2PVDB

Crystal srtucture of the reduced ferredoxin:thioredoxin reductase
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
73
structure length
73
Chain Sequence
b'MNVGDRVRVTSSVVVYHHPEHAKTAFDLQGMEGEVAAVLTGWQGRPISANLPVLVKFEQRFKAHFRPDEVTLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-thioredoxin reductase, catalytic chain
molecule tags Electron transport
source organism Synechocystis sp.
publication title Structural snapshots along the reaction pathway of ferredoxin-thioredoxin reductase.
pubmed doi rcsb
total genus 11
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02941 FeThRed_A Ferredoxin thioredoxin reductase variable alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2pvdB00
1DJ7B 2ZPGB 2PUOB 1QP3A 4ZGEB 1UGSB 3QZ5B 2PVGB 2PU9B 1JB0E 2CZ0B 2ZPEB 3A8GB 4OB1B 3A8LB 4L6V5 2WSFE 3X26B 3VYGA 2QDYB 2WSEE 3A8HB 2ZPBB 4KT0E 4XK8E 1IREB 2ZPIB 5L8RE 1UGPB 3QXEB 2DD4A 2DPPB 3A8OB 4OB0B 3QZ9B 4OB3B 3VYHB 3X24B 1GXIE 2PVOB 2ZCFB 2CZ1B 2CZ6B 1V29B 3X25B 2DXCA 1QP2A 1AHJB 1UGQB 3LW5E 4RKUE 4Y28E 3X20B 3X28B 2AHJB 3QYHB 2ZZDA 4FM4B 2CZ7B 1UGRB 3QYGB 3WVDB 2DXBA 4ZGJB 4OB2B 1PSFA 4ZGDB 2PVDB 2ZPFB 2ZPHB 1PSEA 3HHTB 2O01E 2WSCE 3A8MB 2D0QB 2PUKB 3WVEB 2DD5A 2CYZB
chains in the Genus database with same CATH superfamily
1M1FA 2JS0A 2PVGB 2RB6A 2BE9B 4JUVA 1VQOA 1KQSP 1W2BS 5EC7A 1N27A 3QSUA 2CZ7B 5HK3A 3VS1A 1I0CA 1P92A 1WGSA 1WJSA 2E70A 2OAWA 2O4XB 4M77F 3G71A 2RJFA 1WXTA 1VQLT 2LQNA 7AT1B 2EKOA 2DKGA 2EGCA 2EFIA 2ESWA 1ZSZA 2C0IA 2BE7D 3FJPA 1OEBA 2MWOA 2X3WD 2EYQA 3LH0A 3QYGB 3CPWA 2OTJT 3OS0A 4M78C 2LNHB 5HK0A 4PFZA 3M0RA 3CCMT 1C0MA 3JCMW 1OZ3A 4BI4A 4KGZB 1D0XA 4JRKA 4C8QB 2KRMA 4OB0B 4FSXA 2W10A 2CP3A 4XU2A 5LJ5g 3UA7A 2HBPA 3HL8A 2LCCA 3KBGA 2E5KA 3CCLA 3C94A 1RAIB 3THKA 1Q7YC 2HL5C 1RI0A 3S3MA 2CH4A 4XQ3A 3I35A 2YUOA 1QLYA 4PLIA 5GAMg 1EIFA 5C6SA 1UECA 2R5AA 3G7ZA 3CC4T 1R8OB 2YWWA 2AHJB 3PTAA 4QVCA 4A4EA 3E9GA 1WZOA 1MHNA 1TG0A 3OB9A 1M1KC 1E7OA 1TXQA 2ECZA 2X4JA 4JRQA 1KQSS 2LQ8A 2QYZA 1TUGB 2VXFA 4C5GA 4FU6A 2CT3A 4E7LA 1B34B 1QP3A 3PMTA 2HDAA 1BIBA 3ZFJA 4OMOA 3VS5A 4BE2A 1UJ0A 4C0FA 4IKFA 1K9MU 1A0NB 1VQ7Q 3EG3A 4PJOG 4ZN3A 3MEAA 1UHFA 2Y4YA 2XI9A 4ZN1A 1M90R 4M7DG 4E7KA 4HT8A 2GBQA 3UATA 4EMHA 1CKBA 2XICA 4HCBA 5FWCA 4M7DB 3BDLA 2LDMA 3MHXA 3QZ9B 3JB9F 2LX7A 5LJ5h 2RJCA 1VQ7A 2E3IA 3OSVA 3JCMf 1X2QA 1Q81R 2KEAA 5GAMd 2PUOB 5GANf 1I5OB 2Y90A 4GY5A 3MP8A 3F70A 1Y7XA 1X69A 4M77B 1K76A 4BD3A 4AT1B 4EMKC 1GRIA 1YJNT 4RTTA 3QYHB 3SFMA 2RF0A 2B86A 2YRCA 4JLIA 3CCST 3DB4A 2K2VA 2Y4XA 1T0JA 4A4KA 3CC2T 4E47A 3OW2P 2KT1A 3GPLA 3J80E 2XD0A 3CCRA 4J9EA 2PZ1A 4OF1A 4BE1A 3ZEHA 4F7UE 3I56Q 3A8OB 4LD6A 2WACA 4DEYA 1YNZA 3I55Q 2QEXA 2XU8A 2COWA 3L2QA 4HXJA 4E2FB 1KQ2A 3VJPA 3I9QA 1O75A 1WFWA 1QKXA 3A8MB 2EJFA 3M0SA 2VASA 1K4US 1VQNA 2CP2A 1QCOA 3G6EA 1YI2A 4HCCA 1JRIA 5FU6C 2VC8A 1OQKA 5GAMf 2P0QA 1WHMA 2K79A 2CSQA 3CCSQ 1MNDA 3L2RA 1WHGA 1LVKA 1KC8U 2HAXA 2NUTB 2PVDB 5GAN3 4AG2C 4C5HA 1VYTA 1ZUYA 5LJ3g 3OYYA 1BB9A 2EQMA 3FEOA 4M7AB 1PM3A 3J81E 5I11A 3I56T 1KD1U 4PJLA 3EGDA 3L2UA 4ANJA 1V29B 3I5SA 1M90U 2CP5A 3OYHA 1OX8A 4QQ6A 2XDBA 4Z89A 5GAN2 3HPWA 1H3HA 2FYKA 4IUVA 5J3BA 4M75E 1K73R 1U5SA 2E41A 2E6ZA 4C92A 1TU0B 3QDRB 4AFUC 2HCKA 1UGPB 2MF2A 4IURA 4LDUA 2FEIA 2G6FX 2M0OA 1N8RC 2MWPA 1MV0B 1D0YA 3C12A 4IUUA 4DBRA 2K3XA 2EQKA 2V8KA 2C0OA 1BI3A 4M7DD 3CXCS 3A1PA 1D3BB 2X4XA 2JNGA 4XU3A 3FC3A 1RAAB 3NHNA 4AFQC 2DD5A 2DETA 2F69A 3FJ5A 2D8JA 4PFOA 4BB7A 2JTMA 4E7HA 4CC4B 4F7UF 4RTUA 3QXEB 5IT9E 3V8JA 1VYUA 1T0HA 2QAZA 4Y28E 3CXCA 3G4SA 3H6ZA 2GCXA 1VA7A 2DTIA 2RHZA 2RQRA 2LX9A 4M7AE 1W1FA 1H641 5A0GA 2ABLA 2EJ9A 3JCMg 1VQ5Q 2RNAA 4JJNK 4A53A 3QIIA 2L89A 4PJOF 4LUDA 4C92E 2PVOB 4OVAA 1I07A 4HA8A 2J05A 1GL5A 3CCSA 3AHUA 2J6FA 3L2ZA 2OTLA 2VB6A 3M54A 1YI2Q 5EG2A 3UF4A 2RA2A 4PJMA 1UGVA 2HL3A 2CKKA 2PNIA 4UC4A 3G4ST 5GMKh 3VYGA 1BCMA 2E65A 2L3RA 4OB3B 2DIGA 5LJ5e 3LWIA 1ABOA 2COYA 2HEQA 4J8OA 8ATCB 4E7JA 2DXBA 3CC4A 3LX7A 4ORZA 4BUGA 2KAFA 1BK2A 2MAMA 3HHTB 2K4YA 4C0ZA 3CCRQ 2RI3A 1C1AA 3G71Q 2JS2A 1GCQA 1YJ9T 3H0IA 3VS3A 3HKSA 4M7AG 1KC8R 4M7AF 2R5MA 1VYVA 3OSSC 2ROLA 4RTXA 3CMAA 1VQ9T 4M77G 3E2UA 4YTLA 3OYIA 1IO6A 4MDWA 3EGXB 4R56A 3CCJQ 3RIRA 5GAMe 4FCYA 3BW1A 3OMCA 4KT0E 3J7AF 1I8FA 1G3SA 4XK8E 4V2SA 3CCQQ 2XG8D 3OMGA 3TU4K 1IGUA 1QVGA 3JV3A 3M5AA 3RDVA 4N4IA 1D1AA 1RAHB 3QBYA 2ZPFB 2EYXA 3OW2A 4QVZA 2RPNA 1VQOQ 1VQ6T 1N9RA 4A4HA 4LUEA 1VQ4T 1KQSA 2PU9B 3LYIA 3H9NA 2OJ2A 2YRDA 3D7SB 3V7SA 3JCMX 1M90C 2M51A 2P4TA 1QMCA 2QDLA 1Y96B 4M75D 2YUNA 3OW2S 4J6WA 3HTRA 4FYWB 2KSSA 3ER0A 4X9DA 5DLQE 1YIJQ 4A54A 3EFOA 1WYXA 2RQWA 4C8QA 3PGGA 4KUDK 1TS9A 4Y92A 1WLPB 5HCKA 1RAFB 2DILA 2YXYA 4KH0B 2BZXA 1C6VX 3X28B 1NM7A 1NG2A 2F2VA 4BDZA 1WPYA 1PWTA 2CGHA 4LDVA 2JMAA 4WCIA 1G5VA 4DBQA 4DBHA 5I21A 2V1RA 1M9SA 3EH2A 2LC4A 2D9TA 3CCMQ 1Q95G 2OTJQ 2OX7A 4DA4A 2VYTA 1BI0A 2NUZA 5IHIA 2MPXC 3VYHB 2LP5A 2JTFA 2KYMA 2KRSA 4F7UG 1BBZA 4HCKA 1YITA 3RESA 1M5Q1 5KYYA 1RI9A 1GFDA 5D7UA 1SF9A 4L5GA 2V1QA 4PJJA 4OGCA 2DK3A 1ZQ1A 1YJWA 3R6OA 2YRVA 2RH2A 4J9BA 2MYSA 2GFUA 3CQTA 2A3LA 2DM1A 2RHYA 4M77E 1UTIA 1N8RU 2L0AA 1D09B 2I2LA 2L3PA 4M7DA 2EGAA 3JAME 2R57A 3OA6A 1FMWA 3EHQA 4ZGEB 1KK7A 3QZ5B 1GBRA 2JJ9A 4BDYA 5FU6B 1IGQA 3MP6A 2JVVA 1K0SA 1VQ7T 1I4K1 3OYNA 3RUXA 3E9FA 3EFRA 2DFUA 3GNFB 4OMFB 1AZEA 1Z9QA 3SWNB 2FZCB 2K5FA 4M7AD 1YJNA 3JCMd 2ATCB 2WSEE 5KCOA 1T3SA 2KRNA 1H8KA 1KG1A 1VOMA 1WXUA 3JCMJ 4DOWA 1H3ZA 1AVZC 1OU9A 1Q82U 2JN0A 2FVUA 3LLRA 1ZUKA 1M8VA 5FRMA 2DERA 2HKNA 1WXBA 3E19A 4EIKA 3OBWA 5J39A 3OYLA 2EJGA 2D6FA 1ZA1B 3TEEA 3CC7Q 5A0LA 1R77A 5CVIA 1FYNA 2CUBA 4F7UB 1AEYA 1VQNT 4D8DA 1NLOC 2RD1A 5D6XA 1QVGS 3CCVT 3TSZA 1N9SA 2YUQA 2MK5A 4ZTJA 4RUGA 5HY6A 3BY7A 2EYYA 1KIKA 2CDTA 2VWFA 2FO0A 3CC2Q 4PL6A 2LJ1A 3CD6A 2HNIA 3M0UA 1E6HA 1HK9A 4HVWA 4CC3A 5DM7R 2XDPA 4OB2B 4WF2A 1NJIC 1BCOA 3CD6Q 3RKWA 1WHJA 3A5ZB 3MPUB 2D0QB 4N4HA 1WIEA 1VQ6Q 4M7AA 2E10A 1WJRA 2CP0A 1GBQA 1G83A 2A28A 3H0HA 2O9SA 2P0KA 2PQWA 4PJOA 2QG9B 4J7IA 4CI0C 1VQ6A 3RKYA 4MMLA 3VU3C 1WQWA 1D1BA 2W0ZA 3PIPA 1ARKA 2DYIA 2ENMA 2J7IA 2VKNA 2QEXQ 2CREA 1U1SA 4NL2A 1AT1B 4JRPA 5GANh 2ED0A 4JS4A 5GAN7 5FRNA 3TCJA 4QW2A 3MO8A 4JJDA 2ZGWA 3CCMA 2MCNA 1TOVA 2DNUA 3N5BB 4ELZC 2GFAA 2JOYA 2LQWA 2KXDA 4KUIA 4B9WA 3IQLA 2RHIA 1JJ2P 1TTHB 1OV3A 1RLQC 2AKLA 5KYXA 3GLXA 3EFSA 2IIMA 2YLBA 1QW1A 3QDFA 4BI3A 1VQPT 3NTHA 2RHXA 2X35A 2QDYB 2AZVA 1JJ2S 4A63B 2EVRA 2P4RA 3QUIA 5GMKi 2DL7A 3TQ7P 3EG2A 4C8QG 3RKXA 2BTTA 4MZPA 5CQYA 3TVTA 1VQMT 2V8IA 5LJ3d 4EMKA 2QGGA 3BDUA 2I0NA 1OYXA 1M3BA 1BYMA 4IIOA 2C06A 5AT1B 2FB7A 5KCHA 2EYWA 1RAEB 3JCMe 1NYFA 2A0FB 5IH2A 2YT6A 4PFPA 1M3CA 1F1BB 4FM4B 1FMVA 4X9CA 2V8JA 1EFNA 2FPFA 1VQ5T 1KQ1A 3JB9I 2DL5A 4E7ZA 1W2BA 4XTWA 5FW9A 1AD5A 3G6ET 4PJOE 3A8HB 2ZPBB 3M0QA 3RR6A 2F5KA 2DL8A 5HKCA 3ME9A 3PMIA 1JU5C 1IRXA 3EHRA 2FHDA 2QK0A 2LJ0A 4JZ4A 4LN2A 4FW2A 1YI2T 4IUQA 2J6OA 2RQUA 4J7FA 2O88A 1JBMA 1X2KA 1Y07A 1VQNQ 3PNWC 2XDDA 1MNEA 3URGA 1UUEA 1U1TA 3HRSA 1Q81C 4J9CA 1Q86C 2K7AA 4XTUA 1YITQ 2HQHA 3CC4Q 1I81A 1VQKT 3OYCA 2FPDA 4NOYA 1R0BG 2AK5A 1G3WA 3I56A 3VS7A 3WVEB 2QA4T 1XJWB 1B7TA 3X26B 4RMOA 2EGEA 2PTKA 4OMQA 3KXTA 1SHFA 1YIJA 1QVFS 1TSFA 1MUZA 4OGEA 5CK9A 1E6GA 2FL7A 2F1LA 1QVGP 4FYXB 1UEBA 3L1AA 1XQHA 1M8MA 3BE3A 4J9GA 2KROA 5KYWB 5IN1A 5GANg 2AT1B 2OAUA 4N0AC 1DJ7B 4O5VA 4Q5WA 5LL6S 1X43A 5CAIA 2XHCA 2K57A 2FRYA 2JZ2A 2RK1A 3H41A 3LW5E 2DIQA 5I2SA 1K0XA 1K8AR 2A37A 4L59A 3G4SQ 2J06A 3EFOB 3CCQT 1RABB 4NL3A 2LVMA 2ZPHB 3M53A 2M9UA 4M75A 3OS1A 2F5TX 1NBEB 1AWWA 2JT4A 5LJ5f 1PNJA 3S3OA 2A7YA 1UHCA 3OS2A 3CMAQ 1M1GA 1K73U 4HVVA 1OPLA 2QEXT 1JQQA 3PT9A 4RCCA 3OYFA 3UA6A 2DXTA 1M2VA 3QJ6A 2KBTA 3JCMc 5GAOp 5GAOn 3M58A 1Q7YU 5CR2A 5GMKe 4FW1A 3PIOA 3VUZA 5KYUB 1VQMQ 2HD0A 4Z8AA 2CP7A 3P8DA 1UGQB 5FROA 2OTLT 2RJDA 1YITT 4KBMB 4FIBA 2GQIA 2D1XA 1TUCA 3CCLT 1Z9ZA 1ZHIA 2PUKB 1MMNA 4FSSA 1U3OA 1YJWQ 2E64A 5GAOq 1VQPQ 1J3TA 1YJ9A 4C92C 4M78B 3PE0A 2DD4A 2MIOA 2FG0A 1N6AA 2F2WA 2QTXA 2KE9A 1ZSZB 3I55A 3PFSA 3NGPA 4HCZA 2DEQA 1OX9A 2DVJA 1EZZB 2SEMA 3U23A 2L3SA 5J26A 4KGXB 3A8LB 1QKWA 5GAMh 1NJIR 1PG5B 1IREB 1WNLA 4F14A 2DTHA 4RTYA 1WHHA 4J83A 2OTLQ 2X9HA 1GXIE 1QWFA 3GIBA 3VKIA 3MP1A 3OYEA 2JM9A 3RBBB 1JXOA 3MKDA 3SWNA 3M0TA 2GTJA 3CBPA 1QWEA 4JJBA 4E7IA 4A4FA 2HKQB 4QQDA 3LH5A 2O9VA 4M7DF 3OYMA 1UJYA 2DBMA 4L6V5 4DQ2A 3TREA 3JCMP 1VQ5A 5CKHA 2EW3A 2DVEA 5IHNA 4M75C 4XU0A 1FMKA 4O6JA 4JDSA 3R6NA 1X01A 1XOVA 1PSEA 1SKUB 3PVLA 3RNJA 4EMGA 4MMKA 4C0DC 4J5YA 4BY6B 1QQJA 1VQMA 2FZGB 2KMTA 2IG0A 1WHLA 1HYOA 1V1CA 4CC7A 1JEGA 1M4ZA 3OBYA 4M75G 2QQAA 2H3EB 3OYAA 1WJQA 1ZLMA 4DEXA 3JB9G 5LJ3e 2YLCA 4RG2A 1QVFA 4BY6C 1B3QA 4JPBW 2EAYA 3ASKA 2JM8A 5A2QE 3L2WA 2C0TA 1SG5A 1KHIA 1T3LA 2AZSA 3O8VA 4X1VA 4FT4A 2VVKA 1UGSB 2KQWA 2EYZA 4OB1B 4DOVA 3A8GB 3NTKA 1K9MR 4GLKA 3EG9B 4IUTA 2ZPIB 3VS4A 5I2MA 1NPRA 3RMSA 2LQKA 4KH1B 2NWMA 1VIEA 4EPCA 1VUBA 2QQBA 3CCVQ 2DLPA 2DMOA 4LDXA 1PC0A 4C92D 4M77D 1PKTA 3H0FA 2DJQA 1KD1C 3AT1B 3EH1A 2DJZA 2K9GA 1U8RA 4JZ3A 2E6NA 2CZ6B 2QGFB 3VS2A 2KGTA 1YWOA 1Q82C 3SD4A 1XTDA 4M77A 1PD1A 2CT4A 2J6KA 4QT7A 2CUDA 1LNXA 4RTZA 4RTVA 3FRNA 4EDUA 3S3NA 1GFCA 3HSBA 3T9NA 5CIUA 1YJ9Q 3S6WA 2EBPA 2LZ6B 2DRMA 3EGDB 4ELYC 1HXDA 3G71T 1SSFA 4QQGA 1WA7A 3V7RA 4XTVA 2KI7A 1YIJT 2ZZDA 5KYXB 2MI6A 2H8HA 2HZYA 3QO3A 4C92B 2RHUA 2L8DA 1G3YA 4IIMA 2G3RA 3VS6A 3VV0A 3UT1A 5GAN8 2NYSA 1D1CA 5GAOr 2Z0WA 2GQVA 2DX1A 2YUPA 3DLMA 5CKBA 1FX7A 3C95A 3EGUA 3X20B 1IZ6A 1JJ2A 1M30A 4HKEA 2LRQA 3M59A 5GAOm 1NE8A 2X51A 3V7CA 4LD9K 1AWXA 3C0CA 3H8ZA 3DLLA 3CC7A 1WDXA 4ZNXA 5GAOl 3CCUQ 4AMCA 4RG8A 3RMQA 4XTXA 3OYDA 2RQVA 2JW4A 3HRUA 3OYGA 1YP5A 2EQIA 1VQ9Q 4FT2A 1G2BA 1HD3A 2XMFA 2VUBA 2E5QA 2IPOB 2DAQA 1RACB 2CZ0B 1RUWA 2H3JA 1W2BP 1PRMC 1FWZA 4N4GA 1PHTA 1AWOA 3GNGA 3QHSA 1NLPC 3LGLA 4X34A 1Q7YR 1VQKQ 1G8XA 3ZL7C 2LMJA 4M75F 3NPFA 5D6WA 2QQ9A 3CC7T 1SRLA 2RM4A 1VQ8A 4JLGA 4C0GA 3CPWP 1MGQA 1QCFA 2XKOC 3NTIA 3CCUT 1W6XA 2CSIA 1CKAA 2RJEA 1TH7A 3P8BB 4LDYA 2LTOA 1M1KR 4QVDA 1SPKA 2YHTA 5CKEA 4B9XA 5GANj 4OMNA 5AYFA 5GAN6 2E4HA 3CCEQ 1YN8A 3G1JA 4F04B 2EPDA 2EIFA 2DL3A 2WSCE 9ATCB 3GBQA 3TSWA 2KVQG 1IHWA 4M78D 3ULRB 4N0AA 4ZTFA 1RL2A 6AT1B 2LNVA 1NPPA 2X3XD 5LJ3h 4J9DA 3CMET 4PJNA 3EGXA 5KYWA 1SHGA 2MOXA 4ESRA 4C92F 1LCKA 2P0PA 1X75C 1K8AU 2ZAEA 2QASA 1AOJA 3DKMA 2AKKA 4JRIA 4JJCA 5GMKl 2DF6A 3M4GA 3CCET 5CO7A 1M2OA 4LDWA 1YWPA 5KYNA 4OP0A 3PVQA 3KUFA 4TVRA 2P84A 1XNIA 1ZBJA 2JMCA 3M57A 3OYBA 1O9SA 3VRYA 4ME7A 3CBMA 2O2OA 1Q81U 1VIFA 4GLMA 3V8KA 3X25B 3FLGA 4D6WA 4DBFA 5FU7C 4M4ZA 1M2VB 1IB8A 2JTEA 5GJWB 1OULA 5KH6A 3OYJA 1GCQC 1LPLA 2KR3A 5ECAA 3FDRA 3FB9A 2SRCA 2RI5A 4M7DE 5KYUA 3A98A 2WSFE 2EQJA 2QI2A 2KT8A 2DA9A 3VS0A 3C4SA 3JB9H 4LE9A 1QP2A 2K5IA 2KNBB 4KULA 1LJOA 2ROTA 2E1HA 5CKFA 1UGRB 2RQTA 2X4WA 2NUPB 2DO3A 5GANd 1Y71A 4M78A 1JXMA 2D0NA 4PJOD 2RO0A 4M7AC 4HVUA 3REBB 2QQSA 2LT4A 5KYYB 4J9HA 1S72A 1ZUUA 1VQ4A 1YFNA 4AFSC 2AIRB 1X27A 1Y96A 1PSFA 2BKDN 2RMOA 3JRZA 2CP6A 1EX4A 2A36A 3GP8A 2DYBA 2FRWA 1M1KU 5GMKj 1OZ2A 3SDZA 3JCMQ 1YJWT 1VQLA 1YHQQ 1ACMB 5CKDA 1UE9A 1KJWA 5IAYA 2O4XA 3CCLQ 3CMEA 3O5ZA 2CH4W 2K6DA 4J9FA 1K1ZA 2HQXA 3CPWS 5GJVB 4BE0A 1S1NA 2FZKB 5LJ5d 5GAN5 2O01E 3QWXX 3INZA 1VQPA 1N8RR 4FYVB 4C8QF 4C8QE 3JCMh 4XTZA 1I1JA 4OMPA 5GAMj 2K2MA 4HT9A 4C0DB 1B07A 1CSKA 1BKBA 5FWBA 3JCMb 3FIFA 1PKSA 4B6MA 4ATOA 4XU1A 4MZTA 4AFZC 2BUDA 2QA4Q 2EKHA 4PK4A 3GF5A 1VQ4Q 4PKCC 3M0PA 3QG1A 5DLOA 4PNOA 2QXFA 3EAEA 1SSHA 3BFMA 1VQ8T 1YCSB 3CMEQ 2GF7A 4MZMA 3KFVA 2HSEB 2E12A 1YHQA 2DE0X 2KYBA 2M1HA 2LT1A 3HP9A 3QKJA 4RKUE 4CRIA 1JO8A 1ZSZC 2BZYA 1M3AA 3OY9A 2GNCA 2KY9A 2JXBA 2LCLA 2DRKA 5LJ3j 3EG9A 2KK4A 4WTOB 4C8QD 1Q86R 2L2PA 5GMKm 1RLPC 4M78E 4QKUA 4F7UA 1B34A 1Y57A 2HBWA 2K3BA 1HSQA 2ZCFB 2KXCA 3CEYA 2JUFA 2IVWA 3WVDB 1KSWA 4KGVB 1WX6A 1NJIU 1K9AA 2DTOA 3M56A 5KE2A 1JB0E 1YBYA 4LNPA 3QPHA 3CCUA 3UWNA 4P5NA 4M78G 3CD6T 1OU8A 1MMGA 2XIDA 1OI1A 4OMMA 2BIVA 4Y91A 2O31A 4PLLA 1G3TA 1KC8C 3MEUA 3M4YA 4PJOB 2RN8A 4CC2A 4J6XA 3CCQA 1IXDA 2ZPGB 1K8AC 2EQUA 5GAN4 2K5LA 4Z02A 2E3HA 3M55A 4NS5A 3M9QA 2VGNA 3I55T 3GOXA 1UG1A 3CCJT 4XAXB 4M78F 1X6OA 3MEVA 1ABQA 4C5EA 3WXMB 1Y0MA 1ZX6A 3I5RA 3CC2A 1NZ9A 2A08A 3UPUA 2HSPA 3HFNA 4M77C 2FPEA 4RCBA 8AT1B 3META 1N5ZA 1W4SA 3SEMA 3QWYA 3OQ5A 3G6EQ 4F16A 1OOTA 3E1SA 5L8RE 1UB4A 2D8HA 2QTVA 2CS7A 4M7DC 1KFZA 4J6YA 5A0DA 1QVPA 2VGMA 3CCRT 2DXUA 3CCEA 3QJYA 2DEUA 2HMAA 4J9IA 1V76A 1M27C 3UDCA 2DZCA 1X6GA 4E6RA 4LXCA 3MCAB 1HJDA 1WI7A 2M16A 1GCPA 2X4YA 2LCSA 4JS5A 2YDLA 1AHJB 3DB3A 2GGRA 1W70A 3NFCA 4EMKB 1I5LA 1BI2A 2VXEA 4BACA 3L42A 2NUTA 1YCYA 1YHQT 2MMPA 1SRMA 2OI3A 1X6BA 5I22A 1QCNA 1H92A 1VQOT 5D6YA 2COZA 3P8HA 1VQ8Q 4VUBA 1VQ9A 3CMAT 5LJ3f 1QVFP 3LGFA 4AG1C 5IXFA 1AWJA 5CQXA 1ZSGA 1NYGA 4C92G 3HFOA 1BIAA 3CBOA 2L3QA 4C8QC 5LJ5j 1U06A 1UDLA 2DXCA 1WQ7A 3V8LA 1LOJA 4F17A 1NEBA 1OPKA 2YSQA 3CXCP 1S72T 3OS5A 1RAGB 1BI1A 3VUBA 3RERA 4FYYB 3SWNC 4II1A 3SHWA 2M02A 1D3BA 3VRZA 3CCJA 3EG0A 3MEWA 4Z88A 3OYKA 2DL4A 2DPPB 4KRTA 1WHKA 3HRTA 5IHKA 5FU7B 1SEMA 1UFFA 2KDSA 4R55A 4OMLA 1PCXA 2DZ9A 2QA4A 5M9OA 4D8KA 5CCAA 3JB9D 2QQRA 2LJ3A 1BU1A 3Q1JA 5KE3A 4FL6A 4BI8B 2K3YA 2L5QA 1ZA2B 4IUPA 2OTJA 2V26A 3MJXA 4E7SA 1VQLQ 4K11A 3JB9J 4R0KA 2R58A 3ZBDA 4RTWA 1S72Q 2EWNA 2DBKA 3JSCA 1K9MC 1PRLC 1R0CB 4ZGJB 1MMAA 2ED1A 4ZGDB 4PJOC 2HQEA 4A4GA 2RK2A 1D0ZA 2BZ8A 5L23A 3CPFA 2XK0A 1ZBXA 1IHVA 4MDXA 3X24B 2F2XA 2CZ1B 1MV3A 2GTOA 3CCVA 1KHCA 3LWHA 1K73C 1AZGB 1VQKA 1TWBA 2RI2A 5FLXE 4M75B 1RADB 1KD1R 4GBQA 2VV5A 3JCMV 1FXXA 2CYZB 1Q82R 3SB2A 2M0YA 4C5IA 2ZPEB 3REAB 5IXBA 2NLUA 5GANe 1Q86U 1TUDA 3EG1A 5C0MA 1MMDA 3NMZC 2NUPA 2B8AA 1NEGA 3L2VA 4XTYA 1PD0A 5DY9A 1YJNQ
chains in the Genus database with same CATH topology
1N9RA 2F5TX 4M7DE 1M1FA 4A4HA 1VQ4T 1KQSA 2PVGB 2PU9B 2RB6A 3LYIA 2WSFE 2EQJA 5LJ5f 3S3OA 2QI2A 4JUVA 1VQOA 3V7SA 3JCMX 3C4SA 1W2BS 1VQ6T 1M90C 2P4TA 2A7YA 3JB9H 1N27A 1Y96B 3OS2A 1QP2A 1M1GA 4M75D 2K5IA 1K73U 4KULA 1LJOA 3OW2S 2QEXT 4J6WA 2E1HA 5CKFA 3QSUA 2CZ7B 1UGRB 5HK3A 3PT9A 2KSSA 3ER0A 4RCCA 3OYFA 4X9DA 2DXTA 5DLQE 1P92A 1WGSA 2X4WA 4A54A 2DO3A 3QJ6A 1WJSA 2E70A 5GANd 3JCMc 5GAOp 2O4XB 1Y71A 5GAOn 4M77F 4M78A 4C8QA 3M58A 2RJFA 3G71A 1Q7YU 5CR2A 1VQLT 3PGGA 4KUDK 4PJOD 2RO0A 2EKOA 4M7AC 5GMKe 2DKGA 2EFIA 3PIOA 3VUZA 3FJPA 2HD0A 2QQSA 2LT4A 3P8DA 1UGQB 5FROA 2MWOA 3X28B 1VQ4A 1S72A 2OTLT 2EYQA 2RJDA 4BDZA 1YITT 1WPYA 3LH0A 4KBMB 3QYGB 4FIBA 1Y96A 1PSFA 2BKDN 3CPWA 2CGHA 3JRZA 4LDVA 2OTJT 1G5VA 3GP8A 3OS0A 3CCLT 4M78C 1M1KU 5GMKj 5I21A 1OZ2A 1ZHIA 2PUKB 1M9SA 3SDZA 5HK0A 2LC4A 2D9TA 3JCMQ 3CCMT 1YJWT 1VQLA 2E64A 3JCMW 5CKDA 5GAOq 1OZ3A 4BI4A 5IAYA 4DA4A 2O4XA 1YJ9A 4C92C 2VYTA 1BI0A 4M78B 4JRKA 4C8QB 3CMEA 3VYHB 2DD4A 4OB0B 4FSXA 2JTFA 4XU2A 5LJ5g 1N6AA 2QTXA 2HQXA 3CPWS 2HBPA 4F7UG 3I55A 4BE0A 3HL8A 3PFSA 1YITA 3RESA 1M5Q1 2LCCA 3KBGA 4HCZA 2DEQA 5LJ5d 5GAN5 4L5GA 3CCLA 2O01E 3C94A 3INZA 1VQPA 1Q7YC 4OGCA 1RI0A 5J26A 2DK3A 1ZQ1A 4XQ3A 3S3MA 1YJWA 4C8QF 4C8QE 3R6OA 4PLIA 3JCMh 2YRVA 3A8LB 4XTZA 5GAMh 5GAMg 5GAMj 2RH2A 1EIFA 5C6SA 4C0DB 4HT9A 1IREB 1WNLA 2GFUA 2DTHA 2A3LA 1BKBA 3JCMb 1GXIE 4J83A 2R5AA 2RHYA 3FIFA 3G7ZA 3CC4T 3GIBA 4ATOA 1R8OB 4M77E 3VKIA 3MP1A 4MZTA 4XU1A 3OYEA 2AHJB 2BUDA 3PTAA 3SWNA 3GF5A 4QVCA 5DY9A 1N8RU 4A4EA 3E9GA 1MHNA 1M1KC 3OB9A 3CBPA 4PKCC 2X4JA 3QG1A 4JRQA 4E7IA 1KQSS 4A4FA 5DLOA 2I2LA 2LQ8A 2VXFA 2QXFA 4PNOA 4M7DA 3EAEA 3BFMA 4QQDA 4FU6A 4C5GA 4E7LA 3JAME 2R57A 1B34B 3OA6A 3OYMA 1VQ8T 4M7DF 1QP3A 4ZGEB 2GF7A 3QZ5B 3PMTA 4MZMA 4L6V5 4DQ2A 3TREA 1BIBA 3JCMP 3ZFJA 4BDYA 1VQ5A 5CKHA 2E12A 1YHQA 2DVEA 4BE2A 5FU6B 2M1HA 2JVVA 3MP6A 2LT1A 4M75C 3HP9A 4XU0A 4C0FA 4IKFA 1K9MU 3QKJA 4RKUE 4CRIA 4O6JA 1VQ7T 4JDSA 1I4K1 3OYNA 1X01A 4PJOG 3E9FA 3EFRA 3RUXA 4ZN3A 3GNFB 4OMFB 3MEAA 2Y4YA 3OY9A 2XI9A 1XOVA 4ZN1A 1PSEA 2KY9A 3SWNB 4M7DG 4EMGA 4MMKA 4C0DC 4E7KA 2LCLA 4J5YA 4BY6B 5LJ3j 2KK4A 4HT8A 4C8QD 1VQMA 2K5FA 4M7AD 4EMHA 5GMKm 2KMTA 1YJNA 2XICA 4M78E 3JCMd 2IG0A 4HCBA 4M7DB 3BDLA 2LDMA 2WSEE 4F7UA 5KCOA 1M4ZA 1B34A 3OBYA 3MHXA 2QQAA 4M75G 3OYAA 3QZ9B 3JB9F 1WJQA 1KG1A 3JB9G 2ZCFB 5LJ3e 5LJ5h 3JCMJ 2YLCA 3CEYA 4DOWA 2JUFA 4RG2A 1H3ZA 2IVWA 2RJCA 1Q82U 3WVDB 1VQ7A 2JN0A 1QVFA 4BY6C 3OSVA 2FVUA 3LLRA 1M8VA 1NJIU 5FRMA 2EAYA 3ASKA 2DTOA 5A2QE 3L2WA 3JCMf 3E19A 3M56A 1KHIA 3O8VA 3OBWA 5GAMd 4FT4A 5KE2A 2PUOB 1UGSB 5J39A 2KQWA 5GANf 1JB0E 1YBYA 4OB1B 3A8GB 3NTKA 3QPHA 4GLKA 4DOVA 2EJGA 2Y90A 3OYLA 4IUTA 4GY5A 3TEEA 3UWNA 3CCUA 3MP8A 3F70A 4P5NA 2D6FA 2ZPIB 4M78G 5A0LA 1Y7XA 3CD6T 5CVIA 5I2MA 4M77B 4M7AA 1NPRA 2XIDA 1OI1A 3RMSA 4F7UB 4BD3A 2BIVA 4EMKC 1YJNT 4Y91A 2LQKA 3QYHB 1VIEA 4PLLA 4EPCA 3SFMA 1VQNT 1VUBA 2QQBA 2RD1A 4JLIA 5D6XA 3CCST 3DB4A 1G3TA 3CCVT 1N9SA 1QVGS 2K2VA 1KC8C 3MEUA 2Y4XA 3M4YA 4A4KA 3CC2T 4LDXA 4E47A 4PJOB 4ZTJA 4J6XA 3CCQA 5HY6A 3BY7A 3GPLA 3J80E 2XD0A 2ZPGB 4C92D 1K8AC 3CCRA 2EQUA 4M77D 5GAN4 2K5LA 4Z02A 3M55A 4NS5A 3M9QA 4OF1A 4BE1A 1KD1C 2VGNA 4PL6A 3ZEHA 4F7UE 3I55T 2DJZA 3GOXA 3CD6A 3A8OB 4LD6A 1U8RA 2WACA 2E6NA 2CZ6B 3CCJT 2HNIA 1HK9A 4XAXB 1VQPT 3SD4A 5DM7R 1XTDA 1Q82C 4M77A 4M78F 1X6OA 3MEVA 2XDPA 4OB2B 1LNXA 4WF2A 4C5EA 1NJIC 3WXMB 2QEXA 2XU8A 3FRNA 3L2QA 3RKWA 4EDUA 3S3NA 1KQ2A 3VJPA 3CC2A 3HSBA 3T9NA 3A5ZB 3A8MB 1O75A 1NZ9A 2D0QB 2EJFA 4N4HA 5CIUA 3UPUA 2E10A 1WJRA 3HFNA 4M77C 3S6WA 4RCBA 3META 1VQNA 1W4SA 4ELYC 2P0KA 2PQWA 4PJOA 1HXDA 3G6EA 3OQ5A 1YI2A 4J7IA 4CI0C 3G71T 1VQ6A 3RKYA 4MMLA 3VU3C 3E1SA 4HCCA 1JRIA 1SSFA 1UB4A 4QQGA 5FU6C 5L8RE 2VC8A 3V7RA 4XTVA 2CS7A 1WQWA 5GAMf 4M7DC 4J6YA 1YIJT 2P0QA 5A0DA 1QVPA 3PIPA 2VGMA 3CCRT 2DXUA 3L2RA 2ZZDA 2MI6A 3QJYA 3CCEA 1KC8U 2HAXA 2PVDB 5GAN3 1U1SA 4NL2A 4C5HA 4JRPA 3QO3A 5GANh 5LJ3g 3OYYA 4C92B 2RHUA 3UDCA 2L8DA 2DZCA 4JS4A 5GAN7 5FRNA 1G3YA 2G3RA 4QW2A 3TCJA 2EQMA 3MCAB 3MO8A 3VV0A 3FEOA 4M7AB 3UT1A 3J81E 3I56T 5GAN8 1KD1U 2ZGWA 2M16A 3CCMA 5GAOr 2GQVA 2X4YA 3L2UA 3DLMA 5CKBA 4JS5A 3N5BB 4ELZC 1V29B 1FX7A 3C95A 2GFAA 1AHJB 3DB3A 1M90U 3X20B 1IZ6A 2JOYA 3NFCA 1JJ2A 4EMKB 1I5LA 4KUIA 4B9WA 1BI2A 3OYHA 2RHIA 4HKEA 4QQ6A 2XDBA 5GAN2 3HPWA 2LRQA 4PJOE 3M59A 5GAOm 1NE8A 2VXEA 3V7CA 4BACA 4LD9K 2FYKA 3L42A 3GLXA 1YCYA 4IUVA 3EFSA 5J3BA 3H8ZA 1YHQT 4M75E 2MMPA 3DLLA 2YLBA 1QW1A 4BI3A 3CC7A 5GAOl 2E41A 2E6ZA 3NTHA 2RHXA 2X35A 2QDYB 4RG8A 4C92A 3QDRB 3RMQA 1UGPB 2MF2A 4IURA 4LDUA 4XTXA 1JJ2S 3OYDA 1VQOT 3HRUA 2M0OA 3OYGA 3QUIA 1N8RC 5GMKi 5D6YA 2MWPA 3P8HA 4VUBA 1VQ9A 3CMAT 3C12A 4IUUA 4FT2A 5LJ3f 4C8QG 2K3XA 3RKXA 2EQKA 4MZPA 5CQYA 2V8KA 1BI3A 1VQMT 2V8IA 3LGFA 4M7DD 5LJ3d 4EMKA 3CXCS 1D3BB 2X4XA 2JNGA 1OYXA 2VUBA 3BDUA 4XU3A 3FC3A 2DD5A 2E5QA 5CQXA 1BYMA 2C06A 2DAQA 4C92G 2FB7A 2F69A 2CZ0B 3HFOA 5KCHA 1BIAA 2H3JA 3JCMe 4BB7A 3CBOA 1FWZA 2JTMA 4E7HA 4N4GA 4F7UF 3GNGA 3QHSA 3QXEB 5IT9E 4C8QC 3LGLA 3V8JA 4X34A 5LJ5j 2DXCA 4Y28E 1WQ7A 3V8LA 1LOJA 3CXCA 3G4SA 4M75F 4FM4B 5D6WA 3H6ZA 2QQ9A 3CC7T 2GCXA 1S72T 4X9CA 2DTIA 2RHZA 2RM4A 2V8JA 3OS5A 1VQ8A 2LX9A 4JLGA 4M7AE 4C0GA 1H641 1MGQA 1BI1A 3VUBA 5A0GA 2XKOC 3RERA 2EJ9A 3NTIA 3SWNC 4II1A 3JCMg 4JJNK 1KQ1A 3JB9I 3CCUT 1VQ5T 4A53A 1W2BA 4XTWA 1D3BA 3QIIA 3G6ET 2L89A 1TH7A 2RJEA 3P8BB 4LDYA 3CCJA 2LTOA 3A8HB 3MEWA 2ZPBB 4PJOF 4C92E 3OYKA 4QVDA 2DPPB 2YHTA 5CKEA 2F5KA 3HRTA 2PVOB 5HKCA 4B9XA 4OVAA 4HA8A 3ME9A 5FU7B 5GANj 3CCSA 2KDSA 5AYFA 4R55A 3AHUA 5GAN6 3PMIA 2DZ9A 2QA4A 5M9OA 5CCAA 3JB9D 2QQRA 3L2ZA 3Q1JA 2EIFA 5KE3A 4FL6A 2OTLA 2FHDA 3M54A 4BI8B 3OS1A 2K3YA 2WSCE 5EG2A 2L5QA 1YI2T 4IUQA 2RA2A 2KVQG 4IUPA 4J7FA 2OTJA 4M78D 4N0AA 1JBMA 4ZTFA 2CKKA 3JB9J 1Y07A 1RL2A 4UC4A 3G4ST 5GMKh 3VYGA 3PNWC 2XDDA 2E65A 2R58A 2L3RA 3URGA 4OB3B 3ZBDA 2LNVA 1NPPA 1U1TA 2DIGA 3HRSA 5LJ3h 5LJ5e 3LWIA 1Q81C 1Q86C 3CMET 4J8OA 4XTUA 2EWNA 4E7JA 1I81A 3JSCA 1K9MC 2DXBA 4ZGJB 1VQKT 3CC4A 3LX7A 3OYCA 4ZGDB 4NOYA 2KAFA 4BUGA 4PJOC 4C92F 2MAMA 3HHTB 2K4YA 2P0PA 1G3WA 1X75C 2HQEA 1K8AU 4A4GA 3WVEB 3I56A 4C0ZA 2RK2A 2RI3A 2QA4T 3DKMA 3X26B 3CPFA 4RMOA 1YJ9T 4JRIA 2XK0A 3KXTA 1ZBXA 3HKSA 1YIJA 4M7AG 4MDXA 4M7AF 3X24B 5GMKl 2R5MA 1QVFS 3M4GA 3OSSC 4OGEA 2CZ1B 5CK9A 3CCET 3CCVA 2FL7A 5CO7A 1KHCA 3LWHA 1K73C 4LDWA 1UEBA 3CMAA 3L1AA 1VQ9T 4M77G 1VQKA 4YTLA 3OYIA 2RI2A 1XQHA 4OP0A 5FLXE 4M75B 3KUFA 2VV5A 4MDWA 3JCMV 4TVRA 1XNIA 5IN1A 1FXXA 5GANg 2CYZB 2OAUA 4N0AC 1DJ7B 4O5VA 4Q5WA 5LL6S 3SB2A 5CAIA 4C5IA 4R56A 2XHCA 2ZPEB 3RIRA 3M57A 5GAMe 3BW1A 2NLUA 3OYBA 1O9SA 3OMCA 4KT0E 3J7AF 1I8FA 1G3SA 2K57A 4ME7A 4XK8E 4V2SA 3CBMA 5GANe 2JZ2A 1VIFA 2RK1A 1Q81U 3V8KA 2XG8D 1Q86U 3OMGA 3X25B 3TU4K 3FLGA 3LW5E 4D6WA 2DIQA 5I2SA 1QVGA 5C0MA 3M5AA 5FU7C 4L59A 4N4IA 5KH6A 3OYJA 2B8AA 3CCQT 3QBYA 4NL3A 2LVMA 2ZPFB 2ZPHB 4XTYA 3L2VA 3OW2A 4QVZA 3M53A 3FDRA 3FB9A 2RI5A 2M9UA 4M75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJ7 B;  2ZPG B;  2PUO B;  1QP3 A;  4ZGE B;  1UGS B;  3QZ5 B;  2PVG B;  2PU9 B;  1JB0 E;  2CZ0 B;  2ZPE B;  3A8G B;  4OB1 B;  3A8L B;  4L6V 5;  2WSF E;  3X26 B;  3VYG A;  2QDY B;  2WSE E;  3A8H B;  2ZPB B;  4KT0 E;  4XK8 E;  1IRE B;  2ZPI B;  5L8R E;  1UGP B;  3QXE B;  2DD4 A;  2DPP B;  3A8O B;  4OB0 B;  3QZ9 B;  4OB3 B;  3VYH B;  3X24 B;  1GXI E;  2PVO B;  2ZCF B;  2CZ1 B;  2CZ6 B;  1V29 B;  3X25 B;  2DXC A;  1QP2 A;  1AHJ B;  1UGQ B;  3LW5 E;  4RKU E;  4Y28 E;  3X20 B;  3X28 B;  2AHJ B;  3QYH B;  2ZZD A;  4FM4 B;  2CZ7 B;  1UGR B;  3QYG B;  3WVD B;  2DXB A;  4ZGJ B;  4OB2 B;  1PSF A;  4ZGD B;  2PVD B;  2ZPF B;  2ZPH B;  1PSE A;  3HHT B;  2O01 E;  2WSC E;  3A8M B;  2D0Q B;  2PUK B;  3WVE B;  2DD5 A;  2CYZ B; 
#chains in the Genus database with same CATH topology
 1M1F A;  2JS0 A;  2PVG B;  2RB6 A;  2BE9 B;  4JUV A;  1VQO A;  1KQS P;  1W2B S;  5EC7 A;  1N27 A;  3QSU A;  2CZ7 B;  5HK3 A;  3VS1 A;  1I0C A;  1P92 A;  1WGS A;  1WJS A;  2E70 A;  2OAW A;  2O4X B;  4M77 F;  3G71 A;  2RJF A;  1WXT A;  1VQL T;  2LQN A;  7AT1 B;  2EKO A;  2DKG A;  2EGC A;  2EFI A;  2ESW A;  1ZSZ A;  2C0I A;  2BE7 D;  3FJP A;  1OEB A;  2MWO A;  2X3W D;  2EYQ A;  3LH0 A;  3QYG B;  3CPW A;  2OTJ T;  3OS0 A;  4M78 C;  2LNH B;  5HK0 A;  4PFZ A;  3M0R A;  3CCM T;  1C0M A;  3JCM W;  1OZ3 A;  4BI4 A;  4KGZ B;  1D0X A;  4JRK A;  4C8Q B;  2KRM A;  4OB0 B;  4FSX A;  2W10 A;  2CP3 A;  4XU2 A;  5LJ5 g;  3UA7 A;  2HBP A;  3HL8 A;  2LCC A;  3KBG A;  2E5K A;  3CCL A;  3C94 A;  1RAI B;  3THK A;  1Q7Y C;  2HL5 C;  1RI0 A;  3S3M A;  2CH4 A;  4XQ3 A;  3I35 A;  2YUO A;  1QLY A;  4PLI A;  5GAM g;  1EIF A;  5C6S A;  1UEC A;  2R5A A;  3G7Z A;  3CC4 T;  1R8O B;  2YWW A;  2AHJ B;  3PTA A;  4QVC A;  4A4E A;  3E9G A;  1WZO A;  1MHN A;  1TG0 A;  3OB9 A;  1M1K C;  1E7O A;  1TXQ A;  2ECZ A;  2X4J A;  4JRQ A;  1KQS S;  2LQ8 A;  2QYZ A;  1TUG B;  2VXF A;  4C5G A;  4FU6 A;  2CT3 A;  4E7L A;  1B34 B;  1QP3 A;  3PMT A;  2HDA A;  1BIB A;  3ZFJ A;  4OMO A;  3VS5 A;  4BE2 A;  1UJ0 A;  4C0F A;  4IKF A;  1K9M U;  1A0N B;  1VQ7 Q;  3EG3 A;  4PJO G;  4ZN3 A;  3MEA A;  1UHF A;  2Y4Y A;  2XI9 A;  4ZN1 A;  1M90 R;  4M7D G;  4E7K A;  4HT8 A;  2GBQ A;  3UAT A;  4EMH A;  1CKB A;  2XIC A;  4HCB A;  5FWC A;  4M7D B;  3BDL A;  2LDM A;  3MHX A;  3QZ9 B;  3JB9 F;  2LX7 A;  5LJ5 h;  2RJC A;  1VQ7 A;  2E3I A;  3OSV A;  3JCM f;  1X2Q A;  1Q81 R;  2KEA A;  5GAM d;  2PUO B;  5GAN f;  1I5O B;  2Y90 A;  4GY5 A;  3MP8 A;  3F70 A;  1Y7X A;  1X69 A;  4M77 B;  1K76 A;  4BD3 A;  4AT1 B;  4EMK C;  1GRI A;  1YJN T;  4RTT A;  3QYH B;  3SFM A;  2RF0 A;  2B86 A;  2YRC A;  4JLI A;  3CCS T;  3DB4 A;  2K2V A;  2Y4X A;  1T0J A;  4A4K A;  3CC2 T;  4E47 A;  3OW2 P;  2KT1 A;  3GPL A;  3J80 E;  2XD0 A;  3CCR A;  4J9E A;  2PZ1 A;  4OF1 A;  4BE1 A;  3ZEH A;  4F7U E;  3I56 Q;  3A8O B;  4LD6 A;  2WAC A;  4DEY A;  1YNZ A;  3I55 Q;  2QEX A;  2XU8 A;  2COW A;  3L2Q A;  4HXJ A;  4E2F B;  1KQ2 A;  3VJP A;  3I9Q A;  1O75 A;  1WFW A;  1QKX A;  3A8M B;  2EJF A;  3M0S A;  2VAS A;  1K4U S;  1VQN A;  2CP2 A;  1QCO A;  3G6E A;  1YI2 A;  4HCC A;  1JRI A;  5FU6 C;  2VC8 A;  1OQK A;  5GAM f;  2P0Q A;  1WHM A;  2K79 A;  2CSQ A;  3CCS Q;  1MND A;  3L2R A;  1WHG A;  1LVK A;  1KC8 U;  2HAX A;  2NUT B;  2PVD B;  5GAN 3;  4AG2 C;  4C5H A;  1VYT A;  1ZUY A;  5LJ3 g;  3OYY A;  1BB9 A;  2EQM A;  3FEO A;  4M7A B;  1PM3 A;  3J81 E;  5I11 A;  3I56 T;  1KD1 U;  4PJL A;  3EGD A;  3L2U A;  4ANJ A;  1V29 B;  3I5S A;  1M90 U;  2CP5 A;  3OYH A;  1OX8 A;  4QQ6 A;  2XDB A;  4Z89 A;  5GAN 2;  3HPW A;  1H3H A;  2FYK A;  4IUV A;  5J3B A;  4M75 E;  1K73 R;  1U5S A;  2E41 A;  2E6Z A;  4C92 A;  1TU0 B;  3QDR B;  4AFU C;  2HCK A;  1UGP B;  2MF2 A;  4IUR A;  4LDU A;  2FEI A;  2G6F X;  2M0O A;  1N8R C;  2MWP A;  1MV0 B;  1D0Y A;  3C12 A;  4IUU A;  4DBR A;  2K3X A;  2EQK A;  2V8K A;  2C0O A;  1BI3 A;  4M7D D;  3CXC S;  3A1P A;  1D3B B;  2X4X A;  2JNG A;  4XU3 A;  3FC3 A;  1RAA B;  3NHN A;  4AFQ C;  2DD5 A;  2DET A;  2F69 A;  3FJ5 A;  2D8J A;  4PFO A;  4BB7 A;  2JTM A;  4E7H A;  4CC4 B;  4F7U F;  4RTU A;  3QXE B;  5IT9 E;  3V8J A;  1VYU A;  1T0H A;  2QAZ A;  4Y28 E;  3CXC A;  3G4S A;  3H6Z A;  2GCX A;  1VA7 A;  2DTI A;  2RHZ A;  2RQR A;  2LX9 A;  4M7A E;  1W1F A;  1H64 1;  5A0G A;  2ABL A;  2EJ9 A;  3JCM g;  1VQ5 Q;  2RNA A;  4JJN K;  4A53 A;  3QII A;  2L89 A;  4PJO F;  4LUD A;  4C92 E;  2PVO B;  4OVA A;  1I07 A;  4HA8 A;  2J05 A;  1GL5 A;  3CCS A;  3AHU A;  2J6F A;  3L2Z A;  2OTL A;  2VB6 A;  3M54 A;  1YI2 Q;  5EG2 A;  3UF4 A;  2RA2 A;  4PJM A;  1UGV A;  2HL3 A;  2CKK A;  2PNI A;  4UC4 A;  3G4S T;  5GMK h;  3VYG A;  1BCM A;  2E65 A;  2L3R A;  4OB3 B;  2DIG A;  5LJ5 e;  3LWI A;  1ABO A;  2COY A;  2HEQ A;  4J8O A;  8ATC B;  4E7J A;  2DXB A;  3CC4 A;  3LX7 A;  4ORZ A;  4BUG A;  2KAF A;  1BK2 A;  2MAM A;  3HHT B;  2K4Y A;  4C0Z A;  3CCR Q;  2RI3 A;  1C1A A;  3G71 Q;  2JS2 A;  1GCQ A;  1YJ9 T;  3H0I A;  3VS3 A;  3HKS A;  4M7A G;  1KC8 R;  4M7A F;  2R5M A;  1VYV A;  3OSS C;  2ROL A;  4RTX A;  3CMA A;  1VQ9 T;  4M77 G;  3E2U A;  4YTL A;  3OYI A;  1IO6 A;  4MDW A;  3EGX B;  4R56 A;  3CCJ Q;  3RIR A;  5GAM e;  4FCY A;  3BW1 A;  3OMC A;  4KT0 E;  3J7A F;  1I8F A;  1G3S A;  4XK8 E;  4V2S A;  3CCQ Q;  2XG8 D;  3OMG A;  3TU4 K;  1IGU A;  1QVG A;  3JV3 A;  3M5A A;  3RDV A;  4N4I A;  1D1A A;  1RAH B;  3QBY A;  2ZPF B;  2EYX A;  3OW2 A;  4QVZ A;  2RPN A;  1VQO Q;  1VQ6 T;  1N9R A;  4A4H A;  4LUE A;  1VQ4 T;  1KQS A;  2PU9 B;  3LYI A;  3H9N A;  2OJ2 A;  2YRD A;  3D7S B;  3V7S A;  3JCM X;  1M90 C;  2M51 A;  2P4T A;  1QMC A;  2QDL A;  1Y96 B;  4M75 D;  2YUN A;  3OW2 S;  4J6W A;  3HTR A;  4FYW B;  2KSS A;  3ER0 A;  4X9D A;  5DLQ E;  1YIJ Q;  4A54 A;  3EFO A;  1WYX A;  2RQW A;  4C8Q A;  3PGG A;  4KUD K;  1TS9 A;  4Y92 A;  1WLP B;  5HCK A;  1RAF B;  2DIL A;  2YXY A;  4KH0 B;  2BZX A;  1C6V X;  3X28 B;  1NM7 A;  1NG2 A;  2F2V A;  4BDZ A;  1WPY A;  1PWT A;  2CGH A;  4LDV A;  2JMA A;  4WCI A;  1G5V A;  4DBQ A;  4DBH A;  5I21 A;  2V1R A;  1M9S A;  3EH2 A;  2LC4 A;  2D9T A;  3CCM Q;  1Q95 G;  2OTJ Q;  2OX7 A;  4DA4 A;  2VYT A;  1BI0 A;  2NUZ A;  5IHI A;  2MPX C;  3VYH B;  2LP5 A;  2JTF A;  2KYM A;  2KRS A;  4F7U G;  1BBZ A;  4HCK A;  1YIT A;  3RES A;  1M5Q 1;  5KYY A;  1RI9 A;  1GFD A;  5D7U A;  1SF9 A;  4L5G A;  2V1Q A;  4PJJ A;  4OGC A;  2DK3 A;  1ZQ1 A;  1YJW A;  3R6O A;  2YRV A;  2RH2 A;  4J9B A;  2MYS A;  2GFU A;  3CQT A;  2A3L A;  2DM1 A;  2RHY A;  4M77 E;  1UTI A;  1N8R U;  2L0A A;  1D09 B;  2I2L A;  2L3P A;  4M7D A;  2EGA A;  3JAM E;  2R57 A;  3OA6 A;  1FMW A;  3EHQ A;  4ZGE B;  1KK7 A;  3QZ5 B;  1GBR A;  2JJ9 A;  4BDY A;  5FU6 B;  1IGQ A;  3MP6 A;  2JVV A;  1K0S A;  1VQ7 T;  1I4K 1;  3OYN A;  3RUX A;  3E9F A;  3EFR A;  2DFU A;  3GNF B;  4OMF B;  1AZE A;  1Z9Q A;  3SWN B;  2FZC B;  2K5F A;  4M7A D;  1YJN A;  3JCM d;  2ATC B;  2WSE E;  5KCO A;  1T3S A;  2KRN A;  1H8K A;  1KG1 A;  1VOM A;  1WXU A;  3JCM J;  4DOW A;  1H3Z A;  1AVZ C;  1OU9 A;  1Q82 U;  2JN0 A;  2FVU A;  3LLR A;  1ZUK A;  1M8V A;  5FRM A;  2DER A;  2HKN A;  1WXB A;  3E19 A;  4EIK A;  3OBW A;  5J39 A;  3OYL A;  2EJG A;  2D6F A;  1ZA1 B;  3TEE A;  3CC7 Q;  5A0L A;  1R77 A;  5CVI A;  1FYN A;  2CUB A;  4F7U B;  1AEY A;  1VQN T;  4D8D A;  1NLO C;  2RD1 A;  5D6X A;  1QVG S;  3CCV T;  3TSZ A;  1N9S A;  2YUQ A;  2MK5 A;  4ZTJ A;  4RUG A;  5HY6 A;  3BY7 A;  2EYY A;  1KIK A;  2CDT A;  2VWF A;  2FO0 A;  3CC2 Q;  4PL6 A;  2LJ1 A;  3CD6 A;  2HNI A;  3M0U A;  1E6H A;  1HK9 A;  4HVW A;  4CC3 A;  5DM7 R;  2XDP A;  4OB2 B;  4WF2 A;  1NJI C;  1BCO A;  3CD6 Q;  3RKW A;  1WHJ A;  3A5Z B;  3MPU B;  2D0Q B;  4N4H A;  1WIE A;  1VQ6 Q;  4M7A A;  2E10 A;  1WJR A;  2CP0 A;  1GBQ A;  1G83 A;  2A28 A;  3H0H A;  2O9S A;  2P0K A;  2PQW A;  4PJO A;  2QG9 B;  4J7I A;  4CI0 C;  1VQ6 A;  3RKY A;  4MML A;  3VU3 C;  1WQW A;  1D1B A;  2W0Z A;  3PIP A;  1ARK A;  2DYI A;  2ENM A;  2J7I A;  2VKN A;  2QEX Q;  2CRE A;  1U1S A;  4NL2 A;  1AT1 B;  4JRP A;  5GAN h;  2ED0 A;  4JS4 A;  5GAN 7;  5FRN A;  3TCJ A;  4QW2 A;  3MO8 A;  4JJD A;  2ZGW A;  3CCM A;  2MCN A;  1TOV A;  2DNU A;  3N5B B;  4ELZ C;  2GFA A;  2JOY A;  2LQW A;  2KXD A;  4KUI A;  4B9W A;  3IQL A;  2RHI A;  1JJ2 P;  1TTH B;  1OV3 A;  1RLQ C;  2AKL A;  5KYX A;  3GLX A;  3EFS A;  2IIM A;  2YLB A;  1QW1 A;  3QDF A;  4BI3 A;  1VQP T;  3NTH A;  2RHX A;  2X35 A;  2QDY B;  2AZV A;  1JJ2 S;  4A63 B;  2EVR A;  2P4R A;  3QUI A;  5GMK i;  2DL7 A;  3TQ7 P;  3EG2 A;  4C8Q G;  3RKX A;  2BTT A;  4MZP A;  5CQY A;  3TVT A;  1VQM T;  2V8I A;  5LJ3 d;  4EMK A;  2QGG A;  3BDU A;  2I0N A;  1OYX A;  1M3B A;  1BYM A;  4IIO A;  2C06 A;  5AT1 B;  2FB7 A;  5KCH A;  2EYW A;  1RAE B;  3JCM e;  1NYF A;  2A0F B;  5IH2 A;  2YT6 A;  4PFP A;  1M3C A;  1F1B B;  4FM4 B;  1FMV A;  4X9C A;  2V8J A;  1EFN A;  2FPF A;  1VQ5 T;  1KQ1 A;  3JB9 I;  2DL5 A;  4E7Z A;  1W2B A;  4XTW A;  5FW9 A;  1AD5 A;  3G6E T;  4PJO E;  3A8H B;  2ZPB B;  3M0Q A;  3RR6 A;  2F5K A;  2DL8 A;  5HKC A;  3ME9 A;  3PMI A;  1JU5 C;  1IRX A;  3EHR A;  2FHD A;  2QK0 A;  2LJ0 A;  4JZ4 A;  4LN2 A;  4FW2 A;  1YI2 T;  4IUQ A;  2J6O A;  2RQU A;  4J7F A;  2O88 A;  1JBM A;  1X2K A;  1Y07 A;  1VQN Q;  3PNW C;  2XDD A;  1MNE A;  3URG A;  1UUE A;  1U1T A;  3HRS A;  1Q81 C;  4J9C A;  1Q86 C;  2K7A A;  4XTU A;  1YIT Q;  2HQH A;  3CC4 Q;  1I81 A;  1VQK T;  3OYC A;  2FPD A;  4NOY A;  1R0B G;  2AK5 A;  1G3W A;  3I56 A;  3VS7 A;  3WVE B;  2QA4 T;  1XJW B;  1B7T A;  3X26 B;  4RMO A;  2EGE A;  2PTK A;  4OMQ A;  3KXT A;  1SHF A;  1YIJ A;  1QVF S;  1TSF A;  1MUZ A;  4OGE A;  5CK9 A;  1E6G A;  2FL7 A;  2F1L A;  1QVG P;  4FYX B;  1UEB A;  3L1A A;  1XQH A;  1M8M A;  3BE3 A;  4J9G A;  2KRO A;  5KYW B;  5IN1 A;  5GAN g;  2AT1 B;  2OAU A;  4N0A C;  1DJ7 B;  4O5V A;  4Q5W A;  5LL6 S;  1X43 A;  5CAI A;  2XHC A;  2K57 A;  2FRY A;  2JZ2 A;  2RK1 A;  3H41 A;  3LW5 E;  2DIQ A;  5I2S A;  1K0X A;  1K8A R;  2A37 A;  4L59 A;  3G4S Q;  2J06 A;  3EFO B;  3CCQ T;  1RAB B;  4NL3 A;  2LVM A;  2ZPH B;  3M53 A;  2M9U A;  4M75 A;  3OS1 A;  2F5T X;  1NBE B;  1AWW A;  2JT4 A;  5LJ5 f;  1PNJ A;  3S3O A;  2A7Y A;  1UHC A;  3OS2 A;  3CMA Q;  1M1G A;  1K73 U;  4HVV A;  1OPL A;  2QEX T;  1JQQ A;  3PT9 A;  4RCC A;  3OYF A;  3UA6 A;  2DXT A;  1M2V A;  3QJ6 A;  2KBT A;  3JCM c;  5GAO p;  5GAO n;  3M58 A;  1Q7Y U;  5CR2 A;  5GMK e;  4FW1 A;  3PIO A;  3VUZ A;  5KYU B;  1VQM Q;  2HD0 A;  4Z8A A;  2CP7 A;  3P8D A;  1UGQ B;  5FRO A;  2OTL T;  2RJD A;  1YIT T;  4KBM B;  4FIB A;  2GQI A;  2D1X A;  1TUC A;  3CCL T;  1Z9Z A;  1ZHI A;  2PUK B;  1MMN A;  4FSS A;  1U3O A;  1YJW Q;  2E64 A;  5GAO q;  1VQP Q;  1J3T A;  1YJ9 A;  4C92 C;  4M78 B;  3PE0 A;  2DD4 A;  2MIO A;  2FG0 A;  1N6A A;  2F2W A;  2QTX A;  2KE9 A;  1ZSZ B;  3I55 A;  3PFS A;  3NGP A;  4HCZ A;  2DEQ A;  1OX9 A;  2DVJ A;  1EZZ B;  2SEM A;  3U23 A;  2L3S A;  5J26 A;  4KGX B;  3A8L B;  1QKW A;  5GAM h;  1NJI R;  1PG5 B;  1IRE B;  1WNL A;  4F14 A;  2DTH A;  4RTY A;  1WHH A;  4J83 A;  2OTL Q;  2X9H A;  1GXI E;  1QWF A;  3GIB A;  3VKI A;  3MP1 A;  3OYE A;  2JM9 A;  3RBB B;  1JXO A;  3MKD A;  3SWN A;  3M0T A;  2GTJ A;  3CBP A;  1QWE A;  4JJB A;  4E7I A;  4A4F A;  2HKQ B;  4QQD A;  3LH5 A;  2O9V A;  4M7D F;  3OYM A;  1UJY A;  2DBM A;  4L6V 5;  4DQ2 A;  3TRE A;  3JCM P;  1VQ5 A;  5CKH A;  2EW3 A;  2DVE A;  5IHN A;  4M75 C;  4XU0 A;  1FMK A;  4O6J A;  4JDS A;  3R6N A;  1X01 A;  1XOV A;  1PSE A;  1SKU B;  3PVL A;  3RNJ A;  4EMG A;  4MMK A;  4C0D C;  4J5Y A;  4BY6 B;  1QQJ A;  1VQM A;  2FZG B;  2KMT A;  2IG0 A;  1WHL A;  1HYO A;  1V1C A;  4CC7 A;  1JEG A;  1M4Z A;  3OBY A;  4M75 G;  2QQA A;  2H3E B;  3OYA A;  1WJQ A;  1ZLM A;  4DEX A;  3JB9 G;  5LJ3 e;  2YLC A;  4RG2 A;  1QVF A;  4BY6 C;  1B3Q A;  4JPB W;  2EAY A;  3ASK A;  2JM8 A;  5A2Q E;  3L2W A;  2C0T A;  1SG5 A;  1KHI A;  1T3L A;  2AZS A;  3O8V A;  4X1V A;  4FT4 A;  2VVK A;  1UGS B;  2KQW A;  2EYZ A;  4OB1 B;  4DOV A;  3A8G B;  3NTK A;  1K9M R;  4GLK A;  3EG9 B;  4IUT A;  2ZPI B;  3VS4 A;  5I2M A;  1NPR A;  3RMS A;  2LQK A;  4KH1 B;  2NWM A;  1VIE A;  4EPC A;  1VUB A;  2QQB A;  3CCV Q;  2DLP A;  2DMO A;  4LDX A;  1PC0 A;  4C92 D;  4M77 D;  1PKT A;  3H0F A;  2DJQ A;  1KD1 C;  3AT1 B;  3EH1 A;  2DJZ A;  2K9G A;  1U8R A;  4JZ3 A;  2E6N A;  2CZ6 B;  2QGF B;  3VS2 A;  2KGT A;  1YWO A;  1Q82 C;  3SD4 A;  1XTD A;  4M77 A;  1PD1 A;  2CT4 A;  2J6K A;  4QT7 A;  2CUD A;  1LNX A;  4RTZ A;  4RTV A;  3FRN A;  4EDU A;  3S3N A;  1GFC A;  3HSB A;  3T9N A;  5CIU A;  1YJ9 Q;  3S6W A;  2EBP A;  2LZ6 B;  2DRM A;  3EGD B;  4ELY C;  1HXD A;  3G71 T;  1SSF A;  4QQG A;  1WA7 A;  3V7R A;  4XTV A;  2KI7 A;  1YIJ T;  2ZZD A;  5KYX B;  2MI6 A;  2H8H A;  2HZY A;  3QO3 A;  4C92 B;  2RHU A;  2L8D A;  1G3Y A;  4IIM A;  2G3R A;  3VS6 A;  3VV0 A;  3UT1 A;  5GAN 8;  2NYS A;  1D1C A;  5GAO r;  2Z0W A;  2GQV A;  2DX1 A;  2YUP A;  3DLM A;  5CKB A;  1FX7 A;  3C95 A;  3EGU A;  3X20 B;  1IZ6 A;  1JJ2 A;  1M30 A;  4HKE A;  2LRQ A;  3M59 A;  5GAO m;  1NE8 A;  2X51 A;  3V7C A;  4LD9 K;  1AWX A;  3C0C A;  3H8Z A;  3DLL A;  3CC7 A;  1WDX A;  4ZNX A;  5GAO l;  3CCU Q;  4AMC A;  4RG8 A;  3RMQ A;  4XTX A;  3OYD A;  2RQV A;  2JW4 A;  3HRU A;  3OYG A;  1YP5 A;  2EQI A;  1VQ9 Q;  4FT2 A;  1G2B A;  1HD3 A;  2XMF A;  2VUB A;  2E5Q A;  2IPO B;  2DAQ A;  1RAC B;  2CZ0 B;  1RUW A;  2H3J A;  1W2B P;  1PRM C;  1FWZ A;  4N4G A;  1PHT A;  1AWO A;  3GNG A;  3QHS A;  1NLP C;  3LGL A;  4X34 A;  1Q7Y R;  1VQK Q;  1G8X A;  3ZL7 C;  2LMJ A;  4M75 F;  3NPF A;  5D6W A;  2QQ9 A;  3CC7 T;  1SRL A;  2RM4 A;  1VQ8 A;  4JLG A;  4C0G A;  3CPW P;  1MGQ A;  1QCF A;  2XKO C;  3NTI A;  3CCU T;  1W6X A;  2CSI A;  1CKA A;  2RJE A;  1TH7 A;  3P8B B;  4LDY A;  2LTO A;  1M1K R;  4QVD A;  1SPK A;  2YHT A;  5CKE A;  4B9X A;  5GAN j;  4OMN A;  5AYF A;  5GAN 6;  2E4H A;  3CCE Q;  1YN8 A;  3G1J A;  4F04 B;  2EPD A;  2EIF A;  2DL3 A;  2WSC E;  9ATC B;  3GBQ A;  3TSW A;  2KVQ G;  1IHW A;  4M78 D;  3ULR B;  4N0A A;  4ZTF A;  1RL2 A;  6AT1 B;  2LNV A;  1NPP A;  2X3X D;  5LJ3 h;  4J9D A;  3CME T;  4PJN A;  3EGX A;  5KYW A;  1SHG A;  2MOX A;  4ESR A;  4C92 F;  1LCK A;  2P0P A;  1X75 C;  1K8A U;  2ZAE A;  2QAS A;  1AOJ A;  3DKM A;  2AKK A;  4JRI A;  4JJC A;  5GMK l;  2DF6 A;  3M4G A;  3CCE T;  5CO7 A;  1M2O A;  4LDW A;  1YWP A;  5KYN A;  4OP0 A;  3PVQ A;  3KUF A;  4TVR A;  2P84 A;  1XNI A;  1ZBJ A;  2JMC A;  3M57 A;  3OYB A;  1O9S A;  3VRY A;  4ME7 A;  3CBM A;  2O2O A;  1Q81 U;  1VIF A;  4GLM A;  3V8K A;  3X25 B;  3FLG A;  4D6W A;  4DBF A;  5FU7 C;  4M4Z A;  1M2V B;  1IB8 A;  2JTE A;  5GJW B;  1OUL A;  5KH6 A;  3OYJ A;  1GCQ C;  1LPL A;  2KR3 A;  5ECA A;  3FDR A;  3FB9 A;  2SRC A;  2RI5 A;  4M7D E;  5KYU A;  3A98 A;  2WSF E;  2EQJ A;  2QI2 A;  2KT8 A;  2DA9 A;  3VS0 A;  3C4S A;  3JB9 H;  4LE9 A;  1QP2 A;  2K5I A;  2KNB B;  4KUL A;  1LJO A;  2ROT A;  2E1H A;  5CKF A;  1UGR B;  2RQT A;  2X4W A;  2NUP B;  2DO3 A;  5GAN d;  1Y71 A;  4M78 A;  1JXM A;  2D0N A;  4PJO D;  2RO0 A;  4M7A C;  4HVU A;  3REB B;  2QQS A;  2LT4 A;  5KYY B;  4J9H A;  1S72 A;  1ZUU A;  1VQ4 A;  1YFN A;  4AFS C;  2AIR B;  1X27 A;  1Y96 A;  1PSF A;  2BKD N;  2RMO A;  3JRZ A;  2CP6 A;  1EX4 A;  2A36 A;  3GP8 A;  2DYB A;  2FRW A;  1M1K U;  5GMK j;  1OZ2 A;  3SDZ A;  3JCM Q;  1YJW T;  1VQL A;  1YHQ Q;  1ACM B;  5CKD A;  1UE9 A;  1KJW A;  5IAY A;  2O4X A;  3CCL Q;  3CME A;  3O5Z A;  2CH4 W;  2K6D A;  4J9F A;  1K1Z A;  2HQX A;  3CPW S;  5GJV B;  4BE0 A;  1S1N A;  2FZK B;  5LJ5 d;  5GAN 5;  2O01 E;  3QWX X;  3INZ A;  1VQP A;  1N8R R;  4FYV B;  4C8Q F;  4C8Q E;  3JCM h;  4XTZ A;  1I1J A;  4OMP A;  5GAM j;  2K2M A;  4HT9 A;  4C0D B;  1B07 A;  1CSK A;  1BKB A;  5FWB A;  3JCM b;  3FIF A;  1PKS A;  4B6M A;  4ATO A;  4XU1 A;  4MZT A;  4AFZ C;  2BUD A;  2QA4 Q;  2EKH A;  4PK4 A;  3GF5 A;  1VQ4 Q;  4PKC C;  3M0P A;  3QG1 A;  5DLO A;  4PNO A;  2QXF A;  3EAE A;  1SSH A;  3BFM A;  1VQ8 T;  1YCS B;  3CME Q;  2GF7 A;  4MZM A;  3KFV A;  2HSE B;  2E12 A;  1YHQ A;  2DE0 X;  2KYB A;  2M1H A;  2LT1 A;  3HP9 A;  3QKJ A;  4RKU E;  4CRI A;  1JO8 A;  1ZSZ C;  2BZY A;  1M3A A;  3OY9 A;  2GNC A;  2KY9 A;  2JXB A;  2LCL A;  2DRK A;  5LJ3 j;  3EG9 A;  2KK4 A;  4WTO B;  4C8Q D;  1Q86 R;  2L2P A;  5GMK m;  1RLP C;  4M78 E;  4QKU A;  4F7U A;  1B34 A;  1Y57 A;  2HBW A;  2K3B A;  1HSQ A;  2ZCF B;  2KXC A;  3CEY A;  2JUF A;  2IVW A;  3WVD B;  1KSW A;  4KGV B;  1WX6 A;  1NJI U;  1K9A A;  2DTO A;  3M56 A;  5KE2 A;  1JB0 E;  1YBY A;  4LNP A;  3QPH A;  3CCU A;  3UWN A;  4P5N A;  4M78 G;  3CD6 T;  1OU8 A;  1MMG A;  2XID A;  1OI1 A;  4OMM A;  2BIV A;  4Y91 A;  2O31 A;  4PLL A;  1G3T A;  1KC8 C;  3MEU A;  3M4Y A;  4PJO B;  2RN8 A;  4CC2 A;  4J6X A;  3CCQ A;  1IXD A;  2ZPG B;  1K8A C;  2EQU A;  5GAN 4;  2K5L A;  4Z02 A;  2E3H A;  3M55 A;  4NS5 A;  3M9Q A;  2VGN A;  3I55 T;  3GOX A;  1UG1 A;  3CCJ T;  4XAX B;  4M78 F;  1X6O A;  3MEV A;  1ABQ A;  4C5E A;  3WXM B;  1Y0M A;  1ZX6 A;  3I5R A;  3CC2 A;  1NZ9 A;  2A08 A;  3UPU A;  2HSP A;  3HFN A;  4M77 C;  2FPE A;  4RCB A;  8AT1 B;  3MET A;  1N5Z A;  1W4S A;  3SEM A;  3QWY A;  3OQ5 A;  3G6E Q;  4F16 A;  1OOT A;  3E1S A;  5L8R E;  1UB4 A;  2D8H A;  2QTV A;  2CS7 A;  4M7D C;  1KFZ A;  4J6Y A;  5A0D A;  1QVP A;  2VGM A;  3CCR T;  2DXU A;  3CCE A;  3QJY A;  2DEU A;  2HMA A;  4J9I A;  1V76 A;  1M27 C;  3UDC A;  2DZC A;  1X6G A;  4E6R A;  4LXC A;  3MCA B;  1HJD A;  1WI7 A;  2M16 A;  1GCP A;  2X4Y A;  2LCS A;  4JS5 A;  2YDL A;  1AHJ B;  3DB3 A;  2GGR A;  1W70 A;  3NFC A;  4EMK B;  1I5L A;  1BI2 A;  2VXE A;  4BAC A;  3L42 A;  2NUT A;  1YCY A;  1YHQ T;  2MMP A;  1SRM A;  2OI3 A;  1X6B A;  5I22 A;  1QCN A;  1H92 A;  1VQO T;  5D6Y A;  2COZ A;  3P8H A;  1VQ8 Q;  4VUB A;  1VQ9 A;  3CMA T;  5LJ3 f;  1QVF P;  3LGF A;  4AG1 C;  5IXF A;  1AWJ A;  5CQX A;  1ZSG A;  1NYG A;  4C92 G;  3HFO A;  1BIA A;  3CBO A;  2L3Q A;  4C8Q C;  5LJ5 j;  1U06 A;  1UDL A;  2DXC A;  1WQ7 A;  3V8L A;  1LOJ A;  4F17 A;  1NEB A;  1OPK A;  2YSQ A;  3CXC P;  1S72 T;  3OS5 A;  1RAG B;  1BI1 A;  3VUB A;  3RER A;  4FYY B;  3SWN C;  4II1 A;  3SHW A;  2M02 A;  1D3B A;  3VRZ A;  3CCJ A;  3EG0 A;  3MEW A;  4Z88 A;  3OYK A;  2DL4 A;  2DPP B;  4KRT A;  1WHK A;  3HRT A;  5IHK A;  5FU7 B;  1SEM A;  1UFF A;  2KDS A;  4R55 A;  4OML A;  1PCX A;  2DZ9 A;  2QA4 A;  5M9O A;  4D8K A;  5CCA A;  3JB9 D;  2QQR A;  2LJ3 A;  1BU1 A;  3Q1J A;  5KE3 A;  4FL6 A;  4BI8 B;  2K3Y A;  2L5Q A;  1ZA2 B;  4IUP A;  2OTJ A;  2V26 A;  3MJX A;  4E7S A;  1VQL Q;  4K11 A;  3JB9 J;  4R0K A;  2R58 A;  3ZBD A;  4RTW A;  1S72 Q;  2EWN A;  2DBK A;  3JSC A;  1K9M C;  1PRL C;  1R0C B;  4ZGJ B;  1MMA A;  2ED1 A;  4ZGD B;  4PJO C;  2HQE A;  4A4G A;  2RK2 A;  1D0Z A;  2BZ8 A;  5L23 A;  3CPF A;  2XK0 A;  1ZBX A;  1IHV A;  4MDX A;  3X24 B;  2F2X A;  2CZ1 B;  1MV3 A;  2GTO A;  3CCV A;  1KHC A;  3LWH A;  1K73 C;  1AZG B;  1VQK A;  1TWB A;  2RI2 A;  5FLX E;  4M75 B;  1RAD B;  1KD1 R;  4GBQ A;  2VV5 A;  3JCM V;  1FXX A;  2CYZ B;  1Q82 R;  3SB2 A;  2M0Y A;  4C5I A;  2ZPE B;  3REA B;  5IXB A;  2NLU A;  5GAN e;  1Q86 U;  1TUD A;  3EG1 A;  5C0M A;  1MMD A;  3NMZ C;  2NUP A;  2B8A A;  1NEG A;  3L2V A;  4XTY A;  1PD0 A;  5DY9 A;  1YJN Q; 
#chains in the Genus database with same CATH homology
 1N9R A;  2F5T X;  4M7D E;  1M1F A;  4A4H A;  1VQ4 T;  1KQS A;  2PVG B;  2PU9 B;  2RB6 A;  3LYI A;  2WSF E;  2EQJ A;  5LJ5 f;  3S3O A;  2QI2 A;  4JUV A;  1VQO A;  3V7S A;  3JCM X;  3C4S A;  1W2B S;  1VQ6 T;  1M90 C;  2P4T A;  2A7Y A;  3JB9 H;  1N27 A;  1Y96 B;  3OS2 A;  1QP2 A;  1M1G A;  4M75 D;  2K5I A;  1K73 U;  4KUL A;  1LJO A;  3OW2 S;  2QEX T;  4J6W A;  2E1H A;  5CKF A;  3QSU A;  2CZ7 B;  1UGR B;  5HK3 A;  3PT9 A;  2KSS A;  3ER0 A;  4RCC A;  3OYF A;  4X9D A;  2DXT A;  5DLQ E;  1P92 A;  1WGS A;  2X4W A;  4A54 A;  2DO3 A;  3QJ6 A;  1WJS A;  2E70 A;  5GAN d;  3JCM c;  5GAO p;  2O4X B;  1Y71 A;  5GAO n;  4M77 F;  4M78 A;  4C8Q A;  3M58 A;  2RJF A;  3G71 A;  1Q7Y U;  5CR2 A;  1VQL T;  3PGG A;  4KUD K;  4PJO D;  2RO0 A;  2EKO A;  4M7A C;  5GMK e;  2DKG A;  2EFI A;  3PIO A;  3VUZ A;  3FJP A;  2HD0 A;  2QQS A;  2LT4 A;  3P8D A;  1UGQ B;  5FRO A;  2MWO A;  3X28 B;  1VQ4 A;  1S72 A;  2OTL T;  2EYQ A;  2RJD A;  4BDZ A;  1YIT T;  1WPY A;  3LH0 A;  4KBM B;  3QYG B;  4FIB A;  1Y96 A;  1PSF A;  2BKD N;  3CPW A;  2CGH A;  3JRZ A;  4LDV A;  2OTJ T;  1G5V A;  3GP8 A;  3OS0 A;  3CCL T;  4M78 C;  1M1K U;  5GMK j;  5I21 A;  1OZ2 A;  1ZHI A;  2PUK B;  1M9S A;  3SDZ A;  5HK0 A;  2LC4 A;  2D9T A;  3JCM Q;  3CCM T;  1YJW T;  1VQL A;  2E64 A;  3JCM W;  5CKD A;  5GAO q;  1OZ3 A;  4BI4 A;  5IAY A;  4DA4 A;  2O4X A;  1YJ9 A;  4C92 C;  2VYT A;  1BI0 A;  4M78 B;  4JRK A;  4C8Q B;  3CME A;  3VYH B;  2DD4 A;  4OB0 B;  4FSX A;  2JTF A;  4XU2 A;  5LJ5 g;  1N6A A;  2QTX A;  2HQX A;  3CPW S;  2HBP A;  4F7U G;  3I55 A;  4BE0 A;  3HL8 A;  3PFS A;  1YIT A;  3RES A;  1M5Q 1;  2LCC A;  3KBG A;  4HCZ A;  2DEQ A;  5LJ5 d;  5GAN 5;  4L5G A;  3CCL A;  2O01 E;  3C94 A;  3INZ A;  1VQP A;  1Q7Y C;  4OGC A;  1RI0 A;  5J26 A;  2DK3 A;  1ZQ1 A;  4XQ3 A;  3S3M A;  1YJW A;  4C8Q F;  4C8Q E;  3R6O A;  4PLI A;  3JCM h;  2YRV A;  3A8L B;  4XTZ A;  5GAM h;  5GAM g;  5GAM j;  2RH2 A;  1EIF A;  5C6S A;  4C0D B;  4HT9 A;  1IRE B;  1WNL A;  2GFU A;  2DTH A;  2A3L A;  1BKB A;  3JCM b;  1GXI E;  4J83 A;  2R5A A;  2RHY A;  3FIF A;  3G7Z A;  3CC4 T;  3GIB A;  4ATO A;  1R8O B;  4M77 E;  3VKI A;  3MP1 A;  4MZT A;  4XU1 A;  3OYE A;  2AHJ B;  2BUD A;  3PTA A;  3SWN A;  3GF5 A;  4QVC A;  5DY9 A;  1N8R U;  4A4E A;  3E9G A;  1MHN A;  1M1K C;  3OB9 A;  3CBP A;  4PKC C;  2X4J A;  3QG1 A;  4JRQ A;  4E7I A;  1KQS S;  4A4F A;  5DLO A;  2I2L A;  2LQ8 A;  2VXF A;  2QXF A;  4PNO A;  4M7D A;  3EAE A;  3BFM A;  4QQD A;  4FU6 A;  4C5G A;  4E7L A;  3JAM E;  2R57 A;  1B34 B;  3OA6 A;  3OYM A;  1VQ8 T;  4M7D F;  1QP3 A;  4ZGE B;  2GF7 A;  3QZ5 B;  3PMT A;  4MZM A;  4L6V 5;  4DQ2 A;  3TRE A;  1BIB A;  3JCM P;  3ZFJ A;  4BDY A;  1VQ5 A;  5CKH A;  2E12 A;  1YHQ A;  2DVE A;  4BE2 A;  5FU6 B;  2M1H A;  2JVV A;  3MP6 A;  2LT1 A;  4M75 C;  3HP9 A;  4XU0 A;  4C0F A;  4IKF A;  1K9M U;  3QKJ A;  4RKU E;  4CRI A;  4O6J A;  1VQ7 T;  4JDS A;  1I4K 1;  3OYN A;  1X01 A;  4PJO G;  3E9F A;  3EFR A;  3RUX A;  4ZN3 A;  3GNF B;  4OMF B;  3MEA A;  2Y4Y A;  3OY9 A;  2XI9 A;  1XOV A;  4ZN1 A;  1PSE A;  2KY9 A;  3SWN B;  4M7D G;  4EMG A;  4MMK A;  4C0D C;  4E7K A;  2LCL A;  4J5Y A;  4BY6 B;  5LJ3 j;  2KK4 A;  4HT8 A;  4C8Q D;  1VQM A;  2K5F A;  4M7A D;  4EMH A;  5GMK m;  2KMT A;  1YJN A;  2XIC A;  4M78 E;  3JCM d;  2IG0 A;  4HCB A;  4M7D B;  3BDL A;  2LDM A;  2WSE E;  4F7U A;  5KCO A;  1M4Z A;  1B34 A;  3OBY A;  3MHX A;  2QQA A;  4M75 G;  3OYA A;  3QZ9 B;  3JB9 F;  1WJQ A;  1KG1 A;  3JB9 G;  2ZCF B;  5LJ3 e;  5LJ5 h;  3JCM J;  2YLC A;  3CEY A;  4DOW A;  2JUF A;  4RG2 A;  1H3Z A;  2IVW A;  2RJC A;  1Q82 U;  3WVD B;  1VQ7 A;  2JN0 A;  1QVF A;  4BY6 C;  3OSV A;  2FVU A;  3LLR A;  1M8V A;  1NJI U;  5FRM A;  2EAY A;  3ASK A;  2DTO A;  5A2Q E;  3L2W A;  3JCM f;  3E19 A;  3M56 A;  1KHI A;  3O8V A;  3OBW A;  5GAM d;  4FT4 A;  5KE2 A;  2PUO B;  1UGS B;  5J39 A;  2KQW A;  5GAN f;  1JB0 E;  1YBY A;  4OB1 B;  3A8G B;  3NTK A;  3QPH A;  4GLK A;  4DOV A;  2EJG A;  2Y90 A;  3OYL A;  4IUT A;  4GY5 A;  3TEE A;  3UWN A;  3CCU A;  3MP8 A;  3F70 A;  4P5N A;  2D6F A;  2ZPI B;  4M78 G;  5A0L A;  1Y7X A;  3CD6 T;  5CVI A;  5I2M A;  4M77 B;  4M7A A;  1NPR A;  2XID A;  1OI1 A;  3RMS A;  4F7U B;  4BD3 A;  2BIV A;  4EMK C;  1YJN T;  4Y91 A;  2LQK A;  3QYH B;  1VIE A;  4PLL A;  4EPC A;  3SFM A;  1VQN T;  1VUB A;  2QQB A;  2RD1 A;  4JLI A;  5D6X A;  3CCS T;  3DB4 A;  1G3T A;  3CCV T;  1N9S A;  1QVG S;  2K2V A;  1KC8 C;  3MEU A;  2Y4X A;  3M4Y A;  4A4K A;  3CC2 T;  4LDX A;  4E47 A;  4PJO B;  4ZTJ A;  4J6X A;  3CCQ A;  5HY6 A;  3BY7 A;  3GPL A;  3J80 E;  2XD0 A;  2ZPG B;  4C92 D;  1K8A C;  3CCR A;  2EQU A;  4M77 D;  5GAN 4;  2K5L A;  4Z02 A;  3M55 A;  4NS5 A;  3M9Q A;  4OF1 A;  4BE1 A;  1KD1 C;  2VGN A;  4PL6 A;  3ZEH A;  4F7U E;  3I55 T;  2DJZ A;  3GOX A;  3CD6 A;  3A8O B;  4LD6 A;  1U8R A;  2WAC A;  2E6N A;  2CZ6 B;  3CCJ T;  2HNI A;  1HK9 A;  4XAX B;  1VQP T;  3SD4 A;  5DM7 R;  1XTD A;  1Q82 C;  4M77 A;  4M78 F;  1X6O A;  3MEV A;  2XDP A;  4OB2 B;  1LNX A;  4WF2 A;  4C5E A;  1NJI C;  3WXM B;  2QEX A;  2XU8 A;  3FRN A;  3L2Q A;  3RKW A;  4EDU A;  3S3N A;  1KQ2 A;  3VJP A;  3CC2 A;  3HSB A;  3T9N A;  3A5Z B;  3A8M B;  1O75 A;  1NZ9 A;  2D0Q B;  2EJF A;  4N4H A;  5CIU A;  3UPU A;  2E10 A;  1WJR A;  3HFN A;  4M77 C;  3S6W A;  4RCB A;  3MET A;  1VQN A;  1W4S A;  4ELY C;  2P0K A;  2PQW A;  4PJO A;  1HXD A;  3G6E A;  3OQ5 A;  1YI2 A;  4J7I A;  4CI0 C;  3G71 T;  1VQ6 A;  3RKY A;  4MML A;  3VU3 C;  3E1S A;  4HCC A;  1JRI A;  1SSF A;  1UB4 A;  4QQG A;  5FU6 C;  5L8R E;  2VC8 A;  3V7R A;  4XTV A;  2CS7 A;  1WQW A;  5GAM f;  4M7D C;  4J6Y A;  1YIJ T;  2P0Q A;  5A0D A;  1QVP A;  3PIP A;  2VGM A;  3CCR T;  2DXU A;  3L2R A;  2ZZD A;  2MI6 A;  3QJY A;  3CCE A;  1KC8 U;  2HAX A;  2PVD B;  5GAN 3;  1U1S A;  4NL2 A;  4C5H A;  4JRP A;  3QO3 A;  5GAN h;  5LJ3 g;  3OYY A;  4C92 B;  2RHU A;  3UDC A;  2L8D A;  2DZC A;  4JS4 A;  5GAN 7;  5FRN A;  1G3Y A;  2G3R A;  4QW2 A;  3TCJ A;  2EQM A;  3MCA B;  3MO8 A;  3VV0 A;  3FEO A;  4M7A B;  3UT1 A;  3J81 E;  3I56 T;  5GAN 8;  1KD1 U;  2ZGW A;  2M16 A;  3CCM A;  5GAO r;  2GQV A;  2X4Y A;  3L2U A;  3DLM A;  5CKB A;  4JS5 A;  3N5B B;  4ELZ C;  1V29 B;  1FX7 A;  3C95 A;  2GFA A;  1AHJ B;  3DB3 A;  1M90 U;  3X20 B;  1IZ6 A;  2JOY A;  3NFC A;  1JJ2 A;  4EMK B;  1I5L A;  4KUI A;  4B9W A;  1BI2 A;  3OYH A;  2RHI A;  4HKE A;  4QQ6 A;  2XDB A;  5GAN 2;  3HPW A;  2LRQ A;  4PJO E;  3M59 A;  5GAO m;  1NE8 A;  2VXE A;  3V7C A;  4BAC A;  4LD9 K;  2FYK A;  3L42 A;  3GLX A;  1YCY A;  4IUV A;  3EFS A;  5J3B A;  3H8Z A;  1YHQ T;  4M75 E;  2MMP A;  3DLL A;  2YLB A;  1QW1 A;  4BI3 A;  3CC7 A;  5GAO l;  2E41 A;  2E6Z A;  3NTH A;  2RHX A;  2X35 A;  2QDY B;  4RG8 A;  4C92 A;  3QDR B;  3RMQ A;  1UGP B;  2MF2 A;  4IUR A;  4LDU A;  4XTX A;  1JJ2 S;  3OYD A;  1VQO T;  3HRU A;  2M0O A;  3OYG A;  3QUI A;  1N8R C;  5GMK i;  5D6Y A;  2MWP A;  3P8H A;  4VUB A;  1VQ9 A;  3CMA T;  3C12 A;  4IUU A;  4FT2 A;  5LJ3 f;  4C8Q G;  2K3X A;  3RKX A;  2EQK A;  4MZP A;  5CQY A;  2V8K A;  1BI3 A;  1VQM T;  2V8I A;  3LGF A;  4M7D D;  5LJ3 d;  4EMK A;  3CXC S;  1D3B B;  2X4X A;  2JNG A;  1OYX A;  2VUB A;  3BDU A;  4XU3 A;  3FC3 A;  2DD5 A;  2E5Q A;  5CQX A;  1BYM A;  2C06 A;  2DAQ A;  4C92 G;  2FB7 A;  2F69 A;  2CZ0 B;  3HFO A;  5KCH A;  1BIA A;  2H3J A;  3JCM e;  4BB7 A;  3CBO A;  1FWZ A;  2JTM A;  4E7H A;  4N4G A;  4F7U F;  3GNG A;  3QHS A;  3QXE B;  5IT9 E;  4C8Q C;  3LGL A;  3V8J A;  4X34 A;  5LJ5 j;  2DXC A;  4Y28 E;  1WQ7 A;  3V8L A;  1LOJ A;  3CXC A;  3G4S A;  4M75 F;  4FM4 B;  5D6W A;  3H6Z A;  2QQ9 A;  3CC7 T;  2GCX A;  1S72 T;  4X9C A;  2DTI A;  2RHZ A;  2RM4 A;  2V8J A;  3OS5 A;  1VQ8 A;  2LX9 A;  4JLG A;  4M7A E;  4C0G A;  1H64 1;  1MGQ A;  1BI1 A;  3VUB A;  5A0G A;  2XKO C;  3RER A;  2EJ9 A;  3NTI A;  3SWN C;  4II1 A;  3JCM g;  4JJN K;  1KQ1 A;  3JB9 I;  3CCU T;  1VQ5 T;  4A53 A;  1W2B A;  4XTW A;  1D3B A;  3QII A;  3G6E T;  2L89 A;  1TH7 A;  2RJE A;  3P8B B;  4LDY A;  3CCJ A;  2LTO A;  3A8H B;  3MEW A;  2ZPB B;  4PJO F;  4C92 E;  3OYK A;  4QVD A;  2DPP B;  2YHT A;  5CKE A;  2F5K A;  3HRT A;  2PVO B;  5HKC A;  4B9X A;  4OVA A;  4HA8 A;  3ME9 A;  5FU7 B;  5GAN j;  3CCS A;  2KDS A;  5AYF A;  4R55 A;  3AHU A;  5GAN 6;  3PMI A;  2DZ9 A;  2QA4 A;  5M9O A;  5CCA A;  3JB9 D;  2QQR A;  3L2Z A;  3Q1J A;  2EIF A;  5KE3 A;  4FL6 A;  2OTL A;  2FHD A;  3M54 A;  4BI8 B;  3OS1 A;  2K3Y A;  2WSC E;  5EG2 A;  2L5Q A;  1YI2 T;  4IUQ A;  2RA2 A;  2KVQ G;  4IUP A;  4J7F A;  2OTJ A;  4M78 D;  4N0A A;  1JBM A;  4ZTF A;  2CKK A;  3JB9 J;  1Y07 A;  1RL2 A;  4UC4 A;  3G4S T;  5GMK h;  3VYG A;  3PNW C;  2XDD A;  2E65 A;  2R58 A;  2L3R A;  3URG A;  4OB3 B;  3ZBD A;  2LNV A;  1NPP A;  1U1T A;  2DIG A;  3HRS A;  5LJ3 h;  5LJ5 e;  3LWI A;  1Q81 C;  1Q86 C;  3CME T;  4J8O A;  4XTU A;  2EWN A;  4E7J A;  1I81 A;  3JSC A;  1K9M C;  2DXB A;  4ZGJ B;  1VQK T;  3CC4 A;  3LX7 A;  3OYC A;  4ZGD B;  4NOY A;  2KAF A;  4BUG A;  4PJO C;  4C92 F;  2MAM A;  3HHT B;  2K4Y A;  2P0P A;  1G3W A;  1X75 C;  2HQE A;  1K8A U;  4A4G A;  3WVE B;  3I56 A;  4C0Z A;  2RK2 A;  2RI3 A;  2QA4 T;  3DKM A;  3X26 B;  3CPF A;  4RMO A;  1YJ9 T;  4JRI A;  2XK0 A;  3KXT A;  1ZBX A;  3HKS A;  1YIJ A;  4M7A G;  4MDX A;  4M7A F;  3X24 B;  5GMK l;  2R5M A;  1QVF S;  3M4G A;  3OSS C;  4OGE A;  2CZ1 B;  5CK9 A;  3CCE T;  3CCV A;  2FL7 A;  5CO7 A;  1KHC A;  3LWH A;  1K73 C;  4LDW A;  1UEB A;  3CMA A;  3L1A A;  1VQ9 T;  4M77 G;  1VQK A;  4YTL A;  3OYI A;  2RI2 A;  1XQH A;  4OP0 A;  5FLX E;  4M75 B;  3KUF A;  2VV5 A;  4MDW A;  3JCM V;  4TVR A;  1XNI A;  5IN1 A;  1FXX A;  5GAN g;  2CYZ B;  2OAU A;  4N0A C;  1DJ7 B;  4O5V A;  4Q5W A;  5LL6 S;  3SB2 A;  5CAI A;  4C5I A;  4R56 A;  2XHC A;  2ZPE B;  3RIR A;  3M57 A;  5GAM e;  3BW1 A;  2NLU A;  3OYB A;  1O9S A;  3OMC A;  4KT0 E;  3J7A F;  1I8F A;  1G3S A;  2K57 A;  4ME7 A;  4XK8 E;  4V2S A;  3CBM A;  5GAN e;  2JZ2 A;  1VIF A;  2RK1 A;  1Q81 U;  3V8K A;  2XG8 D;  1Q86 U;  3OMG A;  3X25 B;  3TU4 K;  3FLG A;  3LW5 E;  4D6W A;  2DIQ A;  5I2S A;  1QVG A;  5C0M A;  3M5A A;  5FU7 C;  4L59 A;  4N4I A;  5KH6 A;  3OYJ A;  2B8A A;  3CCQ T;  3QBY A;  4NL3 A;  2LVM A;  2ZPF B;  2ZPH B;  4XTY A;  3L2V A;  3OW2 A;  4QVZ A;  3M53 A;  3FDR A;  3FB9 A;  2RI5 A;  2M9U A;  4M75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...