2PVDB

Crystal srtucture of the reduced ferredoxin:thioredoxin reductase
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
73
structure length
73
Chain Sequence
MNVGDRVRVTSSVVVYHHPEHAKTAFDLQGMEGEVAAVLTGWQGRPISANLPVLVKFEQRFKAHFRPDEVTLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-thioredoxin reductase, catalytic chain
publication title Structural snapshots along the reaction pathway of ferredoxin-thioredoxin reductase.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Electron transport
total genus 11
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02941 FeThRed_A Ferredoxin thioredoxin reductase variable alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2pvdB00
3QZ9B 3X26B 2ZPEB 2WSCE 3LW5E 1IREB 1AHJB 2DXCA 3A8GB 3QYGB 3WVEB 2WSFE 3QXEB 4KT0E 2ZPFB 2CYZB 4OB1B 2QDYB 3WVDB 2PUOB 2CZ6B 1PSEA 2PU9B 2DXBA 3QYHB 3VYHB 3QZ5B 3HHTB 3X25B 5L8RE 1JB0E 1QP3A 2PVGB 4ZGEB 3X28B 4ZGJB 2WSEE 4OB3B 2CZ1B 1UGSB 1UGQB 4L6V5 3VYGA 4RKUE 4FM4B 4OB2B 2O01E 1QP2A 1DJ7B 3A8OB 2DPPB 1V29B 2AHJB 1UGPB 2D0QB 1GXIE 3X20B 2ZPGB 2PVOB 3A8LB 4XK8E 2ZZDA 2PVDB 2DD5A 2PUKB 4Y28E 2CZ0B 3A8MB 3A8HB 2ZCFB 4OB0B 4ZGDB 1UGRB 2DD4A 2CZ7B 2ZPIB 3X24B 1PSFA 2ZPBB 2ZPHB
chains in the Genus database with same CATH superfamily
4GY5A 2ROTA 4M78C 2WSCE 1ABOA 1ZLMA 1MHNA 1ZQ1A 2EJFA 2DXCA 3VS5A 1S72A 5GAMd 5CKFA 1F1BB 2E5KA 3WVEB 3CCVQ 1KQSS 2ZGWA 4BE1A 3OA6A 2VB6A 4NL3A 1UHCA 2DL7A 2X9HA 3UF4A 5GMKh 2P0QA 1N8RR 2JMCA 3R6OA 4Z02A 4QQ6A 4ATOA 2EFIA 3M4YA 4JJDA 1T3SA 1VQ8T 5FRMA 1P92A 4OVAA 3VS0A 2FZGB 3TQ7P 2AIRB 2HL3A 1FMKA 2D0NA 3OQ5A 1SKUB 2P84A 3REBB 2KDSA 1OU9A 4J9FA 2A3LA 2YXYA 1JO8A 4N4IA 3CD6T 2K3YA 1WXBA 4M78F 3D7SB 3EGXB 4PJNA 4EMGA 3GNGA 1UGQB 3CC7T 5DY9A 2BE9B 4E7SA 1ZX6A 2D8JA 2MWPA 3L2ZA 3FDRA 1I5OB 2KGTA 4FYVB 3CCVT 1SEMA 2DZCA 1VQLQ 2IVWA 3M0UA 4OMPA 3EG9A 3O8VA 2MF2A 2LZ6B 4RCBA 4F04B 3OYNA 1KC8U 2RK1A 1T0HA 4J6YA 1UE9A 2M9UA 3MEAA 2C0OA 3OW2S 4XTVA 4J9EA 1M3AA 4Y28E 3A8MB 4EMKC 4B9WA 1N5ZA 2FPEA 3OS2A 2XIDA 3SEMA 1HD3A 3CEYA 1KFZA 1S72Q 1D0ZA 2YUPA 5FU6C 1ACMB 2DE0X 4F7UE 5J39A 1PKTA 1Q82U 1WJQA 3J80E 1M90U 3JB9H 2DYBA 5GJVB 1SHFA 2IIMA 4PK4A 2X4JA 1G8XA 2EQKA 5D7UA 5LJ5g 1IHVA 1VQLT 1ABQA 1LNXA 4LDUA 2X3WD 3L2WA 4HT9A 2CSIA 3MHXA 2HQHA 5IAYA 2V8IA 2K3BA 3RMQA 3OMGA 4AT1B 3CBPA 4RTUA 1PSEA 3LLRA 5I21A 1WYXA 1VQPA 1NYFA 3X25B 1VQNT 2VKNA 1BK2A 3TEEA 4QVZA 1S72T 3KFVA 1OPLA 3HRTA 2YUQA 2I0NA 4CI0C 4JJBA 3VV0A 2CZ1B 2KAFA 3A98A 2DEUA 1C6VX 2DL8A 2LTOA 4C0GA 4FM4B 4FT4A 3ZFJA 1Z9ZA 1YWOA 1YJNQ 4JRKA 4DBHA 5LJ3j 2GBQA 3M53A 3PFSA 1Y57A 4DBRA 1RAEB 1UEBA 3OS5A 4PLIA 3UPUA 1UJ0A 3A5ZB 3H6ZA 1OPKA 1BYMA 2DBMA 4KH0B 4R0KA 4C5IA 1A0NB 2DD4A 3PIOA 4E7IA 4ZNXA 2X3XD 1H8KA 1PKSA 1IRXA 2KRSA 1YI2A 1AVZC 4ZTJA 2XG8D 2GQIA 3UATA 4QQGA 3OYFA 3C95A 4CC2A 2LJ1A 1R0CB 3I5SA 1R0BG 1W4SA 3JCMJ 1YJNT 1N8RU 1QWEA 1VQ9Q 1VQPQ 3E19A 2QAZA 4C0ZA 1MV0B 2CP3A 5C0MA 1X6GA 3ZL7C 5GAMg 4DBFA 2YUNA 1ZSZA 4IUVA 1QWFA 2G3RA 3S3OA 1VOMA 1SRMA 1TWBA 2GNCA 4WCIA 3NGPA 5CK9A 5LJ3h 4WTOB 3OYIA 3M0RA 2EYWA 2RQRA 5IT9E 4LXCA 4MDWA 2GQVA 1I1JA 2ECZA 1YJ9Q 3QJYA 3M55A 5IN1A 3LWIA 1D1BA 4L6V5 2DVEA 4XAXB 5HKCA 2KYMA 2M1HA 3MP8A 1NZ9A 1M27C 1O9SA 3EH1A 4C92C 1VQ9T 1JU5C 3A8OB 1NJIC 4X1VA 1G2BA 3H41A 5KCOA 4DOWA 3OYHA 3OYJA 1WHLA 2QTXA 2NWMA 3UA6A 1H3ZA 1VQKA 4OMQA 2DIQA 4X34A 3L2QA 2C0TA 3OSSC 1XOVA 4IKFA 1YJWA 2QG9B 3TCJA 2LCSA 3JB9F 4RUGA 4CC4B 1YJ9T 2AT1B 1QVFS 3THKA 2ZPHB 2P4RA 3CBMA 1TU0B 4DQ2A 5GANh 3X26B 4C8QA 2KYBA 1IXDA 4C92F 3J81E 2H8HA 3OYCA 1M1GA 2DTOA 1VYUA 3DB3A 4M7AC 4IUQA 4DA4A 2QGFB 1TXQA 3ER0A 2CYZB 4O5VA 3L2VA 2EYZA 2JS2A 1MMAA 1OOTA 3QPHA 1NBEB 2LP5A 3OYBA 1OULA 4RTWA 1KSWA 1FYNA 2V1QA 4E7HA 4Z8AA 1OZ3A 4C8QG 1ZSZB 2YHTA 2QGGA 3GBQA 1YIJA 1KQ2A 1K73C 4II1A 2FRYA 4KGVB 3OS1A 2RQWA 4LNPA 3G71Q 1EX4A 1NPRA 2O88A 3TVTA 3RKXA 4E7LA 1M2VA 2L5QA 4GLMA 3GLXA 3MEWA 4M7AF 5CKEA 2F2XA 4MZTA 2K5FA 2F2VA 1VQKQ 1KQ1A 2DIGA 2LQ8A 3CCQA 3LX7A 2L3SA 4JRPA 5CQYA 5I2MA 1OV3A 3JB9D 2YRVA 4XTWA 4BD3A 3JCMQ 2QDLA 4RG8A 4IUUA 4F7UA 3OBWA 4DBQA 2O4XA 4OB0B 3JCMP 3I9QA 1BI3A 2JT4A 3EH2A 4HCBA 4RTTA 1PD1A 3G71T 1PSFA 1OYXA 2VYTA 3QDRB 1BKBA 3LH5A 4L5GA 5J3BA 2KVQG 3DKMA 4CC3A 1WJRA 3QZ9B 2GCXA 2HKQB 2RHIA 9ATCB 3LW5E 3QSUA 3RIRA 1GBRA 3QYGB 1I81A 1PNJA 5LJ5h 1FXXA 4M77G 2KR3A 4C8QB 3PVLA 1E6GA 3EGDB 5GAN8 1PRMC 3CPWP 1YIJQ 5IHKA 4EPCA 2VC8A 2LC4A 1PHTA 1LCKA 3MEVA 2E4HA 2NUTA 1EZZB 4BE2A 4EDUA 2D9TA 2KQWA 4P5NA 4N0AA 2HBWA 3CD6A 3MP6A 1IHWA 1RAIB 2EYXA 3JCMh 2DA9A 1HJDA 3M9QA 5AT1B 3ZEHA 4O6JA 3CC7A 1YWPA 2FO0A 4A53A 4BY6B 1WHHA 1WJSA 3CCQQ 3SWNA 4IIOA 2FYKA 5CO7A 1Q81R 3CCVA 5GAMj 4JZ4A 3CCMQ 1G83A 1X2QA 3CCLT 4KUIA 2LX7A 2RB6A 3VS3A 3JB9I 4XU1A 1PG5B 1M2VB 1VQ4T 2CT3A 2X51A 2HSPA 4JUVA 2ZPGB 1YIJT 3CQTA 2QASA 1W2BS 2G6FX 2RMOA 2L8DA 5KYYA 1IGUA 1I4K1 1AWXA 3M57A 2EQIA 2L2PA 3KBGA 2P0KA 3P8DA 4C0FA 1U3OA 4BDZA 3HP9A 3OYMA 3CXCS 4M77B 2FPFA 3VS4A 3CCQT 1NJIR 3FJ5A 5DM7R 4A63B 2O4XB 4M75A 5CKBA 2OTLT 5GJWB 1IREB 3CCMT 1WNLA 4PFOA 2E12A 3EHQA 5L23A 3NTKA 3EGUA 3RR6A 3LH0A 1YHQQ 2K4YA 1AWOA 4ORZA 5GAMh 3OW2A 1JJ2S 1XQHA 2M16A 1VQNA 4M7DA 3CC7Q 1B3QA 2HBPA 2DM1A 4LUDA 1WHGA 5EC7A 4M75G 2FVUA 1H92A 2ED0A 4HKEA 4C8QE 2BZYA 2EKOA 2MI6A 2GTOA 3PMIA 2DXTA 2NUTB 1VA7A 7AT1B 2KRMA 1KJWA 4J9GA 4LDWA 4JS5A 2JJ9A 1OX8A 3JCMc 3E1SA 2DEQA 2K7AA 1KQSP 3LYIA 2KROA 3R6NA 1Y96A 2JM9A 3FB9A 2LQNA 1JXMA 3SDZA 3WXMB 5A0GA 5GMKl 1JRIA 2HL5C 2OJ2A 2VV5A 1VQMT 1YHQT 2ENMA 4M7DG 3SWNB 5GMKm 5I11A 1YCSB 3N5BB 4QW2A 5CR2A 1W1FA 2DL4A 2MMPA 2LNVA 3QO3A 2JW4A 3OYEA 2BZXA 3ZBDA 1S1NA 3TSWA 4KGXB 2RO0A 1K73R 3T9NA 1GFCA 2CREA 4FW1A 2KXDA 3UA7A 5IXFA 2PNIA 3A8HB 3G4SA 3MPUB 1OEBA 4NL2A 1KHCA 3JV3A 2RPNA 5DLQE 4KULA 2ZPBB 2QXFA 4PJMA 2K2MA 5KYYB 1K0XA 2DETA 3EFSA 3OY9A 1ZBJA 2GF7A 1YJNA 3LGFA 2E3HA 4E7ZA 3P8HA 2YWWA 2P0PA 2JTEA 2WSFE 1VQNQ 5FLXE 1VQ6T 3INZA 4ZN3A 4M75B 2ZAEA 3M0SA 2FZCB 3OW2P 4M77E 2SRCA 2FHDA 1JEGA 2QQ9A 5LL6S 1BI0A 5IHNA 4OB1B 4E7KA 2K79A 3VS7A 2JUFA 3PE0A 2F2WA 1GFDA 1UUEA 1Q7YC 1PM3A 2JS0A 4QT7A 3C4SA 4E2FB 2DK3A 2LJ3A 4X9DA 1K9MC 2O9SA 2CP6A 2HNIA 4RMOA 2DYIA 1Q81U 1M1KR 4ZGEB 4M7DB 1MNEA 2E41A 3IQLA 1LOJA 2FZKB 1UHFA 4ZGJB 2RJEA 2RI2A 2W10A 4FYXB 1VQ9A 3RKYA 3CCEQ 1E7OA 2O01E 1UG1A 2R57A 2XKOC 1FX7A 4J9BA 4XTZA 1MMNA 1RLQC 3ME9A 4LD6A 4PL6A 2AHJB 3G4SQ 1RABB 4BI8B 3NPFA 2M51A 2KT8A 4AG2C 1Y96B 1WI7A 2NUZA 2EJGA 4XK8E 3M54A 2XDPA 2V8JA 2RJDA 1BB9A 2RHUA 3FJPA 3HL8A 4JRQA 4C0DC 2DF6A 4Q5WA 4LDYA 4KRTA 1N9SA 3CC2A 4LN2A 4PJOG 2A36A 1YJ9A 2KBTA 1AZGB 2ZPIB 1NJIU 1HXDA 3EFOB 3OYDA 3EFRA 4JZ3A 3CCRQ 3H0IA 2C0IA 2O9VA 2XU8A 1QVPA 1OU8A 3QIIA 3EG2A 3PMTA 3CCET 2NYSA 1K8AC 5KE2A 4MDXA 1VQOA 1U8RA 3G4ST 4KT0E 4AFQC 3JAME 2JXBA 1YN8A 2Y4YA 3MCAB 5FU7B 2R58A 4X9CA 3NTHA 5FW9A 4TVRA 2DXBA 3HPWA 2EQUA 4NS5A 3J7AF 2JNGA 5CAIA 3EG1A 4HCKA 3NHNA 4J7FA 4OMOA 4F7UF 2QYZA 3CCRT 1H641 4QQDA 5AYFA 3V8LA 4A4KA 4C8QD 2LQKA 4M75E 1Q81C 4XU3A 2E10A 4XTYA 4OB3B 2BTTA 1UJYA 2X4YA 4RKUE 3JCMV 3RERA 2CUBA 5D6WA 5GANj 3HKSA 1WPYA 2JTFA 1U1TA 1NEBA 4PJOB 2K5IA 3EG0A 2PQWA 2HQEA 1K73U 2O31A 3CC2Q 1UGPB 2D0QB 2RK2A 4HT8A 4OGEA 2HZYA 1D1CA 3VKIA 4M7DE 3G1JA 1W70A 4HA8A 2BE7D 1J3TA 2RNAA 2X35A 3L2RA 2VXFA 1NM7A 3G71A 2DTHA 4Y92A 5LJ3d 1X6OA 4OF1A 3M4GA 3X24B 3URGA 2Y90A 3Q1JA 1KK7A 2J6KA 2LQWA 4DOVA 1VQOQ 3V7RA 4M78G 2J05A 1WZOA 1VQ7Q 4B6MA 5I2SA 2V26A 3C12A 5IH2A 2HDAA 2X4XA 3QG1A 2LDMA 3L1AA 1D1AA 3JCMW 2LT4A 4ELZC 3CC2T 2X4WA 5CKDA 3PT9A 3QHSA 1R77A 1K9AA 4M77D 2QK0A 3QDFA 2KMTA 1KG1A 1M3BA 1WHMA 2CZ6B 2CP0A 4MMKA 2LJ0A 2VUBA 2E65A 3EGDA 2XICA 3I5RA 3QYHB 1Y0MA 2COWA 4JLIA 2FPDA 3AHUA 1M1KU 2LNHB 4XTXA 1WGSA 2DILA 1QVFP 4K11A 1U5SA 4OMMA 5FWBA 2KEAA 2D6FA 3EAEA 1TSFA 2KE9A 1ZBXA 1VQOT 1SPKA 1JB0E 4EMKA 3OMCA 1VQ7T 4HVUA 1UGSB 3FLGA 3VYGA 1RAFB 3CCLA 2MIOA 1JXOA 3CPWA 5KE3A 2CH4A 4XTUA 1VQ4A 1LPLA 4Z88A 3V7CA 1BI1A 1SRLA 2RI3A 2DPPB 1Q7YR 3I56A 5LJ5j 4FCYA 4J9IA 1O75A 3VU3C 1K9MR 3MEUA 3UT1A 4M78B 2Y4XA 2BKDN 2CSQA 3MKDA 1PRLC 5GMKe 2PUKB 1AEYA 1ZA2B 1HYOA 2CP7A 2HKNA 5DLOA 2HEQA 4M7DF 2ABLA 1ARKA 1Q86R 4PJOE 2DL5A 2QTVA 1WLPB 2OX7A 5HY6A 1AOJA 3CPFA 1YFNA 2KRNA 2OTLA 3CCMA 2HSEB 5GAN7 2XK0A 5FRNA 5GAOp 2FEIA 4QVCA 4PJJA 4M77A 3QKJA 2LT1A 2XI9A 2MK5A 3HFOA 1PD0A 5GAOl 2KT1A 2OAWA 2FL7A 2Z0WA 5GAOm 4A4GA 4JDSA 3CMAQ 1B34B 1M2OA 2E64A 2RD1A 3E9FA 4DEYA 2D8HA 3I55A 4GLKA 2EGEA 2QEXQ 2QQSA 4PLLA 3G6EA 5CQXA 2K57A 1I8FA 2DLPA 1M9SA 3PGGA 1M1KC 2F5KA 2RQTA 2JZ2A 3BDUA 2MOXA 4LUEA 2YT6A 1QKWA 3CCLQ 4OGCA 1K8AR 4N4HA 1QVGS 4KBMB 4M75D 2CP2A 2YDLA 3VS1A 1VQ4Q 2LCLA 1NLOC 3KUFA 1WIEA 1B7TA 3AT1B 2JOYA 2HMAA 3I56Q 3BE3A 1G3TA 1ZUYA 3M5AA 1VQMA 1YHQA 1GBQA 1VQ5T 3RESA 4EMKB 4F14A 5EG2A 5FWCA 3CMAT 2CGHA 1TOVA 3G7ZA 3VS6A 2DFUA 2ED1A 5FU6B 4M7DD 1CKAA 2QEXT 1JJ2A 1QCFA 2OTJA 1YBYA 2I2LA 1RUWA 1VIEA 2J7IA 5GAOr 1BI2A 1GCPA 2EVRA 2OTLQ 3CMEQ 1FMVA 5KYUB 1TH7A 4LD9K 4IUTA 1KQSA 1K0SA 4A54A 2EIFA 1TS9A 1AZEA 3JCMd 2MPXC 4YTLA 1EIFA 2L3PA 4CC7A 3I56T 1V1CA 5LJ3g 1WQ7A 4IUPA 4M78E 4QVDA 2HD0A 3SB2A 4E7JA 4C5GA 3I55Q 3OBYA 2A37A 3G6EQ 1VQ6A 3UDCA 2B86A 3H9NA 2HAXA 4PJLA 1W2BP 2VGMA 2RH2A 3S3MA 1QCNA 3UWNA 1G3SA 1M30A 1ZSGA 2PU9B 1D3BB 3CMET 1WQWA 4HCZA 1X75C 2L0AA 1VYVA 1GCQA 3CXCP 4ANJA 1U06A 4N4GA 5FROA 2DBKA 2RA2A 4BDYA 1VQMQ 3QBYA 2PVGB 1M4ZA 1I0CA 2IG0A 2EQMA 2FG0A 4JPBW 3VS2A 5GAN3 4ESRA 2P4TA 1C1AA 4LDXA 3I55T 4C92G 3M56A 3L2UA 1Q7YU 2OTJQ 3G6ET 1QP2A 3RKWA 1JQQA 1PCXA 3S6WA 1MMGA 1K9MU 1ZSZC 1K1ZA 4FYWB 3CCSQ 1JJ2P 3MO8A 1RI0A 2CKKA 4M7AA 1IB8A 4ZTFA 1Y71A 4AMCA 4HCCA 2R5MA 3V8JA 4ELYC 1Q86U 2JM8A 2RF0A 1KD1U 3H0HA 4OMLA 4GBQA 3RUXA 4KH1B 2JN0A 5C6SA 1N27A 3EHRA 2H3JA 2CZ7B 4PJOD 1ZA1B 2QQBA 4FW2A 4A4FA 5LJ3e 4V2SA 2H3EB 2KNBB 1VQ6Q 8ATCB 1WA7A 3CCEA 2V1RA 2RHXA 3EFOA 1UECA 3FRNA 3OYLA 2COZA 2KSSA 2OTJT 3QUIA 1WX6A 3NTIA 1G3WA 2RJCA 4M7AG 1RADB 2K6DA 1RLPC 2DRMA 4RCCA 3BFMA 3CCST 5KYWA 2NUPB 1FMWA 1KHIA 3BY7A 2PZ1A 3CCJA 3CCUQ 4PKCC 1WDXA 2EJ9A 2QDYB 4JLGA 3M0TA 1Y07A 1D0YA 3TREA 1K8AU 4KGZB 5GAN5 2B8AA 3QZ5B 1TTHB 3HHTB 4FIBA 1TG0A 3CCRA 5GAOq 4C92B 1X43A 2RQUA 3L42A 5D6YA 1YITQ 4C8QC 1I5LA 1AWJA 3M59A 2EGCA 3PTAA 2EAYA 2WSEE 1I07A 3OYKA 2QI2A 2FB7A 2DJQA 2MWOA 1WFWA 4AFSC 2F69A 2FRWA 2AK5A 5GANe 2DMOA 2VWFA 1M5Q1 3A1PA 2XDBA 3SD4A 1PC0A 2GTJA 1LJOA 2DTIA 1GXIE 1FWZA 2L3QA 3TSZA 3M58A 3CCUT 3X20B 2A28A 4BY6C 4PJOA 2IPOB 4JJNK 4MZMA 5LJ3f 3BDLA 3O5ZA 3OB9A 1G5VA 4RTZA 3F70A 2OI3A 1Q86C 1KD1C 1MV3A 1M3CA 2DD5A 1RAAB 1UFFA 2CZ0B 4EIKA 1WXUA 4AFZC 4C8QF 1NLPC 2DVJA 1M8VA 4R55A 4M7AB 1YITT 2J06A 4XQ3A 1RACB 3LGLA 2YUOA 2BZ8A 3META 5CVIA 1OI1A 2VASA 1JBMA 4FT2A 5IXBA 2ZPEB 4M78D 5GAN4 2K9GA 3JCMg 1LVKA 3CCJQ 1C0MA 2EW3A 2E6NA 4HXJA 4J6XA 1UDLA 1ZUUA 1UB4A 2VXEA 2ZPFB 3QJ6A 3OSVA 4M77C 3QWXX 5ECAA 4IURA 4D6WA 4D8KA 1IO6A 1YCYA 2DJZA 3RDVA 4IIMA 4BI3A 2DXUA 5KYWB 1E6HA 1SSHA 3DLMA 1AT1B 1K76A 3E9GA 4J8OA 1VQ7A 3HTRA 5CKHA 5GANf 2CT4A 2DO3A 3QWYA 1KC8C 4L59A 2EPDA 2E6ZA 3X28B 1N9RA 2ROLA 5GAOn 4A4HA 4KUDK 2CS7A 3CCJT 3EG9B 2MYSA 1ZHIA 3GPLA 2RN8A 3GOXA 4C92E 1CKBA 3M0QA 2HQXA 4M77F 2CP5A 3JCMb 2KK4A 4JS4A 1V29B 1X27A 1XNIA 1QVFA 1NPPA 1Q82C 5LJ5e 2PVOB 1M90C 1VUBA 3EG3A 3A8LB 4N0AC 2A7YA 2ZZDA 4Y91A 2DKGA 4MZPA 4D8DA 4JJCA 4ZGDB 4M78A 4LDVA 5A2QE 2C06A 5I22A 5KYXA 2MAMA 1QLYA 2KY9A 3SWNC 3DB4A 1ZUKA 1OQKA 2QA4A 2LRQA 2PTKA 1Y7XA 3JCMe 3VUBA 2EBPA 4NOYA 5A0DA 4FSSA 4OMFB 3CBOA 4HVVA 3OS0A 1SSFA 2M02A 3ASKA 3JRZA 1QCOA 4LE9A 3OYYA 4M7AE 2LX9A 3E2UA 3QXEB 4J5YA 5KYNA 1MMDA 1Q95G 2BIVA 3C94A 2PUOB 2A08A 3CC4A 1B34A 2RM4A 1QKXA 3VYHB 4J9DA 1VQPT 5M9OA 4OMNA 2YLCA 2DL3A 5HCKA 4FSXA 3REAB 4FYYB 4M75C 2GFUA 3JSCA 1UTIA 2AZVA 3DLLA 1RI9A 1U1SA 2E1HA 4J6WA 2COYA 1GCQC 1BU1A 2YRDA 5GAN2 1YI2Q 5LJ5f 1VQ5A 4DEXA 1WHJA 1WXTA 4E6RA 2K5LA 3CMAA 3GNFB 4PFPA 3SFMA 2QEXA 4RTXA 4BB7A 4M7DC 1EFNA 4CRIA 3PNWC 3BW1A 4ZN1A 2QA4Q 4FU6A 3FEOA 2CDTA 3JCMf 5GANd 2RHZA 4Z89A 2CH4W 2GFAA 2XMFA 5GAMe 1N8RC 4M75F 4BI4A 1M8MA 4J9CA 2YSQA 4J83A 1QVGA 1BIBA 2KI7A 2E3IA 2EYYA 3PIPA 3MP1A 5KYUA 2DZ9A 3RBBB 2XD0A 3RMSA 3HRUA 3NMZC 1CSKA 2AKLA 5HK3A 1XTDA 1YI2T 1QQJA 1AHJB 1AWWA 2OAUA 5KYXB 1AD5A 4PFZA 1B07A 2E70A 1T0JA 3ULRB 2EWNA 3CC4Q 1Z9QA 1VYTA 3H8ZA 4F16A 1KD1R 2HCKA 4J7IA 4A4EA 3NFCA 5GMKi 3HSBA 4M4ZA 2QQAA 2EKHA 3VJPA 2EQJA 2QA4T 1HK9A 1X6BA 3CMEA 2XDDA 5D6XA 1MUZA 1NYGA 1VIFA 4B9XA 1SHGA 2D1XA 4WF2A 3GIBA 2LVMA 3S3NA 5GAN6 1SG5A 1D3BA 1T3LA 1VQ5Q 2DX1A 4AFUC 5KCHA 1YJWQ 2KXCA 3H0FA 1GL5A 2RJFA 3TU4K 2W0ZA 1W2BA 5FU7C 2SEMA 4ME7A 1NG2A 3JB9J 3GF5A 1TUDA 4F17A 1R8OB 3GP8A 4OB2B 3CC4T 4C92D 2L89A 3I35A 4XU2A 2BUDA 4FL6A 3VUZA 5CIUA 4RG2A 2DAQA 2ESWA 3VRZA 5GAMf 1KIKA 4BUGA 3CXCA 2AZSA 5IHIA 2VVKA 1QW1A 1OX9A 4BE0A 1TUGB 1BIAA 2LCCA 4XU0A 5A0LA 2PVDB 1KC8R 1TUCA 3FC3A 1VQKT 2YLBA 3FIFA 3CPWS 2ZCFB 1QVGP 2JTMA 2K3XA 6AT1B 1G3YA 1X69A 2VGNA 2YRCA 4MMLA 4PJOC 1IGQA 2R5AA 4BACA 1YJWT 4F7UG 2ATCB 4QKUA 2RI5A 5LJ5d 1VQ8A 1M1FA 2AKKA 2RQVA 1QMCA 1BCMA 1NE8A 2MCNA 1BBZA 3VRYA 3SHWA 3LWHA 1RAGB 1PWTA 3A8GB 1IZ6A 4C5HA 2EYQA 1Q82R 3CCSA 2NLUA 1M90R 2LMJA 2A0FB 2M0YA 4M7AD 3JCMX 5J26A 1D09B 1X2KA 2XHCA 3V8KA 4VUBA 1HSQA 2K2VA 4JRIA 2O2OA 2GGRA 1MNDA 3WVDB 3HFNA 2F1LA 2NUPA 3C0CA 3EGXA 2E5QA 3P8BB 4PJOF 2V8KA 4EMHA 2M0OA 5L8RE 2CUDA 2QQRA 4HVWA 3KXTA 1UGVA 2J6OA 4E47A 2DRKA 1RAHB 4C92A 3OYGA 1V76A 1QP3A 1WHKA 1GRIA 1RL2A 3RNJA 4J9HA 5KH6A 2DNUA 1H3HA 5GMKj 1YNZA 1X01A 1XJWB 5CCAA 1YP5A 4C0DB 3PVQA 2F5TX 2RHYA 1DJ7B 4AG1C 3CCUA 3MJXA 1D0XA 2JMAA 1SF9A 4RTVA 3JB9G 1W6XA 3HRSA 4F7UB 3V7SA 4OP0A 3OYAA 2DERA 4R56A 1BCOA 2J6FA 1VQ8Q 1VQLA 3U23A 1OZ2A 4UC4A 1K4US 1YITA 4RTYA 2EGAA 3M0PA 1MGQA 4PNOA 1UGRB 2L3RA 8AT1B 1N6AA 2JVVA 5HK0A 4C5EA 1NEGA 2WACA 5GANg 3CD6Q
chains in the Genus database with same CATH topology
3DKMA 4M78G 1OI1A 1WJRA 3QZ9B 1JBMA 4FT2A 4GY5A 5I2SA 2GCXA 4M78C 2ZPEB 2RHIA 2WSCE 3LW5E 4M78D 3QSUA 3C12A 5GAN4 2EJFA 1MHNA 1ZQ1A 2DXCA 1S72A 3RIRA 5GAMd 3JCMg 2X4XA 3QG1A 3QYGB 5CKFA 1I81A 2E6NA 2LDMA 5LJ5h 3L1AA 3WVEB 1FXXA 4J6XA 3JCMW 1KQSS 2LT4A 4ELZC 2ZGWA 4BE1A 3CC2T 2X4WA 5CKDA 3PT9A 3OA6A 4M77G 1UB4A 3QHSA 2VXEA 4C8QB 4NL3A 2ZPFB 3QJ6A 3OSVA 5GMKh 4M77C 2P0QA 4M77D 5GAN8 3R6OA 4Z02A 4QQ6A 4IURA 4ATOA 2EFIA 2KMTA 3M4YA 1KG1A 4EPCA 1VQ8T 2VC8A 2LC4A 4D6WA 2CZ6B 5FRMA 1P92A 4OVAA 3MEVA 4MMKA 1YCYA 2E65A 2VUBA 2XICA 3QYHB 4EDUA 4BE2A 2DJZA 2D9TA 3OQ5A 4JLIA 2DXUA 2KQWA 4BI3A 3AHUA 4P5NA 4N0AA 3DLMA 1M1KU 4XTXA 1WGSA 3CD6A 3MP6A 2KDSA 3JCMh 3E9GA 2D6FA 2A3LA 4J8OA 1VQ7A 3EAEA 3M9QA 4N4IA 3CD6T 1ZBXA 2K3YA 5CKHA 1VQOT 5GANf 2DO3A 1JB0E 4EMKA 1KC8C 3ZEHA 4M78F 3OMCA 4L59A 4O6JA 4EMGA 2E6ZA 3X28B 3CC7A 1VQ7T 1N9RA 4A53A 1UGSB 3FLGA 3GNGA 4BY6B 1UGQB 1WJSA 5GAOn 3SWNA 4A4HA 2FYKA 5DY9A 3VYGA 3CC7T 5CO7A 4KUDK 3CCLA 3CCVA 5GAMj 2CS7A 3CCJT 2MWPA 3CPWA 3L2ZA 3FDRA 1ZHIA 3GPLA 5KE3A 3GOXA 3CCLT 4C92E 3CCVT 4KUIA 2RB6A 4XTUA 3JB9I 1VQ4A 4XU1A 2HQXA 4M77F 2DZCA 2IVWA 3V7CA 1BI1A 2RI3A 3JCMb 2KK4A 3O8VA 4JS4A 2DPPB 1VQ4T 1V29B 2MF2A 3I56A 1QVFA 1XNIA 4RCBA 3V7RA 5LJ5j 3OYNA 1KC8U 1VQKT 4JUVA 1NPPA 2ZPGB 1YIJT 1Q82C 2RK1A 5LJ5e 1O75A 2PVOB 1VUBA 3VU3C 1M90C 3MEUA 3A8LB 1W2BS 4J6YA 4N0AC 2M9UA 2A7YA 2ZZDA 3MEAA 2Y4XA 2BKDN 4M78B 4Y91A 3UT1A 4XTVA 3OW2S 2L8DA 2DKGA 5GMKe 4MZPA 1I4K1 2PUKB 4Y28E 3A8MB 5CVIA 3M57A 4ZGDB 3KBGA 4B9WA 4EMKC 5DLOA 2P0KA 4M78A 2XIDA 3P8DA 4LDVA 4C0FA 5A2QE 3OS2A 3CEYA 2C06A 4M7DF 4PJOE 2MAMA 3HP9A 3OYMA 2KY9A 4BDZA 3SWNC 3DB4A 2QA4A 5FU6C 2LRQA 5HY6A 3CPFA 3CXCS 4M77B 4F7UE 5J39A 1Q82U 2OTLA 1WJQA 3CCQT 3J80E 1M90U 3CCMA 1Y7XA 5GAN7 3JCMe 2XK0A 3JB9H 5FRNA 5DM7R 1H3ZA 3VUBA 4NOYA 2O4XB 5GAOp 4M75A 5CKBA 5A0DA 2OTLT 1IREB 4OMFB 4QVCA 3CCMT 4M77A 2X4JA 2EQKA 5LJ5g 1WNLA 3QKJA 3CBOA 3OS0A 1SSFA 2LT1A 2XI9A 3ASKA 3JRZA 2E12A 3HFOA 5GAOl 1VQLT 1LNXA 3NTKA 3OYYA 2FL7A 2LX9A 4LDUA 5GAOm 4A4GA 3L2WA 3QXEB 4HT9A 4J5YA 4JDSA 3LH0A 1B34B 3MHXA 5IAYA 2E64A 2K4YA 2V8IA 2RD1A 3E9FA 3RMQA 2BIVA 3OMGA 3I55A 3C94A 5GAMh 4GLKA 3OW2A 3CBPA 1JJ2S 2PUOB 2QQSA 4PLLA 1PSEA 1XQHA 3LLRA 5CQXA 1B34A 5I21A 3G6EA 3CC4A 2M16A 1VQPA 1VQNA 4M7DA 2K57A 2RM4A 2HBPA 3VYHB 1I8FA 1VQPT 3X25B 1VQNT 5M9OA 3TEEA 1M9SA 2YLCA 3PGGA 4QVZA 1S72T 2F5KA 1M1KC 3BDUA 2JZ2A 3HRTA 4M75G 2FVUA 4OGCA 4FSXA 4N4HA 4CI0C 1QVGS 4KBMB 4HKEA 4M75C 4C8QE 2EKOA 2MI6A 4M75D 2GFUA 3JSCA 3PMIA 2DXTA 3DLLA 2LCLA 1U1SA 2E1HA 4J6WA 2CZ1B 3VV0A 2KAFA 3KUFA 4LDWA 2JOYA 4JS5A 5GAN2 3JCMc 3E1SA 2DEQA 2LTOA 4C0GA 5LJ5f 3LYIA 1VQ5A 4FM4B 1G3TA 1Y96A 4FT4A 2K5LA 3FB9A 3M5AA 3ZFJA 3CMAA 1VQMA 1YHQA 3GNFB 1VQ5T 3RESA 4EMKB 3SDZA 3WXMB 5A0GA 5GMKl 1JRIA 5EG2A 4JRKA 3SFMA 5LJ3j 3CMAT 2VV5A 2CGHA 1VQMT 1YHQT 3G7ZA 2QEXA 3SWNB 3M53A 5GMKm 4M7DG 5FU6B 3N5BB 3PFSA 4QW2A 4BB7A 5CR2A 4M7DC 4M7DD 2MMPA 2QEXT 2LNVA 3QO3A 4CRIA 1JJ2A 3OYEA 1UEBA 1YBYA 2I2LA 3OS5A 3BW1A 3PNWC 4PLIA 3ZBDA 1VIEA 3UPUA 2RO0A 3A5ZB 3H6ZA 4ZN1A 4FU6A 3T9NA 3FEOA 5GAOr 1BYMA 1BI2A 3JCMf 5GANd 2RHZA 3A8HB 3G4SA 2GFAA 5GAMe 1TH7A 4LD9K 4IUTA 1N8RC 4M75F 4C5IA 4BI4A 1KQSA 2DD4A 4NL2A 4A54A 3PIOA 4E7IA 4J83A 1QVGA 1BIBA 1KHCA 2EIFA 3PIPA 3MP1A 5DLQE 3JCMd 2DZ9A 4KULA 2ZPBB 2QXFA 1YI2A 3RMSA 2XD0A 3HRUA 4YTLA 1EIFA 4ZTJA 2XG8D 5HK3A 1XTDA 3I56T 1YI2T 3EFSA 5LJ3g 1WQ7A 3OY9A 4IUPA 4M78E 2GF7A 4QQGA 4QVDA 2HD0A 3SB2A 1AHJB 3OYFA 3C95A 1YJNA 4E7JA 2OAUA 3LGFA 4C5GA 3P8HA 3OBYA 2E70A 2EWNA 1W4SA 3JCMJ 1YJNT 1N8RU 1VQ6A 3UDCA 2P0PA 2WSFE 3H8ZA 2HAXA 3E19A 4C0ZA 4J7IA 5C0MA 5FLXE 4A4EA 3NFCA 1VQ6T 5GAMg 3INZA 2VGMA 4ZN3A 4M75B 2RH2A 5GMKi 3HSBA 2QQAA 4M77E 3S3MA 2FHDA 3VJPA 2EQJA 3UWNA 2QQ9A 4IUVA 1BI0A 5LL6S 4OB1B 2G3RA 1HK9A 3CMEA 2QA4T 2XDDA 5D6XA 4E7KA 3S3OA 4M7AE 2JUFA 1G3SA 2PU9B 1D3BB 3CMET 5CK9A 1VIFA 1WQWA 4HCZA 5LJ3h 1X75C 4B9XA 3OYIA 1Q7YC 4WF2A 3C4SA 3GIBA 2LVMA 2DK3A 3S3NA 4X9DA 5GAN6 5IT9E 1D3BA 1K9MC 4MDWA 2GQVA 4N4GA 2HNIA 5FROA 2RA2A 4RMOA 5KCHA 1Q81U 4BDYA 3QJYA 3QBYA 2PVGB 2RJFA 4ZGEB 3TU4K 3M55A 1M4ZA 2E41A 4ZGJB 4M7DB 1LOJA 5IN1A 2RJEA 5FU7C 1W2BA 3LWIA 2RI2A 4ME7A 2IG0A 2EQMA 4L6V5 5GAN3 3JB9J 2DVEA 4XAXB 5HKCA 3GF5A 2M1HA 1R8OB 2P4TA 3MP8A 1VQ9A 4LDXA 3RKYA 3I55T 4C92G 3M56A 1NZ9A 1O9SA 3L2UA 1Q7YU 3GP8A 4OB2B 2O01E 4C92C 3G6ET 3CC4T 4C92D 1VQ9T 2L89A 4XU2A 1QP2A 2BUDA 3RKWA 2R57A 2XKOC 3S6WA 4FL6A 1FX7A 3VUZA 1K9MU 3A8OB 4RG2A 5CIUA 4XTZA 1NJIC 2DAQA 3ME9A 4LD6A 4PL6A 5GAMf 4BUGA 2AHJB 3MO8A 5KCOA 3CXCA 4DOWA 3OYHA 4BI8B 1RI0A 2CKKA 4M7AA 4ZTFA 1Y71A 1Y96B 3OYJA 4HCCA 1QW1A 2QTXA 2EJGA 2R5MA 4XK8E 3M54A 2XDPA 2V8JA 1VQKA 3V8JA 4ELYC 2RJDA 2DIQA 4BE0A 1BIAA 2LCCA 4XU0A 5A0LA 4X34A 2PVDB 3L2QA 1Q86U 1KD1U 2RHUA 3FJPA 3HL8A 3OSSC 1XOVA 3RUXA 4JRQA 4C0DC 3FC3A 4Q5WA 4LDYA 2JN0A 2YLBA 3FIFA 5C6SA 1N9SA 3CPWS 2ZCFB 3CC2A 2JTMA 2K3XA 4PJOG 4IKFA 1YJ9A 3TCJA 1YJWA 1G3YA 2VGNA 4MMLA 1N27A 4PJOC 3JB9F 2H3JA 2CZ7B 2ZPIB 1HXDA 1NJIU 4PJOD 2R5AA 4BACA 2QQBA 1YJ9T 4F7UG 1YJWT 3OYDA 3EFRA 5LJ5d 2RI5A 4A4FA 1VQ8A 5LJ3e 4V2SA 1QVFS 1M1FA 2ZPHB 2XU8A 3CCEA 3CBMA 1NE8A 1QVPA 2RHXA 3QIIA 3FRNA 4DQ2A 5GANh 3X26B 4C8QA 3OYLA 4C92F 3LWHA 3PMTA 3CCET 2KSSA 1K8AC 3J81E 3A8GB 1IZ6A 2OTJT 4C5HA 3QUIA 3OYCA 2EYQA 5KE2A 1M1GA 3NTIA 3CCSA 4MDXA 2DTOA 2NLUA 1G3WA 2RJCA 4M7AG 1VQOA 3DB3A 4RCCA 2OTJA 1U8RA 4M7AC 3BFMA 3CCST 4M7AD 3JCMX 4IUQA 5J26A 3G4ST 4KT0E 3JAME 4DA4A 1KHIA 2XHCA 3V8KA 4VUBA 3BY7A 2K2VA 4JRIA 3ER0A 2Y4YA 2CYZB 4O5VA 3L2VA 3CCJA 3MCAB 4PKCC 5FU7B 2R58A 2EJ9A 2QDYB 3HFNA 3NTHA 3QPHA 4JLGA 4X9CA 3WVDB 1Y07A 3OYBA 4TVRA 3TREA 1K8AU 2DXBA 2E5QA 3HPWA 2EQUA 4NS5A 3P8BB 4PJOF 3J7AF 2V8KA 5GAN5 2B8AA 2JNGA 3HHTB 3QZ5B 4FIBA 4EMHA 5CAIA 2M0OA 3CCRA 5GAOq 4C92B 5L8RE 4E7HA 1OZ3A 4J7FA 2QQRA 3L42A 4F7UF 4C8QG 2YHTA 3KXTA 3CCRT 1YIJA 4E47A 1H641 1KQ2A 4QQDA 5D6YA 5AYFA 3V8LA 4A4KA 4C8QC 1K73C 1I5LA 4C8QD 3M59A 4II1A 1GXIE 4C92A 3OYGA 2LQKA 4M75E 1Q81C 3OS1A 1QP3A 4XU3A 3PTAA 1NPRA 2EAYA 2E10A 1RL2A 4XTYA 2WSEE 4OB3B 3RKXA 4E7LA 5KH6A 5GMKj 2L5QA 2X4YA 1X01A 3OYKA 2QI2A 2FB7A 4RKUE 3JCMV 5CCAA 3RERA 2MWOA 3GLXA 3MEWA 4C0DB 2F69A 4M7AF 5D6WA 2F5TX 5CKEA 5GANj 3HKSA 2RHYA 4MZTA 1WPYA 2K5FA 2JTFA 1U1TA 5GANe 1DJ7B 1KQ1A 2DIGA 2LQ8A 4PJOB 2K5IA 3CCUA 1M5Q1 3CCQA 2PQWA 3LX7A 2HQEA 1K73U 3JB9G 3SD4A 2XDBA 1LJOA 1UGPB 2D0QB 2DTIA 1FWZA 2RK2A 3HRSA 4OGEA 4HT8A 3M58A 4F7UB 5CQYA 3CCUT 3V7SA 5I2MA 4JRPA 3JB9D 2YRVA 3VKIA 3X20B 4M7DE 4BY6C 4PJOA 4OP0A 4XTWA 4BD3A 3JCMQ 4JJNK 4MZMA 5LJ3f 3BDLA 3OYAA 4HA8A 3OB9A 4R56A 1G5VA 3F70A 4RG8A 1VQLA 4IUUA 4F7UA 1Q86C 1KD1C 2X35A 2DD5A 3OBWA 1OZ2A 4UC4A 2CZ0B 3L2RA 1YITA 2VXFA 2O4XA 4OB0B 3JCMP 1MGQA 4C8QF 4PNOA 3G71A 2DTHA 1UGRB 1M8VA 1BI3A 4R55A 2L3RA 4HCBA 5LJ3d 4M7AB 1YITT 1N6AA 1X6OA 4OF1A 2JVVA 4XQ3A 3M4GA 3X24B 5HK0A 3URGA 2Y90A 3Q1JA 4C5EA 3G71T 1PSFA 1OYXA 2VYTA 2WACA 3LGLA 3QDRB 1BKBA 3META 5GANg 4DOVA 4L5GA 5J3BA 2KVQG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QZ9 B;  3X26 B;  2ZPE B;  2WSC E;  3LW5 E;  1IRE B;  1AHJ B;  2DXC A;  3A8G B;  3QYG B;  3WVE B;  2WSF E;  3QXE B;  4KT0 E;  2ZPF B;  2CYZ B;  4OB1 B;  2QDY B;  3WVD B;  2PUO B;  2CZ6 B;  1PSE A;  2PU9 B;  2DXB A;  3QYH B;  3VYH B;  3QZ5 B;  3HHT B;  3X25 B;  5L8R E;  1JB0 E;  1QP3 A;  2PVG B;  4ZGE B;  3X28 B;  4ZGJ B;  2WSE E;  4OB3 B;  2CZ1 B;  1UGS B;  1UGQ B;  4L6V 5;  3VYG A;  4RKU E;  4FM4 B;  4OB2 B;  2O01 E;  1QP2 A;  1DJ7 B;  3A8O B;  2DPP B;  1V29 B;  2AHJ B;  1UGP B;  2D0Q B;  1GXI E;  3X20 B;  2ZPG B;  2PVO B;  3A8L B;  4XK8 E;  2ZZD A;  2PVD B;  2DD5 A;  2PUK B;  4Y28 E;  2CZ0 B;  3A8M B;  3A8H B;  2ZCF B;  4OB0 B;  4ZGD B;  1UGR B;  2DD4 A;  2CZ7 B;  2ZPI B;  3X24 B;  1PSF A;  2ZPB B;  2ZPH B; 
#chains in the Genus database with same CATH topology
 4GY5 A;  2ROT A;  4M78 C;  2WSC E;  1ABO A;  1ZLM A;  1MHN A;  1ZQ1 A;  2EJF A;  2DXC A;  3VS5 A;  1S72 A;  5GAM d;  5CKF A;  1F1B B;  2E5K A;  3WVE B;  3CCV Q;  1KQS S;  2ZGW A;  4BE1 A;  3OA6 A;  2VB6 A;  4NL3 A;  1UHC A;  2DL7 A;  2X9H A;  3UF4 A;  5GMK h;  2P0Q A;  1N8R R;  2JMC A;  3R6O A;  4Z02 A;  4QQ6 A;  4ATO A;  2EFI A;  3M4Y A;  4JJD A;  1T3S A;  1VQ8 T;  5FRM A;  1P92 A;  4OVA A;  3VS0 A;  2FZG B;  3TQ7 P;  2AIR B;  2HL3 A;  1FMK A;  2D0N A;  3OQ5 A;  1SKU B;  2P84 A;  3REB B;  2KDS A;  1OU9 A;  4J9F A;  2A3L A;  2YXY A;  1JO8 A;  4N4I A;  3CD6 T;  2K3Y A;  1WXB A;  4M78 F;  3D7S B;  3EGX B;  4PJN A;  4EMG A;  3GNG A;  1UGQ B;  3CC7 T;  5DY9 A;  2BE9 B;  4E7S A;  1ZX6 A;  2D8J A;  2MWP A;  3L2Z A;  3FDR A;  1I5O B;  2KGT A;  4FYV B;  3CCV T;  1SEM A;  2DZC A;  1VQL Q;  2IVW A;  3M0U A;  4OMP A;  3EG9 A;  3O8V A;  2MF2 A;  2LZ6 B;  4RCB A;  4F04 B;  3OYN A;  1KC8 U;  2RK1 A;  1T0H A;  4J6Y A;  1UE9 A;  2M9U A;  3MEA A;  2C0O A;  3OW2 S;  4XTV A;  4J9E A;  1M3A A;  4Y28 E;  3A8M B;  4EMK C;  4B9W A;  1N5Z A;  2FPE A;  3OS2 A;  2XID A;  3SEM A;  1HD3 A;  3CEY A;  1KFZ A;  1S72 Q;  1D0Z A;  2YUP A;  5FU6 C;  1ACM B;  2DE0 X;  4F7U E;  5J39 A;  1PKT A;  1Q82 U;  1WJQ A;  3J80 E;  1M90 U;  3JB9 H;  2DYB A;  5GJV B;  1SHF A;  2IIM A;  4PK4 A;  2X4J A;  1G8X A;  2EQK A;  5D7U A;  5LJ5 g;  1IHV A;  1VQL T;  1ABQ A;  1LNX A;  4LDU A;  2X3W D;  3L2W A;  4HT9 A;  2CSI A;  3MHX A;  2HQH A;  5IAY A;  2V8I A;  2K3B A;  3RMQ A;  3OMG A;  4AT1 B;  3CBP A;  4RTU A;  1PSE A;  3LLR A;  5I21 A;  1WYX A;  1VQP A;  1NYF A;  3X25 B;  1VQN T;  2VKN A;  1BK2 A;  3TEE A;  4QVZ A;  1S72 T;  3KFV A;  1OPL A;  3HRT A;  2YUQ A;  2I0N A;  4CI0 C;  4JJB A;  3VV0 A;  2CZ1 B;  2KAF A;  3A98 A;  2DEU A;  1C6V X;  2DL8 A;  2LTO A;  4C0G A;  4FM4 B;  4FT4 A;  3ZFJ A;  1Z9Z A;  1YWO A;  1YJN Q;  4JRK A;  4DBH A;  5LJ3 j;  2GBQ A;  3M53 A;  3PFS A;  1Y57 A;  4DBR A;  1RAE B;  1UEB A;  3OS5 A;  4PLI A;  3UPU A;  1UJ0 A;  3A5Z B;  3H6Z A;  1OPK A;  1BYM A;  2DBM A;  4KH0 B;  4R0K A;  4C5I A;  1A0N B;  2DD4 A;  3PIO A;  4E7I A;  4ZNX A;  2X3X D;  1H8K A;  1PKS A;  1IRX A;  2KRS A;  1YI2 A;  1AVZ C;  4ZTJ A;  2XG8 D;  2GQI A;  3UAT A;  4QQG A;  3OYF A;  3C95 A;  4CC2 A;  2LJ1 A;  1R0C B;  3I5S A;  1R0B G;  1W4S A;  3JCM J;  1YJN T;  1N8R U;  1QWE A;  1VQ9 Q;  1VQP Q;  3E19 A;  2QAZ A;  4C0Z A;  1MV0 B;  2CP3 A;  5C0M A;  1X6G A;  3ZL7 C;  5GAM g;  4DBF A;  2YUN A;  1ZSZ A;  4IUV A;  1QWF A;  2G3R A;  3S3O A;  1VOM A;  1SRM A;  1TWB A;  2GNC A;  4WCI A;  3NGP A;  5CK9 A;  5LJ3 h;  4WTO B;  3OYI A;  3M0R A;  2EYW A;  2RQR A;  5IT9 E;  4LXC A;  4MDW A;  2GQV A;  1I1J A;  2ECZ A;  1YJ9 Q;  3QJY A;  3M55 A;  5IN1 A;  3LWI A;  1D1B A;  4L6V 5;  2DVE A;  4XAX B;  5HKC A;  2KYM A;  2M1H A;  3MP8 A;  1NZ9 A;  1M27 C;  1O9S A;  3EH1 A;  4C92 C;  1VQ9 T;  1JU5 C;  3A8O B;  1NJI C;  4X1V A;  1G2B A;  3H41 A;  5KCO A;  4DOW A;  3OYH A;  3OYJ A;  1WHL A;  2QTX A;  2NWM A;  3UA6 A;  1H3Z A;  1VQK A;  4OMQ A;  2DIQ A;  4X34 A;  3L2Q A;  2C0T A;  3OSS C;  1XOV A;  4IKF A;  1YJW A;  2QG9 B;  3TCJ A;  2LCS A;  3JB9 F;  4RUG A;  4CC4 B;  1YJ9 T;  2AT1 B;  1QVF S;  3THK A;  2ZPH B;  2P4R A;  3CBM A;  1TU0 B;  4DQ2 A;  5GAN h;  3X26 B;  4C8Q A;  2KYB A;  1IXD A;  4C92 F;  3J81 E;  2H8H A;  3OYC A;  1M1G A;  2DTO A;  1VYU A;  3DB3 A;  4M7A C;  4IUQ A;  4DA4 A;  2QGF B;  1TXQ A;  3ER0 A;  2CYZ B;  4O5V A;  3L2V A;  2EYZ A;  2JS2 A;  1MMA A;  1OOT A;  3QPH A;  1NBE B;  2LP5 A;  3OYB A;  1OUL A;  4RTW A;  1KSW A;  1FYN A;  2V1Q A;  4E7H A;  4Z8A A;  1OZ3 A;  4C8Q G;  1ZSZ B;  2YHT A;  2QGG A;  3GBQ A;  1YIJ A;  1KQ2 A;  1K73 C;  4II1 A;  2FRY A;  4KGV B;  3OS1 A;  2RQW A;  4LNP A;  3G71 Q;  1EX4 A;  1NPR A;  2O88 A;  3TVT A;  3RKX A;  4E7L A;  1M2V A;  2L5Q A;  4GLM A;  3GLX A;  3MEW A;  4M7A F;  5CKE A;  2F2X A;  4MZT A;  2K5F A;  2F2V A;  1VQK Q;  1KQ1 A;  2DIG A;  2LQ8 A;  3CCQ A;  3LX7 A;  2L3S A;  4JRP A;  5CQY A;  5I2M A;  1OV3 A;  3JB9 D;  2YRV A;  4XTW A;  4BD3 A;  3JCM Q;  2QDL A;  4RG8 A;  4IUU A;  4F7U A;  3OBW A;  4DBQ A;  2O4X A;  4OB0 B;  3JCM P;  3I9Q A;  1BI3 A;  2JT4 A;  3EH2 A;  4HCB A;  4RTT A;  1PD1 A;  3G71 T;  1PSF A;  1OYX A;  2VYT A;  3QDR B;  1BKB A;  3LH5 A;  4L5G A;  5J3B A;  2KVQ G;  3DKM A;  4CC3 A;  1WJR A;  3QZ9 B;  2GCX A;  2HKQ B;  2RHI A;  9ATC B;  3LW5 E;  3QSU A;  3RIR A;  1GBR A;  3QYG B;  1I81 A;  1PNJ A;  5LJ5 h;  1FXX A;  4M77 G;  2KR3 A;  4C8Q B;  3PVL A;  1E6G A;  3EGD B;  5GAN 8;  1PRM C;  3CPW P;  1YIJ Q;  5IHK A;  4EPC A;  2VC8 A;  2LC4 A;  1PHT A;  1LCK A;  3MEV A;  2E4H A;  2NUT A;  1EZZ B;  4BE2 A;  4EDU A;  2D9T A;  2KQW A;  4P5N A;  4N0A A;  2HBW A;  3CD6 A;  3MP6 A;  1IHW A;  1RAI B;  2EYX A;  3JCM h;  2DA9 A;  1HJD A;  3M9Q A;  5AT1 B;  3ZEH A;  4O6J A;  3CC7 A;  1YWP A;  2FO0 A;  4A53 A;  4BY6 B;  1WHH A;  1WJS A;  3CCQ Q;  3SWN A;  4IIO A;  2FYK A;  5CO7 A;  1Q81 R;  3CCV A;  5GAM j;  4JZ4 A;  3CCM Q;  1G83 A;  1X2Q A;  3CCL T;  4KUI A;  2LX7 A;  2RB6 A;  3VS3 A;  3JB9 I;  4XU1 A;  1PG5 B;  1M2V B;  1VQ4 T;  2CT3 A;  2X51 A;  2HSP A;  4JUV A;  2ZPG B;  1YIJ T;  3CQT A;  2QAS A;  1W2B S;  2G6F X;  2RMO A;  2L8D A;  5KYY A;  1IGU A;  1I4K 1;  1AWX A;  3M57 A;  2EQI A;  2L2P A;  3KBG A;  2P0K A;  3P8D A;  4C0F A;  1U3O A;  4BDZ A;  3HP9 A;  3OYM A;  3CXC S;  4M77 B;  2FPF A;  3VS4 A;  3CCQ T;  1NJI R;  3FJ5 A;  5DM7 R;  4A63 B;  2O4X B;  4M75 A;  5CKB A;  2OTL T;  5GJW B;  1IRE B;  3CCM T;  1WNL A;  4PFO A;  2E12 A;  3EHQ A;  5L23 A;  3NTK A;  3EGU A;  3RR6 A;  3LH0 A;  1YHQ Q;  2K4Y A;  1AWO A;  4ORZ A;  5GAM h;  3OW2 A;  1JJ2 S;  1XQH A;  2M16 A;  1VQN A;  4M7D A;  3CC7 Q;  1B3Q A;  2HBP A;  2DM1 A;  4LUD A;  1WHG A;  5EC7 A;  4M75 G;  2FVU A;  1H92 A;  2ED0 A;  4HKE A;  4C8Q E;  2BZY A;  2EKO A;  2MI6 A;  2GTO A;  3PMI A;  2DXT A;  2NUT B;  1VA7 A;  7AT1 B;  2KRM A;  1KJW A;  4J9G A;  4LDW A;  4JS5 A;  2JJ9 A;  1OX8 A;  3JCM c;  3E1S A;  2DEQ A;  2K7A A;  1KQS P;  3LYI A;  2KRO A;  3R6N A;  1Y96 A;  2JM9 A;  3FB9 A;  2LQN A;  1JXM A;  3SDZ A;  3WXM B;  5A0G A;  5GMK l;  1JRI A;  2HL5 C;  2OJ2 A;  2VV5 A;  1VQM T;  1YHQ T;  2ENM A;  4M7D G;  3SWN B;  5GMK m;  5I11 A;  1YCS B;  3N5B B;  4QW2 A;  5CR2 A;  1W1F A;  2DL4 A;  2MMP A;  2LNV A;  3QO3 A;  2JW4 A;  3OYE A;  2BZX A;  3ZBD A;  1S1N A;  3TSW A;  4KGX B;  2RO0 A;  1K73 R;  3T9N A;  1GFC A;  2CRE A;  4FW1 A;  2KXD A;  3UA7 A;  5IXF A;  2PNI A;  3A8H B;  3G4S A;  3MPU B;  1OEB A;  4NL2 A;  1KHC A;  3JV3 A;  2RPN A;  5DLQ E;  4KUL A;  2ZPB B;  2QXF A;  4PJM A;  2K2M A;  5KYY B;  1K0X A;  2DET A;  3EFS A;  3OY9 A;  1ZBJ A;  2GF7 A;  1YJN A;  3LGF A;  2E3H A;  4E7Z A;  3P8H A;  2YWW A;  2P0P A;  2JTE A;  2WSF E;  1VQN Q;  5FLX E;  1VQ6 T;  3INZ A;  4ZN3 A;  4M75 B;  2ZAE A;  3M0S A;  2FZC B;  3OW2 P;  4M77 E;  2SRC A;  2FHD A;  1JEG A;  2QQ9 A;  5LL6 S;  1BI0 A;  5IHN A;  4OB1 B;  4E7K A;  2K79 A;  3VS7 A;  2JUF A;  3PE0 A;  2F2W A;  1GFD A;  1UUE A;  1Q7Y C;  1PM3 A;  2JS0 A;  4QT7 A;  3C4S A;  4E2F B;  2DK3 A;  2LJ3 A;  4X9D A;  1K9M C;  2O9S A;  2CP6 A;  2HNI A;  4RMO A;  2DYI A;  1Q81 U;  1M1K R;  4ZGE B;  4M7D B;  1MNE A;  2E41 A;  3IQL A;  1LOJ A;  2FZK B;  1UHF A;  4ZGJ B;  2RJE A;  2RI2 A;  2W10 A;  4FYX B;  1VQ9 A;  3RKY A;  3CCE Q;  1E7O A;  2O01 E;  1UG1 A;  2R57 A;  2XKO C;  1FX7 A;  4J9B A;  4XTZ A;  1MMN A;  1RLQ C;  3ME9 A;  4LD6 A;  4PL6 A;  2AHJ B;  3G4S Q;  1RAB B;  4BI8 B;  3NPF A;  2M51 A;  2KT8 A;  4AG2 C;  1Y96 B;  1WI7 A;  2NUZ A;  2EJG A;  4XK8 E;  3M54 A;  2XDP A;  2V8J A;  2RJD A;  1BB9 A;  2RHU A;  3FJP A;  3HL8 A;  4JRQ A;  4C0D C;  2DF6 A;  4Q5W A;  4LDY A;  4KRT A;  1N9S A;  3CC2 A;  4LN2 A;  4PJO G;  2A36 A;  1YJ9 A;  2KBT A;  1AZG B;  2ZPI B;  1NJI U;  1HXD A;  3EFO B;  3OYD A;  3EFR A;  4JZ3 A;  3CCR Q;  3H0I A;  2C0I A;  2O9V A;  2XU8 A;  1QVP A;  1OU8 A;  3QII A;  3EG2 A;  3PMT A;  3CCE T;  2NYS A;  1K8A C;  5KE2 A;  4MDX A;  1VQO A;  1U8R A;  3G4S T;  4KT0 E;  4AFQ C;  3JAM E;  2JXB A;  1YN8 A;  2Y4Y A;  3MCA B;  5FU7 B;  2R58 A;  4X9C A;  3NTH A;  5FW9 A;  4TVR A;  2DXB A;  3HPW A;  2EQU A;  4NS5 A;  3J7A F;  2JNG A;  5CAI A;  3EG1 A;  4HCK A;  3NHN A;  4J7F A;  4OMO A;  4F7U F;  2QYZ A;  3CCR T;  1H64 1;  4QQD A;  5AYF A;  3V8L A;  4A4K A;  4C8Q D;  2LQK A;  4M75 E;  1Q81 C;  4XU3 A;  2E10 A;  4XTY A;  4OB3 B;  2BTT A;  1UJY A;  2X4Y A;  4RKU E;  3JCM V;  3RER A;  2CUB A;  5D6W A;  5GAN j;  3HKS A;  1WPY A;  2JTF A;  1U1T A;  1NEB A;  4PJO B;  2K5I A;  3EG0 A;  2PQW A;  2HQE A;  1K73 U;  2O31 A;  3CC2 Q;  1UGP B;  2D0Q B;  2RK2 A;  4HT8 A;  4OGE A;  2HZY A;  1D1C A;  3VKI A;  4M7D E;  3G1J A;  1W70 A;  4HA8 A;  2BE7 D;  1J3T A;  2RNA A;  2X35 A;  3L2R A;  2VXF A;  1NM7 A;  3G71 A;  2DTH A;  4Y92 A;  5LJ3 d;  1X6O A;  4OF1 A;  3M4G A;  3X24 B;  3URG A;  2Y90 A;  3Q1J A;  1KK7 A;  2J6K A;  2LQW A;  4DOV A;  1VQO Q;  3V7R A;  4M78 G;  2J05 A;  1WZO A;  1VQ7 Q;  4B6M A;  5I2S A;  2V26 A;  3C12 A;  5IH2 A;  2HDA A;  2X4X A;  3QG1 A;  2LDM A;  3L1A A;  1D1A A;  3JCM W;  2LT4 A;  4ELZ C;  3CC2 T;  2X4W A;  5CKD A;  3PT9 A;  3QHS A;  1R77 A;  1K9A A;  4M77 D;  2QK0 A;  3QDF A;  2KMT A;  1KG1 A;  1M3B A;  1WHM A;  2CZ6 B;  2CP0 A;  4MMK A;  2LJ0 A;  2VUB A;  2E65 A;  3EGD A;  2XIC A;  3I5R A;  3QYH B;  1Y0M A;  2COW A;  4JLI A;  2FPD A;  3AHU A;  1M1K U;  2LNH B;  4XTX A;  1WGS A;  2DIL A;  1QVF P;  4K11 A;  1U5S A;  4OMM A;  5FWB A;  2KEA A;  2D6F A;  3EAE A;  1TSF A;  2KE9 A;  1ZBX A;  1VQO T;  1SPK A;  1JB0 E;  4EMK A;  3OMC A;  1VQ7 T;  4HVU A;  1UGS B;  3FLG A;  3VYG A;  1RAF B;  3CCL A;  2MIO A;  1JXO A;  3CPW A;  5KE3 A;  2CH4 A;  4XTU A;  1VQ4 A;  1LPL A;  4Z88 A;  3V7C A;  1BI1 A;  1SRL A;  2RI3 A;  2DPP B;  1Q7Y R;  3I56 A;  5LJ5 j;  4FCY A;  4J9I A;  1O75 A;  3VU3 C;  1K9M R;  3MEU A;  3UT1 A;  4M78 B;  2Y4X A;  2BKD N;  2CSQ A;  3MKD A;  1PRL C;  5GMK e;  2PUK B;  1AEY A;  1ZA2 B;  1HYO A;  2CP7 A;  2HKN A;  5DLO A;  2HEQ A;  4M7D F;  2ABL A;  1ARK A;  1Q86 R;  4PJO E;  2DL5 A;  2QTV A;  1WLP B;  2OX7 A;  5HY6 A;  1AOJ A;  3CPF A;  1YFN A;  2KRN A;  2OTL A;  3CCM A;  2HSE B;  5GAN 7;  2XK0 A;  5FRN A;  5GAO p;  2FEI A;  4QVC A;  4PJJ A;  4M77 A;  3QKJ A;  2LT1 A;  2XI9 A;  2MK5 A;  3HFO A;  1PD0 A;  5GAO l;  2KT1 A;  2OAW A;  2FL7 A;  2Z0W A;  5GAO m;  4A4G A;  4JDS A;  3CMA Q;  1B34 B;  1M2O A;  2E64 A;  2RD1 A;  3E9F A;  4DEY A;  2D8H A;  3I55 A;  4GLK A;  2EGE A;  2QEX Q;  2QQS A;  4PLL A;  3G6E A;  5CQX A;  2K57 A;  1I8F A;  2DLP A;  1M9S A;  3PGG A;  1M1K C;  2F5K A;  2RQT A;  2JZ2 A;  3BDU A;  2MOX A;  4LUE A;  2YT6 A;  1QKW A;  3CCL Q;  4OGC A;  1K8A R;  4N4H A;  1QVG S;  4KBM B;  4M75 D;  2CP2 A;  2YDL A;  3VS1 A;  1VQ4 Q;  2LCL A;  1NLO C;  3KUF A;  1WIE A;  1B7T A;  3AT1 B;  2JOY A;  2HMA A;  3I56 Q;  3BE3 A;  1G3T A;  1ZUY A;  3M5A A;  1VQM A;  1YHQ A;  1GBQ A;  1VQ5 T;  3RES A;  4EMK B;  4F14 A;  5EG2 A;  5FWC A;  3CMA T;  2CGH A;  1TOV A;  3G7Z A;  3VS6 A;  2DFU A;  2ED1 A;  5FU6 B;  4M7D D;  1CKA A;  2QEX T;  1JJ2 A;  1QCF A;  2OTJ A;  1YBY A;  2I2L A;  1RUW A;  1VIE A;  2J7I A;  5GAO r;  1BI2 A;  1GCP A;  2EVR A;  2OTL Q;  3CME Q;  1FMV A;  5KYU B;  1TH7 A;  4LD9 K;  4IUT A;  1KQS A;  1K0S A;  4A54 A;  2EIF A;  1TS9 A;  1AZE A;  3JCM d;  2MPX C;  4YTL A;  1EIF A;  2L3P A;  4CC7 A;  3I56 T;  1V1C A;  5LJ3 g;  1WQ7 A;  4IUP A;  4M78 E;  4QVD A;  2HD0 A;  3SB2 A;  4E7J A;  4C5G A;  3I55 Q;  3OBY A;  2A37 A;  3G6E Q;  1VQ6 A;  3UDC A;  2B86 A;  3H9N A;  2HAX A;  4PJL A;  1W2B P;  2VGM A;  2RH2 A;  3S3M A;  1QCN A;  3UWN A;  1G3S A;  1M30 A;  1ZSG A;  2PU9 B;  1D3B B;  3CME T;  1WQW A;  4HCZ A;  1X75 C;  2L0A A;  1VYV A;  1GCQ A;  3CXC P;  4ANJ A;  1U06 A;  4N4G A;  5FRO A;  2DBK A;  2RA2 A;  4BDY A;  1VQM Q;  3QBY A;  2PVG B;  1M4Z A;  1I0C A;  2IG0 A;  2EQM A;  2FG0 A;  4JPB W;  3VS2 A;  5GAN 3;  4ESR A;  2P4T A;  1C1A A;  4LDX A;  3I55 T;  4C92 G;  3M56 A;  3L2U A;  1Q7Y U;  2OTJ Q;  3G6E T;  1QP2 A;  3RKW A;  1JQQ A;  1PCX A;  3S6W A;  1MMG A;  1K9M U;  1ZSZ C;  1K1Z A;  4FYW B;  3CCS Q;  1JJ2 P;  3MO8 A;  1RI0 A;  2CKK A;  4M7A A;  1IB8 A;  4ZTF A;  1Y71 A;  4AMC A;  4HCC A;  2R5M A;  3V8J A;  4ELY C;  1Q86 U;  2JM8 A;  2RF0 A;  1KD1 U;  3H0H A;  4OML A;  4GBQ A;  3RUX A;  4KH1 B;  2JN0 A;  5C6S A;  1N27 A;  3EHR A;  2H3J A;  2CZ7 B;  4PJO D;  1ZA1 B;  2QQB A;  4FW2 A;  4A4F A;  5LJ3 e;  4V2S A;  2H3E B;  2KNB B;  1VQ6 Q;  8ATC B;  1WA7 A;  3CCE A;  2V1R A;  2RHX A;  3EFO A;  1UEC A;  3FRN A;  3OYL A;  2COZ A;  2KSS A;  2OTJ T;  3QUI A;  1WX6 A;  3NTI A;  1G3W A;  2RJC A;  4M7A G;  1RAD B;  2K6D A;  1RLP C;  2DRM A;  4RCC A;  3BFM A;  3CCS T;  5KYW A;  2NUP B;  1FMW A;  1KHI A;  3BY7 A;  2PZ1 A;  3CCJ A;  3CCU Q;  4PKC C;  1WDX A;  2EJ9 A;  2QDY B;  4JLG A;  3M0T A;  1Y07 A;  1D0Y A;  3TRE A;  1K8A U;  4KGZ B;  5GAN 5;  2B8A A;  3QZ5 B;  1TTH B;  3HHT B;  4FIB A;  1TG0 A;  3CCR A;  5GAO q;  4C92 B;  1X43 A;  2RQU A;  3L42 A;  5D6Y A;  1YIT Q;  4C8Q C;  1I5L A;  1AWJ A;  3M59 A;  2EGC A;  3PTA A;  2EAY A;  2WSE E;  1I07 A;  3OYK A;  2QI2 A;  2FB7 A;  2DJQ A;  2MWO A;  1WFW A;  4AFS C;  2F69 A;  2FRW A;  2AK5 A;  5GAN e;  2DMO A;  2VWF A;  1M5Q 1;  3A1P A;  2XDB A;  3SD4 A;  1PC0 A;  2GTJ A;  1LJO A;  2DTI A;  1GXI E;  1FWZ A;  2L3Q A;  3TSZ A;  3M58 A;  3CCU T;  3X20 B;  2A28 A;  4BY6 C;  4PJO A;  2IPO B;  4JJN K;  4MZM A;  5LJ3 f;  3BDL A;  3O5Z A;  3OB9 A;  1G5V A;  4RTZ A;  3F70 A;  2OI3 A;  1Q86 C;  1KD1 C;  1MV3 A;  1M3C A;  2DD5 A;  1RAA B;  1UFF A;  2CZ0 B;  4EIK A;  1WXU A;  4AFZ C;  4C8Q F;  1NLP C;  2DVJ A;  1M8V A;  4R55 A;  4M7A B;  1YIT T;  2J06 A;  4XQ3 A;  1RAC B;  3LGL A;  2YUO A;  2BZ8 A;  3MET A;  5CVI A;  1OI1 A;  2VAS A;  1JBM A;  4FT2 A;  5IXB A;  2ZPE B;  4M78 D;  5GAN 4;  2K9G A;  3JCM g;  1LVK A;  3CCJ Q;  1C0M A;  2EW3 A;  2E6N A;  4HXJ A;  4J6X A;  1UDL A;  1ZUU A;  1UB4 A;  2VXE A;  2ZPF B;  3QJ6 A;  3OSV A;  4M77 C;  3QWX X;  5ECA A;  4IUR A;  4D6W A;  4D8K A;  1IO6 A;  1YCY A;  2DJZ A;  3RDV A;  4IIM A;  4BI3 A;  2DXU A;  5KYW B;  1E6H A;  1SSH A;  3DLM A;  1AT1 B;  1K76 A;  3E9G A;  4J8O A;  1VQ7 A;  3HTR A;  5CKH A;  5GAN f;  2CT4 A;  2DO3 A;  3QWY A;  1KC8 C;  4L59 A;  2EPD A;  2E6Z A;  3X28 B;  1N9R A;  2ROL A;  5GAO n;  4A4H A;  4KUD K;  2CS7 A;  3CCJ T;  3EG9 B;  2MYS A;  1ZHI A;  3GPL A;  2RN8 A;  3GOX A;  4C92 E;  1CKB A;  3M0Q A;  2HQX A;  4M77 F;  2CP5 A;  3JCM b;  2KK4 A;  4JS4 A;  1V29 B;  1X27 A;  1XNI A;  1QVF A;  1NPP A;  1Q82 C;  5LJ5 e;  2PVO B;  1M90 C;  1VUB A;  3EG3 A;  3A8L B;  4N0A C;  2A7Y A;  2ZZD A;  4Y91 A;  2DKG A;  4MZP A;  4D8D A;  4JJC A;  4ZGD B;  4M78 A;  4LDV A;  5A2Q E;  2C06 A;  5I22 A;  5KYX A;  2MAM A;  1QLY A;  2KY9 A;  3SWN C;  3DB4 A;  1ZUK A;  1OQK A;  2QA4 A;  2LRQ A;  2PTK A;  1Y7X A;  3JCM e;  3VUB A;  2EBP A;  4NOY A;  5A0D A;  4FSS A;  4OMF B;  3CBO A;  4HVV A;  3OS0 A;  1SSF A;  2M02 A;  3ASK A;  3JRZ A;  1QCO A;  4LE9 A;  3OYY A;  4M7A E;  2LX9 A;  3E2U A;  3QXE B;  4J5Y A;  5KYN A;  1MMD A;  1Q95 G;  2BIV A;  3C94 A;  2PUO B;  2A08 A;  3CC4 A;  1B34 A;  2RM4 A;  1QKX A;  3VYH B;  4J9D A;  1VQP T;  5M9O A;  4OMN A;  2YLC A;  2DL3 A;  5HCK A;  4FSX A;  3REA B;  4FYY B;  4M75 C;  2GFU A;  3JSC A;  1UTI A;  2AZV A;  3DLL A;  1RI9 A;  1U1S A;  2E1H A;  4J6W A;  2COY A;  1GCQ C;  1BU1 A;  2YRD A;  5GAN 2;  1YI2 Q;  5LJ5 f;  1VQ5 A;  4DEX A;  1WHJ A;  1WXT A;  4E6R A;  2K5L A;  3CMA A;  3GNF B;  4PFP A;  3SFM A;  2QEX A;  4RTX A;  4BB7 A;  4M7D C;  1EFN A;  4CRI A;  3PNW C;  3BW1 A;  4ZN1 A;  2QA4 Q;  4FU6 A;  3FEO A;  2CDT A;  3JCM f;  5GAN d;  2RHZ A;  4Z89 A;  2CH4 W;  2GFA A;  2XMF A;  5GAM e;  1N8R C;  4M75 F;  4BI4 A;  1M8M A;  4J9C A;  2YSQ A;  4J83 A;  1QVG A;  1BIB A;  2KI7 A;  2E3I A;  2EYY A;  3PIP A;  3MP1 A;  5KYU A;  2DZ9 A;  3RBB B;  2XD0 A;  3RMS A;  3HRU A;  3NMZ C;  1CSK A;  2AKL A;  5HK3 A;  1XTD A;  1YI2 T;  1QQJ A;  1AHJ B;  1AWW A;  2OAU A;  5KYX B;  1AD5 A;  4PFZ A;  1B07 A;  2E70 A;  1T0J A;  3ULR B;  2EWN A;  3CC4 Q;  1Z9Q A;  1VYT A;  3H8Z A;  4F16 A;  1KD1 R;  2HCK A;  4J7I A;  4A4E A;  3NFC A;  5GMK i;  3HSB A;  4M4Z A;  2QQA A;  2EKH A;  3VJP A;  2EQJ A;  2QA4 T;  1HK9 A;  1X6B A;  3CME A;  2XDD A;  5D6X A;  1MUZ A;  1NYG A;  1VIF A;  4B9X A;  1SHG A;  2D1X A;  4WF2 A;  3GIB A;  2LVM A;  3S3N A;  5GAN 6;  1SG5 A;  1D3B A;  1T3L A;  1VQ5 Q;  2DX1 A;  4AFU C;  5KCH A;  1YJW Q;  2KXC A;  3H0F A;  1GL5 A;  2RJF A;  3TU4 K;  2W0Z A;  1W2B A;  5FU7 C;  2SEM A;  4ME7 A;  1NG2 A;  3JB9 J;  3GF5 A;  1TUD A;  4F17 A;  1R8O B;  3GP8 A;  4OB2 B;  3CC4 T;  4C92 D;  2L89 A;  3I35 A;  4XU2 A;  2BUD A;  4FL6 A;  3VUZ A;  5CIU A;  4RG2 A;  2DAQ A;  2ESW A;  3VRZ A;  5GAM f;  1KIK A;  4BUG A;  3CXC A;  2AZS A;  5IHI A;  2VVK A;  1QW1 A;  1OX9 A;  4BE0 A;  1TUG B;  1BIA A;  2LCC A;  4XU0 A;  5A0L A;  2PVD B;  1KC8 R;  1TUC A;  3FC3 A;  1VQK T;  2YLB A;  3FIF A;  3CPW S;  2ZCF B;  1QVG P;  2JTM A;  2K3X A;  6AT1 B;  1G3Y A;  1X69 A;  2VGN A;  2YRC A;  4MML A;  4PJO C;  1IGQ A;  2R5A A;  4BAC A;  1YJW T;  4F7U G;  2ATC B;  4QKU A;  2RI5 A;  5LJ5 d;  1VQ8 A;  1M1F A;  2AKK A;  2RQV A;  1QMC A;  1BCM A;  1NE8 A;  2MCN A;  1BBZ A;  3VRY A;  3SHW A;  3LWH A;  1RAG B;  1PWT A;  3A8G B;  1IZ6 A;  4C5H A;  2EYQ A;  1Q82 R;  3CCS A;  2NLU A;  1M90 R;  2LMJ A;  2A0F B;  2M0Y A;  4M7A D;  3JCM X;  5J26 A;  1D09 B;  1X2K A;  2XHC A;  3V8K A;  4VUB A;  1HSQ A;  2K2V A;  4JRI A;  2O2O A;  2GGR A;  1MND A;  3WVD B;  3HFN A;  2F1L A;  2NUP A;  3C0C A;  3EGX A;  2E5Q A;  3P8B B;  4PJO F;  2V8K A;  4EMH A;  2M0O A;  5L8R E;  2CUD A;  2QQR A;  4HVW A;  3KXT A;  1UGV A;  2J6O A;  4E47 A;  2DRK A;  1RAH B;  4C92 A;  3OYG A;  1V76 A;  1QP3 A;  1WHK A;  1GRI A;  1RL2 A;  3RNJ A;  4J9H A;  5KH6 A;  2DNU A;  1H3H A;  5GMK j;  1YNZ A;  1X01 A;  1XJW B;  5CCA A;  1YP5 A;  4C0D B;  3PVQ A;  2F5T X;  2RHY A;  1DJ7 B;  4AG1 C;  3CCU A;  3MJX A;  1D0X A;  2JMA A;  1SF9 A;  4RTV A;  3JB9 G;  1W6X A;  3HRS A;  4F7U B;  3V7S A;  4OP0 A;  3OYA A;  2DER A;  4R56 A;  1BCO A;  2J6F A;  1VQ8 Q;  1VQL A;  3U23 A;  1OZ2 A;  4UC4 A;  1K4U S;  1YIT A;  4RTY A;  2EGA A;  3M0P A;  1MGQ A;  4PNO A;  1UGR B;  2L3R A;  8AT1 B;  1N6A A;  2JVV A;  5HK0 A;  4C5E A;  1NEG A;  2WAC A;  5GAN g;  3CD6 Q; 
#chains in the Genus database with same CATH homology
 3DKM A;  4M78 G;  1OI1 A;  1WJR A;  3QZ9 B;  1JBM A;  4FT2 A;  4GY5 A;  5I2S A;  2GCX A;  4M78 C;  2ZPE B;  2RHI A;  2WSC E;  3LW5 E;  4M78 D;  3QSU A;  3C12 A;  5GAN 4;  2EJF A;  1MHN A;  1ZQ1 A;  2DXC A;  1S72 A;  3RIR A;  5GAM d;  3JCM g;  2X4X A;  3QG1 A;  3QYG B;  5CKF A;  1I81 A;  2E6N A;  2LDM A;  5LJ5 h;  3L1A A;  3WVE B;  1FXX A;  4J6X A;  3JCM W;  1KQS S;  2LT4 A;  4ELZ C;  2ZGW A;  4BE1 A;  3CC2 T;  2X4W A;  5CKD A;  3PT9 A;  3OA6 A;  4M77 G;  1UB4 A;  3QHS A;  2VXE A;  4C8Q B;  4NL3 A;  2ZPF B;  3QJ6 A;  3OSV A;  5GMK h;  4M77 C;  2P0Q A;  4M77 D;  5GAN 8;  3R6O A;  4Z02 A;  4QQ6 A;  4IUR A;  4ATO A;  2EFI A;  2KMT A;  3M4Y A;  1KG1 A;  4EPC A;  1VQ8 T;  2VC8 A;  2LC4 A;  4D6W A;  2CZ6 B;  5FRM A;  1P92 A;  4OVA A;  3MEV A;  4MMK A;  1YCY A;  2E65 A;  2VUB A;  2XIC A;  3QYH B;  4EDU A;  4BE2 A;  2DJZ A;  2D9T A;  3OQ5 A;  4JLI A;  2DXU A;  2KQW A;  4BI3 A;  3AHU A;  4P5N A;  4N0A A;  3DLM A;  1M1K U;  4XTX A;  1WGS A;  3CD6 A;  3MP6 A;  2KDS A;  3JCM h;  3E9G A;  2D6F A;  2A3L A;  4J8O A;  1VQ7 A;  3EAE A;  3M9Q A;  4N4I A;  3CD6 T;  1ZBX A;  2K3Y A;  5CKH A;  1VQO T;  5GAN f;  2DO3 A;  1JB0 E;  4EMK A;  1KC8 C;  3ZEH A;  4M78 F;  3OMC A;  4L59 A;  4O6J A;  4EMG A;  2E6Z A;  3X28 B;  3CC7 A;  1VQ7 T;  1N9R A;  4A53 A;  1UGS B;  3FLG A;  3GNG A;  4BY6 B;  1UGQ B;  1WJS A;  5GAO n;  3SWN A;  4A4H A;  2FYK A;  5DY9 A;  3VYG A;  3CC7 T;  5CO7 A;  4KUD K;  3CCL A;  3CCV A;  5GAM j;  2CS7 A;  3CCJ T;  2MWP A;  3CPW A;  3L2Z A;  3FDR A;  1ZHI A;  3GPL A;  5KE3 A;  3GOX A;  3CCL T;  4C92 E;  3CCV T;  4KUI A;  2RB6 A;  4XTU A;  3JB9 I;  1VQ4 A;  4XU1 A;  2HQX A;  4M77 F;  2DZC A;  2IVW A;  3V7C A;  1BI1 A;  2RI3 A;  3JCM b;  2KK4 A;  3O8V A;  4JS4 A;  2DPP B;  1VQ4 T;  1V29 B;  2MF2 A;  3I56 A;  1QVF A;  1XNI A;  4RCB A;  3V7R A;  5LJ5 j;  3OYN A;  1KC8 U;  1VQK T;  4JUV A;  1NPP A;  2ZPG B;  1YIJ T;  1Q82 C;  2RK1 A;  5LJ5 e;  1O75 A;  2PVO B;  1VUB A;  3VU3 C;  1M90 C;  3MEU A;  3A8L B;  1W2B S;  4J6Y A;  4N0A C;  2M9U A;  2A7Y A;  2ZZD A;  3MEA A;  2Y4X A;  2BKD N;  4M78 B;  4Y91 A;  3UT1 A;  4XTV A;  3OW2 S;  2L8D A;  2DKG A;  5GMK e;  4MZP A;  1I4K 1;  2PUK B;  4Y28 E;  3A8M B;  5CVI A;  3M57 A;  4ZGD B;  3KBG A;  4B9W A;  4EMK C;  5DLO A;  2P0K A;  4M78 A;  2XID A;  3P8D A;  4LDV A;  4C0F A;  5A2Q E;  3OS2 A;  3CEY A;  2C06 A;  4M7D F;  4PJO E;  2MAM A;  3HP9 A;  3OYM A;  2KY9 A;  4BDZ A;  3SWN C;  3DB4 A;  2QA4 A;  5FU6 C;  2LRQ A;  5HY6 A;  3CPF A;  3CXC S;  4M77 B;  4F7U E;  5J39 A;  1Q82 U;  2OTL A;  1WJQ A;  3CCQ T;  3J80 E;  1M90 U;  3CCM A;  1Y7X A;  5GAN 7;  3JCM e;  2XK0 A;  3JB9 H;  5FRN A;  5DM7 R;  1H3Z A;  3VUB A;  4NOY A;  2O4X B;  5GAO p;  4M75 A;  5CKB A;  5A0D A;  2OTL T;  1IRE B;  4OMF B;  4QVC A;  3CCM T;  4M77 A;  2X4J A;  2EQK A;  5LJ5 g;  1WNL A;  3QKJ A;  3CBO A;  3OS0 A;  1SSF A;  2LT1 A;  2XI9 A;  3ASK A;  3JRZ A;  2E12 A;  3HFO A;  5GAO l;  1VQL T;  1LNX A;  3NTK A;  3OYY A;  2FL7 A;  2LX9 A;  4LDU A;  5GAO m;  4A4G A;  3L2W A;  3QXE B;  4HT9 A;  4J5Y A;  4JDS A;  3LH0 A;  1B34 B;  3MHX A;  5IAY A;  2E64 A;  2K4Y A;  2V8I A;  2RD1 A;  3E9F A;  3RMQ A;  2BIV A;  3OMG A;  3I55 A;  3C94 A;  5GAM h;  4GLK A;  3OW2 A;  3CBP A;  1JJ2 S;  2PUO B;  2QQS A;  4PLL A;  1PSE A;  1XQH A;  3LLR A;  5CQX A;  1B34 A;  5I21 A;  3G6E A;  3CC4 A;  2M16 A;  1VQP A;  1VQN A;  4M7D A;  2K57 A;  2RM4 A;  2HBP A;  3VYH B;  1I8F A;  1VQP T;  3X25 B;  1VQN T;  5M9O A;  3TEE A;  1M9S A;  2YLC A;  3PGG A;  4QVZ A;  1S72 T;  2F5K A;  1M1K C;  3BDU A;  2JZ2 A;  3HRT A;  4M75 G;  2FVU A;  4OGC A;  4FSX A;  4N4H A;  4CI0 C;  1QVG S;  4KBM B;  4HKE A;  4M75 C;  4C8Q E;  2EKO A;  2MI6 A;  4M75 D;  2GFU A;  3JSC A;  3PMI A;  2DXT A;  3DLL A;  2LCL A;  1U1S A;  2E1H A;  4J6W A;  2CZ1 B;  3VV0 A;  2KAF A;  3KUF A;  4LDW A;  2JOY A;  4JS5 A;  5GAN 2;  3JCM c;  3E1S A;  2DEQ A;  2LTO A;  4C0G A;  5LJ5 f;  3LYI A;  1VQ5 A;  4FM4 B;  1G3T A;  1Y96 A;  4FT4 A;  2K5L A;  3FB9 A;  3M5A A;  3ZFJ A;  3CMA A;  1VQM A;  1YHQ A;  3GNF B;  1VQ5 T;  3RES A;  4EMK B;  3SDZ A;  3WXM B;  5A0G A;  5GMK l;  1JRI A;  5EG2 A;  4JRK A;  3SFM A;  5LJ3 j;  3CMA T;  2VV5 A;  2CGH A;  1VQM T;  1YHQ T;  3G7Z A;  2QEX A;  3SWN B;  3M53 A;  5GMK m;  4M7D G;  5FU6 B;  3N5B B;  3PFS A;  4QW2 A;  4BB7 A;  5CR2 A;  4M7D C;  4M7D D;  2MMP A;  2QEX T;  2LNV A;  3QO3 A;  4CRI A;  1JJ2 A;  3OYE A;  1UEB A;  1YBY A;  2I2L A;  3OS5 A;  3BW1 A;  3PNW C;  4PLI A;  3ZBD A;  1VIE A;  3UPU A;  2RO0 A;  3A5Z B;  3H6Z A;  4ZN1 A;  4FU6 A;  3T9N A;  3FEO A;  5GAO r;  1BYM A;  1BI2 A;  3JCM f;  5GAN d;  2RHZ A;  3A8H B;  3G4S A;  2GFA A;  5GAM e;  1TH7 A;  4LD9 K;  4IUT A;  1N8R C;  4M75 F;  4C5I A;  4BI4 A;  1KQS A;  2DD4 A;  4NL2 A;  4A54 A;  3PIO A;  4E7I A;  4J83 A;  1QVG A;  1BIB A;  1KHC A;  2EIF A;  3PIP A;  3MP1 A;  5DLQ E;  3JCM d;  2DZ9 A;  4KUL A;  2ZPB B;  2QXF A;  1YI2 A;  3RMS A;  2XD0 A;  3HRU A;  4YTL A;  1EIF A;  4ZTJ A;  2XG8 D;  5HK3 A;  1XTD A;  3I56 T;  1YI2 T;  3EFS A;  5LJ3 g;  1WQ7 A;  3OY9 A;  4IUP A;  4M78 E;  2GF7 A;  4QQG A;  4QVD A;  2HD0 A;  3SB2 A;  1AHJ B;  3OYF A;  3C95 A;  1YJN A;  4E7J A;  2OAU A;  3LGF A;  4C5G A;  3P8H A;  3OBY A;  2E70 A;  2EWN A;  1W4S A;  3JCM J;  1YJN T;  1N8R U;  1VQ6 A;  3UDC A;  2P0P A;  2WSF E;  3H8Z A;  2HAX A;  3E19 A;  4C0Z A;  4J7I A;  5C0M A;  5FLX E;  4A4E A;  3NFC A;  1VQ6 T;  5GAM g;  3INZ A;  2VGM A;  4ZN3 A;  4M75 B;  2RH2 A;  5GMK i;  3HSB A;  2QQA A;  4M77 E;  3S3M A;  2FHD A;  3VJP A;  2EQJ A;  3UWN A;  2QQ9 A;  4IUV A;  1BI0 A;  5LL6 S;  4OB1 B;  2G3R A;  1HK9 A;  3CME A;  2QA4 T;  2XDD A;  5D6X A;  4E7K A;  3S3O A;  4M7A E;  2JUF A;  1G3S A;  2PU9 B;  1D3B B;  3CME T;  5CK9 A;  1VIF A;  1WQW A;  4HCZ A;  5LJ3 h;  1X75 C;  4B9X A;  3OYI A;  1Q7Y C;  4WF2 A;  3C4S A;  3GIB A;  2LVM A;  2DK3 A;  3S3N A;  4X9D A;  5GAN 6;  5IT9 E;  1D3B A;  1K9M C;  4MDW A;  2GQV A;  4N4G A;  2HNI A;  5FRO A;  2RA2 A;  4RMO A;  5KCH A;  1Q81 U;  4BDY A;  3QJY A;  3QBY A;  2PVG B;  2RJF A;  4ZGE B;  3TU4 K;  3M55 A;  1M4Z A;  2E41 A;  4ZGJ B;  4M7D B;  1LOJ A;  5IN1 A;  2RJE A;  5FU7 C;  1W2B A;  3LWI A;  2RI2 A;  4ME7 A;  2IG0 A;  2EQM A;  4L6V 5;  5GAN 3;  3JB9 J;  2DVE A;  4XAX B;  5HKC A;  3GF5 A;  2M1H A;  1R8O B;  2P4T A;  3MP8 A;  1VQ9 A;  4LDX A;  3RKY A;  3I55 T;  4C92 G;  3M56 A;  1NZ9 A;  1O9S A;  3L2U A;  1Q7Y U;  3GP8 A;  4OB2 B;  2O01 E;  4C92 C;  3G6E T;  3CC4 T;  4C92 D;  1VQ9 T;  2L89 A;  4XU2 A;  1QP2 A;  2BUD A;  3RKW A;  2R57 A;  2XKO C;  3S6W A;  4FL6 A;  1FX7 A;  3VUZ A;  1K9M U;  3A8O B;  4RG2 A;  5CIU A;  4XTZ A;  1NJI C;  2DAQ A;  3ME9 A;  4LD6 A;  4PL6 A;  5GAM f;  4BUG A;  2AHJ B;  3MO8 A;  5KCO A;  3CXC A;  4DOW A;  3OYH A;  4BI8 B;  1RI0 A;  2CKK A;  4M7A A;  4ZTF A;  1Y71 A;  1Y96 B;  3OYJ A;  4HCC A;  1QW1 A;  2QTX A;  2EJG A;  2R5M A;  4XK8 E;  3M54 A;  2XDP A;  2V8J A;  1VQK A;  3V8J A;  4ELY C;  2RJD A;  2DIQ A;  4BE0 A;  1BIA A;  2LCC A;  4XU0 A;  5A0L A;  4X34 A;  2PVD B;  3L2Q A;  1Q86 U;  1KD1 U;  2RHU A;  3FJP A;  3HL8 A;  3OSS C;  1XOV A;  3RUX A;  4JRQ A;  4C0D C;  3FC3 A;  4Q5W A;  4LDY A;  2JN0 A;  2YLB A;  3FIF A;  5C6S A;  1N9S A;  3CPW S;  2ZCF B;  3CC2 A;  2JTM A;  2K3X A;  4PJO G;  4IKF A;  1YJ9 A;  3TCJ A;  1YJW A;  1G3Y A;  2VGN A;  4MML A;  1N27 A;  4PJO C;  3JB9 F;  2H3J A;  2CZ7 B;  2ZPI B;  1HXD A;  1NJI U;  4PJO D;  2R5A A;  4BAC A;  2QQB A;  1YJ9 T;  4F7U G;  1YJW T;  3OYD A;  3EFR A;  5LJ5 d;  2RI5 A;  4A4F A;  1VQ8 A;  5LJ3 e;  4V2S A;  1QVF S;  1M1F A;  2ZPH B;  2XU8 A;  3CCE A;  3CBM A;  1NE8 A;  1QVP A;  2RHX A;  3QII A;  3FRN A;  4DQ2 A;  5GAN h;  3X26 B;  4C8Q A;  3OYL A;  4C92 F;  3LWH A;  3PMT A;  3CCE T;  2KSS A;  1K8A C;  3J81 E;  3A8G B;  1IZ6 A;  2OTJ T;  4C5H A;  3QUI A;  3OYC A;  2EYQ A;  5KE2 A;  1M1G A;  3NTI A;  3CCS A;  4MDX A;  2DTO A;  2NLU A;  1G3W A;  2RJC A;  4M7A G;  1VQO A;  3DB3 A;  4RCC A;  2OTJ A;  1U8R A;  4M7A C;  3BFM A;  3CCS T;  4M7A D;  3JCM X;  4IUQ A;  5J26 A;  3G4S T;  4KT0 E;  3JAM E;  4DA4 A;  1KHI A;  2XHC A;  3V8K A;  4VUB A;  3BY7 A;  2K2V A;  4JRI A;  3ER0 A;  2Y4Y A;  2CYZ B;  4O5V A;  3L2V A;  3CCJ A;  3MCA B;  4PKC C;  5FU7 B;  2R58 A;  2EJ9 A;  2QDY B;  3HFN A;  3NTH A;  3QPH A;  4JLG A;  4X9C A;  3WVD B;  1Y07 A;  3OYB A;  4TVR A;  3TRE A;  1K8A U;  2DXB A;  2E5Q A;  3HPW A;  2EQU A;  4NS5 A;  3P8B B;  4PJO F;  3J7A F;  2V8K A;  5GAN 5;  2B8A A;  2JNG A;  3HHT B;  3QZ5 B;  4FIB A;  4EMH A;  5CAI A;  2M0O A;  3CCR A;  5GAO q;  4C92 B;  5L8R E;  4E7H A;  1OZ3 A;  4J7F A;  2QQR A;  3L42 A;  4F7U F;  4C8Q G;  2YHT A;  3KXT A;  3CCR T;  1YIJ A;  4E47 A;  1H64 1;  1KQ2 A;  4QQD A;  5D6Y A;  5AYF A;  3V8L A;  4A4K A;  4C8Q C;  1K73 C;  1I5L A;  4C8Q D;  3M59 A;  4II1 A;  1GXI E;  4C92 A;  3OYG A;  2LQK A;  4M75 E;  1Q81 C;  3OS1 A;  1QP3 A;  4XU3 A;  3PTA A;  1NPR A;  2EAY A;  2E10 A;  1RL2 A;  4XTY A;  2WSE E;  4OB3 B;  3RKX A;  4E7L A;  5KH6 A;  5GMK j;  2L5Q A;  2X4Y A;  1X01 A;  3OYK A;  2QI2 A;  2FB7 A;  4RKU E;  3JCM V;  5CCA A;  3RER A;  2MWO A;  3GLX A;  3MEW A;  4C0D B;  2F69 A;  4M7A F;  5D6W A;  2F5T X;  5CKE A;  5GAN j;  3HKS A;  2RHY A;  4MZT A;  1WPY A;  2K5F A;  2JTF A;  1U1T A;  5GAN e;  1DJ7 B;  1KQ1 A;  2DIG A;  2LQ8 A;  4PJO B;  2K5I A;  3CCU A;  1M5Q 1;  3CCQ A;  2PQW A;  3LX7 A;  2HQE A;  1K73 U;  3JB9 G;  3SD4 A;  2XDB A;  1LJO A;  1UGP B;  2D0Q B;  2DTI A;  1FWZ A;  2RK2 A;  3HRS A;  4OGE A;  4HT8 A;  3M58 A;  4F7U B;  5CQY A;  3CCU T;  3V7S A;  5I2M A;  4JRP A;  3JB9 D;  2YRV A;  3VKI A;  3X20 B;  4M7D E;  4BY6 C;  4PJO A;  4OP0 A;  4XTW A;  4BD3 A;  3JCM Q;  4JJN K;  4MZM A;  5LJ3 f;  3BDL A;  3OYA A;  4HA8 A;  3OB9 A;  4R56 A;  1G5V A;  3F70 A;  4RG8 A;  1VQL A;  4IUU A;  4F7U A;  1Q86 C;  1KD1 C;  2X35 A;  2DD5 A;  3OBW A;  1OZ2 A;  4UC4 A;  2CZ0 B;  3L2R A;  1YIT A;  2VXF A;  2O4X A;  4OB0 B;  3JCM P;  1MGQ A;  4C8Q F;  4PNO A;  3G71 A;  2DTH A;  1UGR B;  1M8V A;  1BI3 A;  4R55 A;  2L3R A;  4HCB A;  5LJ3 d;  4M7A B;  1YIT T;  1N6A A;  1X6O A;  4OF1 A;  2JVV A;  4XQ3 A;  3M4G A;  3X24 B;  5HK0 A;  3URG A;  2Y90 A;  3Q1J A;  4C5E A;  3G71 T;  1PSF A;  1OYX A;  2VYT A;  2WAC A;  3LGL A;  3QDR B;  1BKB A;  3MET A;  5GAN g;  4DOV A;  4L5G A;  5J3B A;  2KVQ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...