLKA 3OMCA 2O4XA 1V29B 2PU9B 3A8LB 3OS2A 2M9UA 5KCOA 2DTOA 5D6YA 4M7AA 3QHSA 2RA2A 4HA8A 4L6V5 4ZTJA 4V2SA 4J6WA 4EMKB 1WJRA 1R8OB 1XOVA 2QA4T 4F7UF 2X4YA 3OSSC 4E7IA 2RHXA 3CC2T 2H3JA 4ELYC 3OYIA 3GNGA 3GIBA 1YJWT 3QZ9B 3WVEB 4MZMA 1WGSA 4C8QE 4C8QC 4UC4A 2QA4A 3CC2A 3QG1A 4M78D 5FU6C 3JB9H 4EMHA 3PGGA 4P5NA 2OTLT 3HRTA 2DD5A 2MI6A 3CPFA 5I2MA 4IUPA 4DQ2A 4BE1A 4C0DB 1Q7YC 4PNOA 3CCVT 3X28B 1M90U 2FVUA 1M5Q1 3JCMX 2VC8A 3VYGA 4O6JA 1QP2A 4MZPA 1WNLA 1VQ4A 5J39A 3I55T 5FLXE 2DO3A 4RMOA 3LH0A 1YCYA 2CS7A 3L1AA 3SFMA 3QZ5B 2OTJT 2ZPEB 5FROA 4A4GA 3I55A 2FHDA 1PSEA 3MP8A 2EWNA 3OYNA 2DJZA 2LVMA 4J83A 4ZTFA 2OTJA 3MEUA 3HRSA 2E64A 2Y4XA 3OQ5A 4M78A 5CKHA 4ZN3A 3PFSA 4XAXB 5IT9E 5LJ3e 2KAFA 3DKMA 2E65A 5HK3A 1FWZA 3HP9A 3JCMf 3X24B 4BDZA 1D3BA 1M90C 5GANh 4M77B 2JUFA 1WPYA 4M77G 4Z02A 4MMKA 2R57A 1UGPB 2DKGA 3PIPA 5HY6A 3GPLA 2QDYB 3CPWA 3M53A 2RJDA 1P92A 1ZHIA 3A8MB 3TCJA 4EDUA 5LL6S 3GOXA 1QVPA 2A3LA 3M57A 4IUUA 2L89A 3MEAA 4QVCA 2V8KA 4A4HA 5GAMj 2B8AA 2CZ7B 1M8VA 3H6ZA 3CCST 1XNIA 3G4ST 4M7DC 2XK0A 5GAOl 4QVZA 4B9XA 1I81A 1YJ9T 2D0QB 4LDVA 4L59A 4LD9K 5GMKe 2R5AA 3CCSA 4OMFB 3G4SA 1QVGS 3LWHA 4ZGDB 5GAMg 1YJ9A 1H3ZA 3QJYA 5FU7C 1MHNA 4MDXA 3JCMP 2PVDB 4DA4A 3HPWA 2LX9A 4C0FA 4OB3B 1KQSA 4PJOD 3BY7A 3G71A 3TU4K 4PJOB 4QQDA 3VYHB 1X6OA 1JB0E 4M75F 3HSBA 1ZBXA 5CCAA 3CMET 4M77F 4ME7A 2XD0A 1SSFA 2HQXA 3GF5A 3RESA 4X9CA 3JCMQ 5FRMA 3CMEA 3CEYA 2RO0A 1DJ7B 2DXBA 2GFUA 4LD6A 1XQHA 5GMKl 2DVEA 5J3BA 4A4FA 1X01A 4HCCA 2ZPGB 3H8ZA 4J6YA 2QQ9A 2LNVA 5LJ3j 4C8QD 1BI3A 4C8QB 4IUQA 4C5IA 4C8QG 3UT1A 1G3SA 5GAN2 3JCMJ 3V7SA 5D6WA 3LLRA 3OYKA 3A8OB 3WXMB 1W2BA 2WSEE 1VUBA 4CRIA 2EIFA 2MWOA 2WSFE 5J26A 2M1HA 1OZ2A 2RD1A 2YLCA 3ZFJA 3JCMW 4PLLA 5LJ3g 4X34A 5CAIA 4M75E 3X25B 4C92F 4M75C 5C0MA 2CGHA 5CO7A 5KCHA 3S3NA 3S3OA 1JJ2A 5CQYA 2KQWA 3HFNA 1VQKA 3NTKA 4BI8B 4R56A 4DOWA 3LX7A 3M4GA 1U1SA 4L5GA 4LDXA 2EQMA 2X35A 3QUIA 4OGEA 5GMKj 4J7IA 4D6WA 5GAN5 4XU1A 2K3YA 5EG2A 5A0DA 5A2QE 5C6SA 2E10A 2JOYA 2EQUA 1W4SA 2HNIA 3C95A 5GAOq 3INZA 4A54A 1UGQB 2KSSA 2DTHA 2RJEA 4BD3A 4C92E 2DZ9A 2ZZDA 1YBYA 4C92C 2XIDA 3X20B 3JB9J 2P0KA 3M56A 5DLOA 2R5MA 3VKIA 2DEQA 1Y71A 1Q81U 4F7UA 4M7DG 5GAMd 3L42A 3OYAA 4J6XA 1VQNA 1VQ5A 4EMGA 1VQ8T 2YHTA 4RCCA 3KXTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QYH B;  1GXI E;  2ZPI B;  3X24 B;  2DXC A;  4OB2 B;  1UGP B;  4RKU E;  2QDY B;  2ZPH B;  4ZGE B;  1UGS B;  3A8M B;  4OB0 B;  2CZ7 B;  1IRE B;  2DD4 A;  5L8R E;  3A8H B;  2D0Q B;  2PUK B;  3WVD B;  2CZ6 B;  2WSC E;  1AHJ B;  4ZGD B;  3LW5 E;  2PVD B;  4OB3 B;  2PVG B;  3VYH B;  1JB0 E;  4KT0 E;  4FM4 B;  1DJ7 B;  2DXB A;  3HHT B;  2ZPG B;  2CZ0 B;  4OB1 B;  1QP3 A;  3A8O B;  2CZ1 B;  2WSE E;  2ZPB B;  2WSF E;  2ZCF B;  3X25 B;  2AHJ B;  3A8G B;  1PSF A;  4ZGJ B;  2PUO B;  3QYG B;  1V29 B;  2PU9 B;  3A8L B;  4L6V 5;  3X26 B;  4XK8 E;  2ZPF B;  3QZ9 B;  3WVE B;  2PVO B;  2DD5 A;  1UGQ B;  3X28 B;  1UGR B;  2ZZD A;  3X20 B;  4Y28 E;  3VYG A;  2DPP B;  2O01 E;  1QP2 A;  3QZ5 B;  2ZPE B;  2CYZ B;  3QXE B;  1PSE A; 
#chains in the Genus database with same CATH topology
 3QSU A;  2E3H A;  1GFD A;  2KDS A;  1Y07 A;  4OMO A;  2LJ3 A;  4BUG A;  2CP7 A;  1JJ2 P;  3CCR A;  1H8K A;  3QJ6 A;  5CKE A;  1GRI A;  3QKJ A;  1VQ4 T;  2VV5 A;  1XTD A;  2BZX A;  3OS5 A;  3DLL A;  1K4U S;  2PNI A;  1H92 A;  1FYN A;  2AKK A;  3OBW A;  3JAM E;  1WXT A;  1IRX A;  3RBB B;  3BDU A;  5CKB A;  2AIR B;  2D0N A;  3O5Z A;  3VV0 A;  4M7A F;  1AZE A;  1MV3 A;  4M75 B;  5L23 A;  2V1R A;  1BCM A;  4M77 D;  3AT1 B;  1UEB A;  2LCL A;  4QW2 A;  1VQO T;  1K8A R;  1KQ2 A;  2RHU A;  2NUT A;  1VQO A;  1AD5 A;  4DBF A;  4XU0 A;  3G71 T;  1PNJ A;  1UHC A;  2VKN A;  1QVG A;  4C92 B;  1D0Z A;  2EKO A;  3EHQ A;  2J6K A;  1UB4 A;  2IIM A;  4GY5 A;  3MPU B;  2GBQ A;  1VOM A;  2LQK A;  1K9A A;  3RMS A;  3CCQ Q;  5LJ5 j;  3R6N A;  3L2Q A;  1BCO A;  2GQV A;  2A7Y A;  2VGN A;  2BZ8 A;  2P84 A;  4M78 E;  1K8A C;  2YXY A;  1Y96 B;  2J6O A;  4RUG A;  3BFM A;  3OYE A;  4RTY A;  4C8Q A;  2DL7 A;  1ABQ A;  1KG1 A;  1AT1 B;  2HKN A;  2ECZ A;  2H3E B;  3CMA Q;  2XIC A;  4A53 A;  3UA7 A;  3FDR A;  3L2U A;  2QK0 A;  1IHV A;  2DE0 X;  1BI2 A;  1AEY A;  4KGV B;  2VAS A;  1BIB A;  4J5Y A;  4HVV A;  2LDM A;  1D1C A;  2JJ9 A;  2YUP A;  1TH7 A;  2C06 A;  2VWF A;  2K5F A;  2EYZ A;  1W2B P;  2DL8 A;  2F5T X;  8ATC B;  2O4X B;  2DAQ A;  2COZ A;  2DET A;  4M7A B;  2I2L A;  3REA B;  2DIL A;  2CKK A;  2L3P A;  4RTT A;  5GAN e;  3CCJ T;  2BKD N;  3M0U A;  3VS3 A;  3CCJ A;  1G3Y A;  2QAZ A;  3EFR A;  1UDL A;  5GAN f;  1M2O A;  4DOV A;  2XDB A;  5CQX A;  3NTI A;  3LH5 A;  1VQK Q;  2RHI A;  3G6E Q;  2L3R A;  2DZC A;  2K5I A;  2P0P A;  2EQJ A;  1VQM Q;  2XI9 A;  5LJ3 d;  5KYX B;  4J9E A;  1U8R A;  1YIJ Q;  4Y91 A;  1U06 A;  2KXD A;  3L2Z A;  4M75 D;  3TSW A;  1VYU A;  1YJN T;  2BE9 B;  4FSX A;  3VJP A;  3CCV A;  2FRY A;  4KUI A;  1YJN A;  3SB2 A;  1QWF A;  7AT1 B;  4PJM A;  3CMA T;  3EFS A;  2CP2 A;  4F7U E;  3JB9 D;  3MKD A;  4JRK A;  3E9F A;  2JZ2 A;  3OB9 A;  1BK2 A;  2PVO B;  2KEA A;  2K57 A;  4C92 D;  2RQV A;  5GAN 7;  1YI2 Q;  1U1T A;  3JCM V;  2RI3 A;  1WJQ A;  1GBR A;  1CKA A;  2LT1 A;  2GNC A;  2CT3 A;  2DX1 A;  4XTU A;  1VQP Q;  5LJ5 h;  2E1H A;  2EVR A;  2PZ1 A;  3MP6 A;  3V8L A;  3VU3 C;  1NLO C;  1TWB A;  1WZO A;  5CK9 A;  2FRW A;  5FWB A;  4RCB A;  4RTZ A;  4PJO G;  1BKB A;  1TG0 A;  4HT8 A;  2LQ8 A;  2RN8 A;  4KH0 B;  4BDY A;  1QVF P;  2DXC A;  2LQW A;  4OB2 B;  4C5G A;  3M0S A;  1OOT A;  2MYS A;  3EG3 A;  1WX6 A;  2CDT A;  2KRN A;  1G5V A;  2DXU A;  3RER A;  1IRE B;  1C0M A;  1QKW A;  3CCU T;  2WSC E;  3RIR A;  3CCU A;  1UUE A;  2LX7 A;  3PT9 A;  2QGF B;  2JT4 A;  1JXO A;  3QBY A;  4FYX B;  4M77 C;  1VA7 A;  1MMD A;  4XU3 A;  3UPU A;  2X4W A;  4X9D A;  5IHI A;  3CXC P;  1UFF A;  2GTO A;  2DVJ A;  2J7I A;  1M1K C;  4F17 A;  2HAX A;  3AHU A;  1V76 A;  5IXF A;  4JZ3 A;  4M7A D;  1LPL A;  1OU9 A;  3QPH A;  2EJG A;  2Y4Y A;  1ZA2 B;  2HSP A;  3G7Z A;  4LDW A;  1D0X A;  3CCE T;  2EW3 A;  1PSF A;  1NBE B;  3QYG B;  2GTJ A;  1V29 B;  3OS2 A;  2M9U A;  2DYI A;  4ZTJ A;  4V2S A;  4EMK B;  1R8O B;  2H3J A;  3GNG A;  1YJW T;  3WVE B;  2LQN A;  4C8Q E;  1ZUY A;  4FSS A;  4DEY A;  3CPF A;  2RMO A;  4PNO A;  1AVZ C;  3JCM X;  2HSE B;  2VC8 A;  4O6J A;  2DL3 A;  5J39 A;  2CH4 W;  3LH0 A;  3L1A A;  2OTJ T;  2O9V A;  1RUW A;  4J83 A;  5I11 A;  2OTJ A;  3MEU A;  2YUQ A;  2QEX Q;  2Y4X A;  5IT9 E;  4XAX B;  1SEM A;  5LJ3 e;  1SHF A;  5HK3 A;  3HP9 A;  1M27 C;  5HY6 A;  2FPF A;  3CPW A;  1VQ7 Q;  1ZHI A;  5GAM j;  2YDL A;  2EBP A;  3CCS T;  2XK0 A;  5GAO l;  1I81 A;  2D0Q B;  3CCS A;  1QVG S;  4JJC A;  1B07 A;  5FU7 C;  3JCM P;  2JM8 A;  1PM3 A;  3TU4 K;  2LP5 A;  2QA4 Q;  5CCA A;  4M77 F;  4OMM A;  5IXB A;  1EFN A;  3CEY A;  2RO0 A;  2W10 A;  5GMK l;  5FWC A;  1X01 A;  2QQ9 A;  1QWE A;  4C8Q D;  1BI3 A;  4IUQ A;  4C5I A;  2YRD A;  3V7S A;  3A8O B;  3I9Q A;  1W2B A;  2LJ0 A;  2EIF A;  2MWO A;  1Q82 R;  2YLC A;  1PG5 B;  1RAA B;  3X25 B;  4M75 C;  2KQW A;  3HFN A;  5KYW B;  4DOW A;  2CSI A;  4JJD A;  1U1S A;  2K6D A;  5GMK j;  4OGE A;  1KQS P;  2K3B A;  4WCI A;  1V1C A;  4QT7 A;  3VS0 A;  4D6W A;  4XU1 A;  2CRE A;  5A0D A;  1YJ9 Q;  3REB B;  2EQU A;  4F14 A;  5GAO q;  3INZ A;  1SG5 A;  2OI3 A;  4CC2 A;  4C92 C;  1FMV A;  4DBQ A;  2R5M A;  1Q81 U;  1Y71 A;  3L42 A;  3OYA A;  2FEI A;  1VQN A;  2DEU A;  4RCC A;  2VXF A;  4RG8 A;  4XU2 A;  4AFQ C;  1O75 A;  1Q82 C;  5A0G A;  2E41 A;  3DB4 A;  1TS9 A;  5CR2 A;  2F5K A;  1ZSZ A;  2DL4 A;  1RAE B;  5CVI A;  1NYF A;  1KK7 A;  1CKB A;  4XTV A;  3JCM b;  4LUD A;  5KE3 A;  3JCM d;  2K2V A;  4Q5W A;  1I5O B;  5LJ5 e;  4E2F B;  3MEV A;  3FLG A;  1VQ6 A;  3NFC A;  2P0Q A;  5GAO r;  2EYY A;  2OAW A;  2VGM A;  3BDL A;  2HDA A;  2FL7 A;  2HEQ A;  1NEG A;  4KUL A;  1OYX A;  3KBG A;  3L2W A;  4PJJ A;  1LNX A;  3VS7 A;  4N0A C;  2RQW A;  2RH2 A;  3OS0 A;  5GAM h;  1YFN A;  1QQJ A;  4OP0 A;  4QQG A;  3JCM c;  2KNB B;  4DBR A;  2RJC A;  2MWP A;  3QDF A;  3OBY A;  1U5S A;  3GNF B;  4C5E A;  4E7Z A;  4M7A C;  1YWP A;  1VQ5 T;  2QTV A;  4ZN1 A;  5CKF A;  1NJI U;  3EG2 A;  5GAN g;  1WHL A;  2XG8 D;  1KC8 U;  1JBM A;  5HK0 A;  1VQ5 A;  2J06 A;  3P8H A;  3GBQ A;  1K73 U;  2DF6 A;  2VYT A;  1IXD A;  1VQ4 Q;  2QQR A;  5GAO m;  3I56 A;  2JN0 A;  1VQ9 A;  1KHC A;  2A36 A;  3JB9 F;  2I0N A;  4BY6 B;  3JB9 I;  2K2M A;  2E5K A;  2L5Q A;  2FZG B;  5GJV B;  3LGF A;  5GMK m;  2AK5 A;  1T3L A;  3QXE B;  2LCC A;  5IN1 A;  1VQO Q;  4LXC A;  3CQT A;  3HKS A;  1C1A A;  4DEX A;  2P4T A;  2QYZ A;  1ZSG A;  4JRI A;  3O8V A;  1PD0 A;  2C0O A;  1BYM A;  3G71 Q;  5IAY A;  1UGS B;  1RLP C;  2PUK B;  3WVD B;  2MAM A;  2KI7 A;  3CC7 A;  3OYJ A;  4FT4 A;  1TOV A;  3CCR T;  4FYW B;  1PRM C;  4IUV A;  2RJF A;  4F16 A;  5GAO p;  1I1J A;  1IHW A;  3I5R A;  1NE8 A;  3P8D A;  1M1G A;  4O5V A;  2KVQ G;  5AYF A;  3OYM A;  2DLP A;  2HZY A;  1BI0 A;  3FJP A;  1RAC B;  2HBP A;  1SKU B;  2O31 A;  4PJL A;  1ABO A;  5KH6 A;  2OAU A;  3T9N A;  2DNU A;  3P8B B;  2EKH A;  1OI1 A;  1BB9 A;  2DFU A;  3EG9 A;  4J9C A;  2KY9 A;  4BI4 A;  1IZ6 A;  4M78 B;  2OTL A;  3BE3 A;  2ESW A;  3CCL T;  1JRI A;  3V7R A;  3U23 A;  1T3S A;  1LVK A;  3CCL A;  2P4R A;  1NZ9 A;  2NUP A;  2EGC A;  4XTW A;  3JCM e;  1G2B A;  3EGU A;  4XTZ A;  2E12 A;  3X26 B;  1NPP A;  2B86 A;  4GBQ A;  1UGV A;  4JUV A;  2F2V A;  2YRV A;  3CPW S;  3EGX B;  4PKC C;  2HBW A;  3A98 A;  1K9M R;  4MZT A;  2QXF A;  1OX8 A;  1UGR B;  3MHX A;  4WTO B;  4Y28 E;  5GAN 3;  2DPP B;  3CCJ Q;  3VS5 A;  1YHQ T;  3SDZ A;  3KUF A;  2CYZ B;  2JXB A;  1VIE A;  1JXM A;  1YHQ A;  1Q86 R;  2EJF A;  1R0C B;  1I4K 1;  4ESR A;  2ZPI B;  5LJ3 h;  4EMK C;  1QCO A;  4ELZ C;  5EC7 A;  3S6W A;  5GAN 8;  2D6F A;  4TVR A;  3SWN A;  4RKU E;  3MET A;  3PMT A;  4JLI A;  2L3Q A;  3E1S A;  4ATO A;  3VRZ A;  4J9H A;  2E70 A;  2EQK A;  5A0L A;  2MIO A;  5L8R E;  1YJN Q;  3L2V A;  1I0C A;  2JTM A;  4RG2 A;  1XJW B;  3C12 A;  3TQ7 P;  1W2B S;  2QG9 B;  1JQQ A;  1QMC A;  4XTX A;  1YN8 A;  1B3Q A;  1K9M C;  1X6B A;  2JMA A;  2RQT A;  4KT0 E;  4WF2 A;  1G83 A;  3E19 A;  4FM4 B;  5FW9 A;  4BB7 A;  4C0Z A;  4HVW A;  1AZG B;  1Q86 C;  1CSK A;  1UEC A;  2D9T A;  3OW2 A;  4LDU A;  4F7U B;  2CZ0 B;  3V8K A;  1B34 A;  2YLB A;  5D7U A;  2DTI A;  4C8Q F;  5KYY A;  3M0Q A;  3CD6 T;  1Q95 G;  2ENM A;  4M7D A;  3CD6 A;  1FX7 A;  1YP5 A;  2XDP A;  2FPE A;  3H9N A;  1O9S A;  4A4K A;  5GAM e;  4PL6 A;  1I07 A;  1BIA A;  2KRS A;  2X4X A;  4ZGJ B;  4HT9 A;  1T0H A;  2PU9 B;  3A8L B;  3QHS A;  4L6V 5;  2DMO A;  3VS4 A;  2X4Y A;  3EHR A;  3OSS C;  2RHX A;  4ELY C;  3CCU Q;  4MZM A;  1RAD B;  4M78 D;  5FU6 C;  3PGG A;  4P5N A;  3HRT A;  2DD5 A;  2MI6 A;  2F2X A;  2X9H A;  4BE1 A;  3CCV T;  1M90 U;  1M5Q 1;  2X3X D;  4LUE A;  4F04 B;  2RNA A;  1WNL A;  2QAS A;  4RMO A;  2DO3 A;  2CS7 A;  2ZPE B;  1PRL C;  1PSE A;  2DJZ A;  4ZTF A;  2DJQ A;  5CKH A;  3OQ5 A;  2KAF A;  2NUT B;  3DKM A;  1AWX A;  3EGD A;  2E65 A;  2KRO A;  2AZV A;  4LN2 A;  1D3B A;  2JUF A;  1WPY A;  4M77 G;  1UGP B;  2DKG A;  2GGR A;  2QDY B;  2RF0 A;  3A8M B;  1QVP A;  4IUU A;  1X2Q A;  2A3L A;  1GBQ A;  4X1V A;  1JEG A;  2V8K A;  2B8A A;  2CZ7 B;  1XNI A;  4QVZ A;  2AZS A;  4L59 A;  5GMK e;  3CCE Q;  2OX7 A;  4OMF B;  1UJY A;  2DM1 A;  1F1B B;  1H3Z A;  2PVD B;  2A08 A;  2LX9 A;  3HPW A;  5IHK A;  1X6O A;  1JB0 E;  1AWJ A;  3CME T;  1OUL A;  4ME7 A;  3GF5 A;  2HQX A;  1YJW Q;  3RES A;  3VRY A;  5FRM A;  3CME A;  4FCY A;  3MJX A;  1DJ7 B;  2RPN A;  2DVE A;  1K1Z A;  3EFO A;  4J6Y A;  1OV3 A;  1GL5 A;  1M3A A;  2CT4 A;  4C8Q B;  2OTJ Q;  3JCM J;  1N8R R;  1VUB A;  2WSF E;  5J26 A;  5KYU A;  1JJ2 A;  3S3N A;  1QKX A;  1VQK A;  3NTK A;  4M4Z A;  4BI8 B;  3C0C A;  3M4G A;  4LDX A;  1QCN A;  2FZK B;  1KIK A;  3CCS Q;  5C6S A;  2E10 A;  2X3W D;  2H8H A;  1X43 A;  2RJE A;  3NPF A;  2ZZD A;  2P0K A;  3KFV A;  1VQ8 T;  4PFP A;  2QQS A;  3H41 A;  2G6F X;  2CP0 A;  1N8R C;  1VQ8 A;  2ED0 A;  5IHN A;  1RAF B;  5DY9 A;  3SEM A;  3M54 A;  1LJO A;  3J7A F;  4J9D A;  3PTA A;  4Z89 A;  3FEO A;  4BY6 C;  1NPR A;  2IVW A;  3CCM T;  3OS1 A;  4NL3 A;  3NHN A;  1YCS B;  1VQP A;  5KE2 A;  3CCM A;  1X2K A;  3E9G A;  2CZ6 B;  1H3H A;  2RK1 A;  1PCX A;  3UDC A;  3OSV A;  2CP6 A;  1MV0 B;  4GLM A;  1C6V X;  3C94 A;  3OYY A;  5DM7 R;  2IPO B;  4M75 G;  2NUZ A;  4YTL A;  1K0X A;  2NYS A;  3ER0 A;  9ATC B;  1VYV A;  5LJ3 f;  2QGG A;  4E6R A;  1RAG B;  1JU5 C;  3EAE A;  2FB7 A;  2V8J A;  3M55 A;  1TUG B;  3DLM A;  3ME9 A;  4M7D E;  3M4Y A;  4CC3 A;  4IIO A;  4R55 A;  1FXX A;  1KJW A;  4B9W A;  1D0Y A;  1BU1 A;  3JB9 G;  1VQL T;  2NLU A;  1JO8 A;  3OYG A;  4JDS A;  2XHC A;  2CZ1 B;  3TVT A;  1VQL A;  4HCZ A;  2COW A;  4C92 G;  1SF9 A;  1AWO A;  3A8G B;  3FB9 A;  1IGU A;  3URG A;  2K3X A;  1Y57 A;  1YIT T;  5GAN 4;  1YIT A;  2Y90 A;  2D8J A;  3JCM h;  2MF2 A;  4PJO A;  1KD1 U;  3F70 A;  5FU6 B;  1VIF A;  2RM4 A;  2EJ9 A;  4AFU C;  1FMW A;  3PVQ A;  3LWI A;  5ECA A;  5CIU A;  2QDL A;  4M78 C;  4R0K A;  2BUD A;  1K0S A;  3C4S A;  2O01 E;  1WA7 A;  1X6G A;  1HD3 A;  2JTF A;  1KHI A;  1WHH A;  2LTO A;  1WHK A;  2VVK A;  4VUB A;  2A0F B;  1M1K U;  2DBK A;  8AT1 B;  1ARK A;  2D8H A;  4FW1 A;  2LMJ A;  3PVL A;  2F1L A;  1YWO A;  3S3M A;  1R77 A;  1RL2 A;  1S72 T;  3OW2 S;  2KK4 A;  3JV3 A;  1VQN T;  4M7D D;  1S72 A;  1SPK A;  2DD4 A;  1OZ3 A;  1VQ5 Q;  4KBM B;  2MMP A;  3TEE A;  2KXC A;  1IB8 A;  4MDW A;  4HCB A;  1UTI A;  3Q1J A;  3LW5 E;  1SHG A;  4KGX B;  4M7A G;  1WYX A;  4OVA A;  1N6A A;  2O2O A;  1ZLM A;  2PVG B;  1VQ7 A;  2DYB A;  3RNJ A;  3LYI A;  2LCS A;  1N9R A;  2LJ1 A;  4BI3 A;  4RTU A;  3JRZ A;  1VQ6 T;  1GCQ C;  2QTX A;  2GCX A;  3QWX X;  4OB1 B;  5GAO n;  1N27 A;  4J8O A;  1M1F A;  2ZCF B;  5LJ5 f;  2ED1 A;  2EAY A;  3MCA B;  4AMC A;  1FMK A;  2AHJ B;  5GAN 6;  2KYB A;  1H64 1;  4J7F A;  3VUZ A;  1QVF A;  2YWW A;  2K9G A;  2X4J A;  1S1N A;  1WDX A;  3HRU A;  4QVD A;  4LDY A;  4E7L A;  4M75 A;  2AKL A;  3RKW A;  2L3S A;  2ZPF B;  2FZC B;  4JS4 A;  3M59 A;  1G3T A;  1ZBJ A;  2KT1 A;  4XTY A;  3CC4 T;  3UWN A;  4KUD K;  1AWW A;  3CCR Q;  4M78 F;  1QW1 A;  2L2P A;  3CC4 A;  4DBH A;  2DIG A;  3I56 T;  2A37 A;  1VQ9 T;  4BE0 A;  1PWT A;  3HL8 A;  4B6M A;  4JLG A;  4NS5 A;  4C92 A;  3CXC A;  2K5L A;  2IG0 A;  3TRE A;  2LC4 A;  2RQU A;  2MPX C;  5CKD A;  2JW4 A;  5DLQ E;  4NL2 A;  4OB0 B;  4JS5 A;  1W1F A;  2DIQ A;  2FPD A;  3CCL Q;  3RKY A;  2ROL A;  5HKC A;  4FIB A;  5GMK h;  2JVV A;  1OU8 A;  3ZEH A;  1HSQ A;  1JJ2 S;  1Y96 A;  2DBM A;  2DRM A;  1TUC A;  4M77 E;  3QII A;  2LNH B;  1EIF A;  4E7J A;  1ZQ1 A;  1LCK A;  2CUB A;  3HHT B;  4D8D A;  3CC7 T;  1X75 C;  4OMP A;  1MMG A;  1NM7 A;  1YHQ Q;  1G8X A;  1M30 A;  4D8K A;  1ACM B;  1QP3 A;  1RI0 A;  3M5A A;  4N0A A;  5GAN d;  4E47 A;  2F69 A;  4E7K A;  1Q82 U;  4J9I A;  3QDR B;  4EIK A;  4PJO E;  1ZSZ B;  3QO3 A;  5GMK i;  1M90 R;  3L2R A;  1Q7Y U;  4N4H A;  1NEB A;  2HCK A;  1R0B G;  3SWN C;  1PKT A;  2CP3 A;  2O4X A;  1NG2 A;  2DTO A;  4M7A A;  1UG1 A;  4E7I A;  1WJR A;  1UE9 A;  4F7U F;  3CC2 T;  3OYI A;  2YSQ A;  5IH2 A;  1OQK A;  4K11 A;  2L0A A;  3CC2 A;  4C8Q C;  4UC4 A;  1TUD A;  3QG1 A;  2OTL T;  5I2M A;  2FVU A;  1WLP B;  3VYG A;  1MND A;  4AG1 C;  4MZP A;  1VQ4 A;  2VB6 A;  2DER A;  3I55 T;  1YCY A;  3SFM A;  5FRO A;  3I55 A;  3OYN A;  4A63 B;  3MP8 A;  5KYX A;  2LVM A;  4ZN3 A;  3PFS A;  4ANJ A;  4HVU A;  3UAT A;  1UJ0 A;  3JCM f;  1OX9 A;  3X24 B;  4BDZ A;  2YT6 A;  2V26 A;  1M90 C;  4MMK A;  2R57 A;  3PIP A;  1J3T A;  2YUO A;  2RJD A;  1P92 A;  3EH2 A;  3TCJ A;  4OML A;  4EDU A;  5LL6 S;  1MMN A;  4AG2 C;  3M57 A;  3GOX A;  3CD6 Q;  4QVC A;  1SRM A;  1PD1 A;  1M8V A;  2F2W A;  1W70 A;  3G4S T;  4M7D C;  4LDV A;  4LD9 K;  3G4S A;  2SRC A;  4ZGD B;  3QJY A;  2J6F A;  4MDX A;  3SHW A;  4DA4 A;  1UHF A;  4C0F A;  4OB3 B;  3G1J A;  1KQS A;  3G71 A;  4PJO D;  4AFZ C;  2JMC A;  2AT1 B;  1ZBX A;  4OMQ A;  1WI7 A;  2KBT A;  1SSF A;  1E7O A;  4LD6 A;  2GFU A;  4A4F A;  3CCV Q;  2ZPG B;  2LNV A;  2K7A A;  3UT1 A;  5D6W A;  3LLR A;  3CPW P;  1RAH B;  2WSE E;  2CSQ A;  3JCM W;  3RDV A;  5LJ3 g;  4X34 A;  5GJW B;  4M75 E;  5CAI A;  5CO7 A;  5CQY A;  1T0J A;  3LX7 A;  3TSZ A;  2EQM A;  2X35 A;  1EZZ B;  1WXU A;  2MK5 A;  4J7I A;  4FYY B;  5EG2 A;  4J9G A;  4HCK A;  1W4S A;  3C95 A;  3VS6 A;  2CP5 A;  4A54 A;  2KSS A;  2DTH A;  4BD3 A;  4C92 E;  2XID A;  3X20 B;  3JB9 J;  5DLO A;  1PC0 A;  2NWM A;  3CME Q;  4EMG A;  2YHT A;  2A28 A;  4RTX A;  3KXT A;  1M3B A;  1GXI E;  3OMG A;  2RB6 A;  5GAM f;  3CBO A;  2EPD A;  3EG9 B;  4IIM A;  3H0H A;  1WHJ A;  1Y0M A;  1D1B A;  2E6N A;  2W0Z A;  2C0T A;  3CCQ T;  1D09 B;  4OF1 A;  3MP1 A;  2VXE A;  4JRQ A;  1Z9Q A;  2EGA A;  3CCQ A;  2OJ2 A;  4IUR A;  1E6G A;  3V8J A;  4EMK A;  4M7D F;  4LNP A;  1BBZ A;  3OYH A;  1M3C A;  1OEB A;  2NUP B;  2GFA A;  3RKX A;  3MEW A;  4PLI A;  2V1Q A;  4NOY A;  1QVF S;  2ZAE A;  2GF7 A;  2XKO C;  2RI2 A;  2KYM A;  3M58 A;  4CC7 A;  2DK3 A;  1RI9 A;  1WJS A;  2RK2 A;  2O9S A;  3JSC A;  1WFW A;  2QI2 A;  3LGL A;  2E4H A;  2Z0W A;  4KGZ B;  1EX4 A;  4OGC A;  1VYT A;  4QQ6 A;  3ZBD A;  2FO0 A;  3CMA A;  2EYX A;  4BE2 A;  1KD1 R;  3MO8 A;  6AT1 B;  1VQ8 Q;  3VUB A;  2ZPB B;  1HYO A;  4M7A E;  3OA6 A;  1B7T A;  3NTH A;  4MML A;  3SWN B;  1K8A U;  3V7C A;  2PUO B;  2VUB A;  3EH1 A;  2QQB A;  1M9S A;  3CXC S;  3A5Z B;  3ASK A;  3CCM Q;  1M8M A;  1M1K R;  3PIO A;  1D1A A;  4FU6 A;  4OMN A;  3RR6 A;  5LJ5 g;  1K9M U;  1Z9Z A;  5D6X A;  1VQK T;  3G6E T;  3RMQ A;  1WQ7 A;  4C0D C;  2PQW A;  3N5B B;  3OYF A;  5FRN A;  4RTW A;  3G6E A;  4C0G A;  1Q81 R;  2CH4 A;  3M9Q A;  1VQM T;  2D1X A;  4IUT A;  2L8D A;  1OPK A;  4XQ3 A;  1Q86 U;  1YIJ T;  3H0F A;  3ZL7 C;  1KD1 C;  3H0I A;  1VQM A;  1M2V A;  2ROT A;  1HJD A;  3QYH B;  1YIJ A;  2J05 A;  2KMT A;  2M0O A;  1MGQ A;  1ZA1 B;  2JNG A;  2M0Y A;  2R58 A;  1B34 B;  2RI5 A;  5KYW A;  1U3O A;  3GP8 A;  5AT1 B;  1VQL Q;  5KYY B;  4JPB W;  2ZPH B;  1WHG A;  4ZGE B;  2RQR A;  4C5H A;  4M7D B;  2HL3 A;  2CUD A;  1KQ1 A;  4BAC A;  2FG0 A;  2JM9 A;  1AHJ B;  2C0I A;  4CI0 C;  1TTH B;  1N9S A;  2SEM A;  1YIT Q;  2WAC A;  1X27 A;  1PKS A;  3GLX A;  1YI2 T;  2RHZ A;  2K4Y A;  3PMI A;  2XDD A;  2M16 A;  2COY A;  4PJO C;  1YI2 A;  1ZUU A;  3VS2 A;  1KSW A;  3I5S A;  1Q81 C;  2JS2 A;  1Y7X A;  1VQP T;  2GQI A;  4Y92 A;  3CCE A;  4PJN A;  3PNW C;  3RUX A;  5LJ5 d;  1GFC A;  4HXJ A;  2PTK A;  2DA9 A;  2M51 A;  3BW1 A;  2KR3 A;  2LRQ A;  3OY9 A;  2FYK A;  1HK9 A;  4E7H A;  2JS0 A;  1TSF A;  4JZ4 A;  4M78 G;  1YJW A;  3EG1 A;  3EGD B;  1WQW A;  1MUZ A;  1D3B B;  2HKQ B;  1NJI R;  1MMA A;  1KFZ A;  4FYV B;  4JRP A;  1KC8 R;  4J9B A;  4N4G A;  1K73 R;  1TXQ A;  1S72 Q;  2E6Z A;  3PE0 A;  1VQN Q;  3FJ5 A;  3CBM A;  4XK8 E;  1M4Z A;  4FL6 A;  2E5Q A;  4M77 A;  3UF4 A;  2X51 A;  1PHT A;  3QWY A;  5GAN j;  1I5L A;  5I21 A;  1A0N B;  4N4I A;  3FC3 A;  1HXD A;  3NMZ C;  2QQA A;  1ZSZ C;  4PK4 A;  1QLY A;  2BZY A;  2EYQ A;  1NLP C;  4CC4 B;  1KQS S;  2M02 A;  2EFI A;  3DB3 A;  3EFO B;  2XMF A;  3SD4 A;  3M0T A;  5I22 A;  4EPC A;  1BI1 A;  1VQ6 Q;  2BIV A;  1NJI C;  3OYB A;  4HKE A;  1KC8 C;  3OYD A;  5I2S A;  4KRT A;  1K73 C;  5KYU B;  2LT4 A;  3FIF A;  2JTE A;  2MCN A;  3A8H B;  1G3W A;  4FT2 A;  3J80 E;  1ZX6 A;  2G3R A;  4Z88 A;  1QVG P;  4E7S A;  2KT8 A;  2V8I A;  4AFS C;  1M2V B;  3JCM g;  3THK A;  3J81 E;  2YUN A;  3OYC A;  1LOJ A;  4PJO F;  3R6O A;  3IQL A;  4ORZ A;  3CC4 Q;  1Q7Y R;  3CBP A;  2QEX T;  1N5Z A;  4JJN K;  1IGQ A;  2HQE A;  2QEX A;  1I8F A;  1TU0 B;  2HD0 A;  4F7U G;  3EG0 A;  1WHM A;  1OPL A;  2EGE A;  2ZGW A;  3D7S B;  5M9O A;  3OYL A;  3I56 Q;  2XU8 A;  2RHY A;  1N8R U;  1VQ9 Q;  3FRN A;  1VQ7 T;  1SRL A;  4A4E A;  1MNE A;  1RAI B;  4IKF A;  3HFO A;  4II1 A;  2DXT A;  4GLK A;  3OMC A;  5KCO A;  5D6Y A;  3HTR A;  3M0P A;  4RTV A;  2RA2 A;  2ATC B;  4HA8 A;  2O88 A;  4J6W A;  1XOV A;  2QA4 T;  5KYN A;  3NGP A;  3GIB A;  3QZ9 B;  2QA4 A;  1WGS A;  2KGT A;  3JB9 H;  4EMH A;  4IUP A;  4DQ2 A;  1Q7Y C;  4C0D B;  3I35 A;  4Z8A A;  3X28 B;  3OW2 P;  1QP2 A;  1AOJ A;  4LE9 A;  1ZUK A;  1YNZ A;  5FLX E;  3ULR B;  3QZ5 B;  4AT1 B;  1SSH A;  4A4G A;  2FHD A;  2EWN A;  3HRS A;  2BTT A;  2E64 A;  4M78 A;  2HQH A;  3CC7 Q;  1FWZ A;  5GAN h;  4M77 B;  2DL5 A;  4Z02 A;  4KH1 B;  3GPL A;  3VS1 A;  3M53 A;  3M0R A;  4QKU A;  2L89 A;  1RAB B;  3MEA A;  4A4H A;  3H6Z A;  4B9X A;  1YJ9 T;  2R5A A;  1X69 A;  3LWH A;  2HMA A;  5GAM g;  1YJ9 A;  3EGX A;  1WXB A;  1MHN A;  4FW2 A;  2MOX A;  3BY7 A;  1GCP A;  4PJO B;  4QQD A;  3VYH B;  4M75 F;  3CC2 Q;  3HSB A;  1QCF A;  2XD0 A;  4X9C A;  3JCM Q;  2DRK A;  4PFZ A;  2OTL Q;  2EYW A;  2KE9 A;  2DXB A;  3A1P A;  2YRC A;  1XQH A;  1K76 A;  5J3B A;  2ABL A;  4HCC A;  3H8Z A;  5HCK A;  3E2U A;  4J9F A;  1IO6 A;  4PFO A;  5LJ3 j;  3I55 Q;  4C8Q G;  1G3S A;  5GAN 2;  1W6X A;  3OYK A;  4ZNX A;  3WXM B;  4CRI A;  3ZFJ A;  2M1H A;  1OZ2 A;  2RD1 A;  4PLL A;  4C92 F;  5C0M A;  5KCH A;  2CGH A;  3S3O A;  2HL5 C;  1GCQ A;  4R56 A;  1E6H A;  1RLQ C;  2KRM A;  4L5G A;  2K79 A;  3QUI A;  1NYG A;  5GAN 5;  1WIE A;  2BE7 D;  3G4S Q;  3UA6 A;  2K3Y A;  5A2Q E;  2JOY A;  2HNI A;  4JJB A;  2LZ6 B;  1UGQ B;  2DZ9 A;  1YBY A;  3M56 A;  2E3I A;  2EQI A;  3VKI A;  2DEQ A;  4F7U A;  4M7D G;  5GAM d;  4J6X A;  5FU7 B; 
#chains in the Genus database with same CATH homology
 3QSU A;  2QQS A;  2VXF A;  4RG8 A;  2KDS A;  1N8R C;  1VQ8 A;  1GXI E;  1Y07 A;  3OMG A;  1O75 A;  2RB6 A;  4XU2 A;  4BUG A;  5A0G A;  2E41 A;  5GAM f;  5DY9 A;  1Q82 C;  3CBO A;  3DB4 A;  5CR2 A;  3CCR A;  2F5K A;  3M54 A;  1LJO A;  3J7A F;  5CVI A;  3PTA A;  3QJ6 A;  2E6N A;  3FEO A;  5CKE A;  4XTV A;  3QKJ A;  4BY6 C;  3CCQ T;  1VQ4 T;  3JCM b;  2VV5 A;  1NPR A;  1XTD A;  3MP1 A;  3OS5 A;  4OF1 A;  3DLL A;  2IVW A;  2VXE A;  3CCM T;  4JRQ A;  3OS1 A;  4NL3 A;  4IUR A;  3CCQ A;  5KE3 A;  1VQP A;  3V8J A;  4EMK A;  5KE2 A;  4M7D F;  3CCM A;  3OBW A;  3OYH A;  3JCM d;  3JAM E;  3E9G A;  2K2V A;  2CZ6 B;  4Q5W A;  5LJ5 e;  3MEV A;  2RK1 A;  3FLG A;  3UDC A;  3RKX A;  3BDU A;  2GFA A;  3OSV A;  1VQ6 A;  3MEW A;  3NFC A;  2P0Q A;  4PLI A;  5CKB A;  5GAO r;  4NOY A;  3C94 A;  3OYY A;  3VV0 A;  5DM7 R;  4M7A F;  4M75 B;  4M75 G;  1QVF S;  2VGM A;  2GF7 A;  3BDL A;  2XKO C;  4M77 D;  4YTL A;  2FL7 A;  2RI2 A;  3ER0 A;  4KUL A;  3M58 A;  5LJ3 f;  1OYX A;  3KBG A;  1UEB A;  3L2W A;  2LCL A;  2DK3 A;  1WJS A;  2RK2 A;  1LNX A;  3JSC A;  4N0A C;  4QW2 A;  2QI2 A;  3EAE A;  3LGL A;  2RH2 A;  1VQO T;  2FB7 A;  2V8J A;  3M55 A;  3OS0 A;  5GAM h;  3DLM A;  4OGC A;  1KQ2 A;  3ME9 A;  2RHU A;  3M4Y A;  4OP0 A;  4QQG A;  1VQO A;  4M7D E;  3JCM c;  4QQ6 A;  3ZBD A;  4R55 A;  1FXX A;  4B9W A;  2RJC A;  2MWP A;  4XU0 A;  3CMA A;  3OBY A;  4C5E A;  3GNF B;  3JB9 G;  1VQL T;  2NLU A;  4BE2 A;  3G71 T;  3MO8 A;  3OYG A;  4JDS A;  2XHC A;  1QVG A;  2CZ1 B;  3VUB A;  2ZPB B;  1VQL A;  4HCZ A;  4M7A E;  3OA6 A;  4M7A C;  4C92 B;  4C92 G;  2EKO A;  1UB4 A;  1VQ5 T;  4ZN1 A;  5CKF A;  1NJI U;  3NTH A;  4GY5 A;  5GAN g;  2XG8 D;  1KC8 U;  1JBM A;  5HK0 A;  3A8G B;  3P8H A;  3FB9 A;  4MML A;  3SWN B;  3URG A;  1K8A U;  2K3X A;  1K73 U;  3V7C A;  1YIT T;  2PUO B;  2VUB A;  2LQK A;  5GAN 4;  2QQB A;  2VYT A;  1M9S A;  3CXC S;  3RMS A;  1YIT A;  2QQR A;  5GAO m;  5LJ5 j;  2Y90 A;  3I56 A;  3L2Q A;  3A5Z B;  3ASK A;  3JCM h;  2JN0 A;  2GQV A;  2MF2 A;  1VQ9 A;  4PJO A;  2A7Y A;  1KHC A;  1KD1 U;  2VGN A;  3PIO A;  3F70 A;  5FU6 B;  4FU6 A;  3JB9 F;  1VIF A;  2RM4 A;  2EJ9 A;  5LJ5 g;  1K9M U;  3LWI A;  4BY6 B;  3JB9 I;  5CIU A;  4M78 E;  5D6X A;  4M78 C;  1VQK T;  1K8A C;  3G6E T;  3RMQ A;  1WQ7 A;  1Y96 B;  2BUD A;  3C4S A;  4C0D C;  2O01 E;  2PQW A;  3BFM A;  3N5B B;  3OYF A;  2L5Q A;  5FRN A;  3G6E A;  4C0G A;  2JTF A;  3OYE A;  3M9Q A;  1VQM T;  1KHI A;  3LGF A;  4IUT A;  5GMK m;  2L8D A;  4C8Q A;  4XQ3 A;  1Q86 U;  1YIJ T;  3QXE B;  2LTO A;  1KD1 C;  1VQM A;  2LCC A;  5IN1 A;  3QYH B;  4VUB A;  1YIJ A;  1M1K U;  3HKS A;  1KG1 A;  2P4T A;  2KMT A;  2XIC A;  2M0O A;  1MGQ A;  2JNG A;  2R58 A;  1B34 B;  2RI5 A;  4JRI A;  3O8V A;  4A53 A;  3GP8 A;  3FDR A;  3S3M A;  3L2U A;  1BYM A;  1RL2 A;  2ZPH B;  5IAY A;  4ZGE B;  1S72 T;  1BI2 A;  1UGS B;  3OW2 S;  2KK4 A;  4C5H A;  1VQN T;  1BIB A;  4J5Y A;  1S72 A;  4M7D D;  2LDM A;  4M7D B;  2DD4 A;  1OZ3 A;  4BAC A;  1KQ1 A;  4KBM B;  1TH7 A;  2MMP A;  3TEE A;  2C06 A;  2PUK B;  3WVD B;  2K5F A;  2MAM A;  3CC7 A;  3OYJ A;  4MDW A;  4HCB A;  1AHJ B;  4FT4 A;  2F5T X;  4CI0 C;  1N9S A;  2O4X B;  3CCR T;  3Q1J A;  3LW5 E;  2WAC A;  2DAQ A;  4M7A B;  2I2L A;  3GLX A;  4IUV A;  4M7A G;  2RJF A;  1YI2 T;  2CKK A;  2RHZ A;  5GAO p;  2K4Y A;  4OVA A;  1N6A A;  3PMI A;  5GAN e;  2XDD A;  3CCJ T;  2BKD N;  2M16 A;  2PVG B;  1VQ7 A;  1NE8 A;  4PJO C;  1YI2 A;  3P8D A;  3CCJ A;  1G3Y A;  1M1G A;  4O5V A;  1Q81 C;  2KVQ G;  5AYF A;  3OYM A;  1Y7X A;  3EFR A;  1BI0 A;  3FJP A;  2HBP A;  3LYI A;  5GAN f;  1VQP T;  1N9R A;  4DOV A;  2XDB A;  5CQX A;  3NTI A;  5KH6 A;  3CCE A;  2OAU A;  3PNW C;  3RUX A;  4BI3 A;  2RHI A;  3T9N A;  3JRZ A;  2L3R A;  3P8B B;  1OI1 A;  5LJ5 d;  2DZC A;  1VQ6 T;  2K5I A;  2P0P A;  2QTX A;  2EQJ A;  3BW1 A;  3OY9 A;  2GCX A;  2LRQ A;  2KY9 A;  4OB1 B;  2XI9 A;  5LJ3 d;  4BI4 A;  1U8R A;  2FYK A;  1IZ6 A;  5GAO n;  1HK9 A;  1N27 A;  4J8O A;  4E7H A;  4Y91 A;  4M78 B;  1M1F A;  4M78 G;  3L2Z A;  1YJW A;  4M75 D;  2ZCF B;  5LJ5 f;  2EAY A;  3MCA B;  2OTL A;  1YJN T;  2AHJ B;  5GAN 6;  1WQW A;  1H64 1;  1JRI A;  3CCL T;  4FSX A;  1D3B B;  4J7F A;  3V7R A;  3VUZ A;  3VJP A;  3CCV A;  4KUI A;  1QVF A;  1YJN A;  4JRP A;  3CCL A;  4N4G A;  3SB2 A;  2X4J A;  1NZ9 A;  4XTW A;  3JCM e;  3HRU A;  2E6Z A;  4XTZ A;  4QVD A;  3CMA T;  2E12 A;  4LDY A;  3EFS A;  3X26 B;  1NPP A;  4E7L A;  3CBM A;  4M75 A;  4XK8 E;  3RKW A;  1M4Z A;  4F7U E;  4FL6 A;  3JB9 D;  4JRK A;  2ZPF B;  2E5Q A;  3E9F A;  3M59 A;  4M77 A;  2JZ2 A;  4JS4 A;  1G3T A;  5GAN j;  3OB9 A;  4JUV A;  2YRV A;  3CPW S;  1I5L A;  5I21 A;  4PKC C;  4XTY A;  3CC4 T;  3UWN A;  4KUD K;  2PVO B;  2K57 A;  4C92 D;  4M78 F;  4N4I A;  1QW1 A;  3FC3 A;  4MZT A;  5GAN 7;  3CC4 A;  2QXF A;  1HXD A;  1UGR B;  3MHX A;  1U1T A;  4Y28 E;  3JCM V;  2DPP B;  2QQA A;  5GAN 3;  2DIG A;  2RI3 A;  5FU7 B;  1WJQ A;  1YHQ T;  2LT1 A;  3SDZ A;  2EYQ A;  3KUF A;  3I56 T;  2CYZ B;  1VIE A;  4XTU A;  1VQ9 T;  1YHQ A;  4BE0 A;  1KQS S;  2EJF A;  3HL8 A;  5LJ5 h;  2E1H A;  1I4K 1;  2EFI A;  3MP6 A;  3V8L A;  3VU3 C;  3DB3 A;  4JLG A;  3SD4 A;  4NS5 A;  4C92 A;  3CXC A;  2ZPI B;  5CK9 A;  4EPC A;  5LJ3 h;  4EMK C;  4RCB A;  2K5L A;  4ELZ C;  4PJO G;  1BKB A;  2IG0 A;  3TRE A;  1BI1 A;  2LC4 A;  2LQ8 A;  4BDY A;  4HT8 A;  2DXC A;  4OB2 B;  3S6W A;  2BIV A;  4C5G A;  5CKD A;  5GAN 8;  1NJI C;  4TVR A;  3SWN A;  2D6F A;  3OYB A;  4HKE A;  4RKU E;  3OYD A;  1KC8 C;  3MET A;  3PMT A;  5I2S A;  4JLI A;  5DLQ E;  3E1S A;  4NL2 A;  1K73 C;  4ATO A;  1G5V A;  4OB0 B;  2DXU A;  2E70 A;  2EQK A;  2LT4 A;  5A0L A;  4JS5 A;  3RER A;  1IRE B;  2DIQ A;  3FIF A;  5L8R E;  3A8H B;  1G3W A;  3CCU T;  3L2V A;  4FT2 A;  3J80 E;  2JTM A;  4RG2 A;  2G3R A;  3RKY A;  3C12 A;  2WSC E;  5HKC A;  3RIR A;  1W2B S;  3CCU A;  4FIB A;  2V8I A;  5GMK h;  2JVV A;  4XTX A;  3ZEH A;  3PT9 A;  3JCM g;  1K9M C;  3J81 E;  1JJ2 S;  1Y96 A;  3OYC A;  1LOJ A;  4PJO F;  4KT0 E;  3QBY A;  3R6O A;  4WF2 A;  4M77 E;  4M77 C;  3QII A;  3E19 A;  1EIF A;  4FM4 B;  4BB7 A;  4C0Z A;  4E7J A;  3CBP A;  2QEX T;  1ZQ1 A;  1Q86 C;  4XU3 A;  4JJN K;  3UPU A;  2D9T A;  2X4W A;  4X9D A;  3HHT B;  2HQE A;  2QEX A;  1X75 C;  3CC7 T;  1I8F A;  3OW2 A;  4LDU A;  4F7U B;  1M1K C;  2HAX A;  2HD0 A;  4F7U G;  2CZ0 B;  3AHU A;  3V8K A;  2ZGW A;  5M9O A;  1B34 A;  2YLB A;  3OYL A;  2DTI A;  2RHY A;  2XU8 A;  4C8Q F;  1N8R U;  4M7A D;  1QP3 A;  1RI0 A;  3M5A A;  4N0A A;  3FRN A;  5GAN d;  4E47 A;  2F69 A;  4E7K A;  1Q82 U;  1VQ7 T;  3QDR B;  4A4E A;  3CD6 T;  3QPH A;  2EJG A;  2Y4Y A;  4PJO E;  4M7D A;  4IKF A;  3G7Z A;  3QO3 A;  3HFO A;  1FX7 A;  4LDW A;  5GMK i;  3CD6 A;  2XDP A;  3L2R A;  4II1 A;  3CCE T;  1Q7Y U;  4N4H A;  1PSF A;  1O9S A;  4A4K A;  5GAM e;  4PL6 A;  4ZGJ B;  1BIA A;  2DXT A;  2X4X A;  3QYG B;  3SWN C;  4HT9 A;  4GLK A;  3OMC A;  2O4X A;  1V29 B;  2PU9 B;  3A8L B;  3OS2 A;  2M9U A;  5KCO A;  2DTO A;  5D6Y A;  4M7A A;  3QHS A;  2RA2 A;  4HA8 A;  4L6V 5;  4ZTJ A;  4V2S A;  4J6W A;  4EMK B;  1WJR A;  1R8O B;  1XOV A;  2QA4 T;  4F7U F;  2X4Y A;  3OSS C;  4E7I A;  2RHX A;  3CC2 T;  2H3J A;  4ELY C;  3OYI A;  3GNG A;  3GIB A;  1YJW T;  3QZ9 B;  3WVE B;  4MZM A;  1WGS A;  4C8Q E;  4C8Q C;  4UC4 A;  2QA4 A;  3CC2 A;  3QG1 A;  4M78 D;  5FU6 C;  3JB9 H;  4EMH A;  3PGG A;  4P5N A;  2OTL T;  3HRT A;  2DD5 A;  2MI6 A;  3CPF A;  5I2M A;  4IUP A;  4DQ2 A;  4BE1 A;  4C0D B;  1Q7Y C;  4PNO A;  3CCV T;  3X28 B;  1M90 U;  2FVU A;  1M5Q 1;  3JCM X;  2VC8 A;  3VYG A;  4O6J A;  1QP2 A;  4MZP A;  1WNL A;  1VQ4 A;  5J39 A;  3I55 T;  5FLX E;  2DO3 A;  4RMO A;  3LH0 A;  1YCY A;  2CS7 A;  3L1A A;  3SFM A;  3QZ5 B;  2OTJ T;  2ZPE B;  5FRO A;  4A4G A;  3I55 A;  2FHD A;  1PSE A;  3MP8 A;  2EWN A;  3OYN A;  2DJZ A;  2LVM A;  4J83 A;  4ZTF A;  2OTJ A;  3MEU A;  3HRS A;  2E64 A;  2Y4X A;  3OQ5 A;  4M78 A;  5CKH A;  4ZN3 A;  3PFS A;  4XAX B;  5IT9 E;  5LJ3 e;  2KAF A;  3DKM A;  2E65 A;  5HK3 A;  1FWZ A;  3HP9 A;  3JCM f;  3X24 B;  4BDZ A;  1D3B A;  1M90 C;  5GAN h;  4M77 B;  2JUF A;  1WPY A;  4M77 G;  4Z02 A;  4MMK A;  2R57 A;  1UGP B;  2DKG A;  3PIP A;  5HY6 A;  3GPL A;  2QDY B;  3CPW A;  3M53 A;  2RJD A;  1P92 A;  1ZHI A;  3A8M B;  3TCJ A;  4EDU A;  5LL6 S;  3GOX A;  1QVP A;  2A3L A;  3M57 A;  4IUU A;  2L89 A;  3MEA A;  4QVC A;  2V8K A;  4A4H A;  5GAM j;  2B8A A;  2CZ7 B;  1M8V A;  3H6Z A;  3CCS T;  1XNI A;  3G4S T;  4M7D C;  2XK0 A;  5GAO l;  4QVZ A;  4B9X A;  1I81 A;  1YJ9 T;  2D0Q B;  4LDV A;  4L59 A;  4LD9 K;  5GMK e;  2R5A A;  3CCS A;  4OMF B;  3G4S A;  1QVG S;  3LWH A;  4ZGD B;  5GAM g;  1YJ9 A;  1H3Z A;  3QJY A;  5FU7 C;  1MHN A;  4MDX A;  3JCM P;  2PVD B;  4DA4 A;  3HPW A;  2LX9 A;  4C0F A;  4OB3 B;  1KQS A;  4PJO D;  3BY7 A;  3G71 A;  3TU4 K;  4PJO B;  4QQD A;  3VYH B;  1X6O A;  1JB0 E;  4M75 F;  3HSB A;  1ZBX A;  5CCA A;  3CME T;  4M77 F;  4ME7 A;  2XD0 A;  1SSF A;  2HQX A;  3GF5 A;  3RES A;  4X9C A;  3JCM Q;  5FRM A;  3CME A;  3CEY A;  2RO0 A;  1DJ7 B;  2DXB A;  2GFU A;  4LD6 A;  1XQH A;  5GMK l;  2DVE A;  5J3B A;  4A4F A;  1X01 A;  4HCC A;  2ZPG B;  3H8Z A;  4J6Y A;  2QQ9 A;  2LNV A;  5LJ3 j;  4C8Q D;  1BI3 A;  4C8Q B;  4IUQ A;  4C5I A;  4C8Q G;  3UT1 A;  1G3S A;  5GAN 2;  3JCM J;  3V7S A;  5D6W A;  3LLR A;  3OYK A;  3A8O B;  3WXM B;  1W2B A;  2WSE E;  1VUB A;  4CRI A;  2EIF A;  2MWO A;  2WSF E;  5J26 A;  2M1H A;  1OZ2 A;  2RD1 A;  2YLC A;  3ZFJ A;  3JCM W;  4PLL A;  5LJ3 g;  4X34 A;  5CAI A;  4M75 E;  3X25 B;  4C92 F;  4M75 C;  5C0M A;  2CGH A;  5CO7 A;  5KCH A;  3S3N A;  3S3O A;  1JJ2 A;  5CQY A;  2KQW A;  3HFN A;  1VQK A;  3NTK A;  4BI8 B;  4R56 A;  4DOW A;  3LX7 A;  3M4G A;  1U1S A;  4L5G A;  4LDX A;  2EQM A;  2X35 A;  3QUI A;  4OGE A;  5GMK j;  4J7I A;  4D6W A;  5GAN 5;  4XU1 A;  2K3Y A;  5EG2 A;  5A0D A;  5A2Q E;  5C6S A;  2E10 A;  2JOY A;  2EQU A;  1W4S A;  2HNI A;  3C95 A;  5GAO q;  3INZ A;  4A54 A;  1UGQ B;  2KSS A;  2DTH A;  2RJE A;  4BD3 A;  4C92 E;  2DZ9 A;  2ZZD A;  1YBY A;  4C92 C;  2XID A;  3X20 B;  3JB9 J;  2P0K A;  3M56 A;  5DLO A;  2R5M A;  3VKI A;  2DEQ A;  1Y71 A;  1Q81 U;  4F7U A;  4M7D G;  5GAM d;  3L42 A;  3OYA A;  4J6X A;  1VQN A;  1VQ5 A;  4EMG A;  1VQ8 T;  2YHT A;  4RCC A;  3KXT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...