2PVHA

Structure-based design of pyrazolo[1,5-a][1,3,5]triazine derivatives as potent inhibitors of protein kinase ck2
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
328
structure length
327
Chain Sequence
MSKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNAYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design, synthesis, and study of pyrazolo[1,5-a][1,3,5]triazine derivatives as potent inhibitors of protein kinase CK2.
pubmed doi rcsb
source organism Zea mays
molecule tags Transferase
molecule keywords Casein kinase II subunit alpha
total genus 110
structure length 327
sequence length 328
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2pvhA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2pvhA02
4C58A 4FKUA 4YPSA 5IQHA 4EHGA 3ZSGA 4MNEA 5D9HA 4W8DA 4UYAA 2GNFA 2FGIA 2Z2WA 3TTJA 3GQIA 4J71A 1BX6A 3QA0A 5H2UA 3NX8A 4J98A 4ZY6A 2W9FB 3FDNA 1QPJA 3PUPA 4UWCA 5EH0A 4YJNA 2ZV2A 1U59A 4AW5A 2HZ0A 2XCKA 3QD4A 1SZMA 3HECA 4HPUE 3BE9A 4QP1A 5E7RA 2CGXA 3V6RA 4X3FA 5EG3A 5A6OA 3PLSA 2PZRA 4M69A 3QKKA 3RCJA 3D9VA 3HRCA 3FI4A 2V62A 4WG5A 1O6KA 3MY5A 2UW3A 4X3JA 3C51A 5EFQA 3MVJA 4BTMA 4F7LA 5AJQA 2XF0A 4K0YA 4FSWA 2VO0A 2YM5A 4KIKB 5D7VA 3TUDA 2I7QA 3IKAA 5F4NA 4IDTA 3UOKA 3KULA 3EB0A 4PL4A 3R6XA 5EYMA 1M17A 2W06A 3DK6A 3VUTA 4USEA 4JQEA 1IASA 3KN5A 4XNEA 4IC7A 4QTBA 1W84A 4AA5A 2UW8A 4O0TA 2F57A 3A8XA 5ETIA 2FVDA 5EK7A 4FTAA 4QMQA 3Q4UA 3PIXA 3W55A 1R0PA 5CS6A 2PSQA 1OPKA 1H27A 4RQKA 4RA4A 3M2WA 3RKBA 4ALVA 4E6CA 5I5ZA 1YVJA 3SQQA 5D1JA 4I1ZA 4LRJA 1SNXA 2VZ6A 3KF7A 4GUBA 4IXPA 1F0QA 5A6NA 2VUWA 4ALWA 4WSYA 5HI2A 1NVQA 1Q61A 4EK4A 2I40A 5IQEA 3K5UA 4O38A 4QP6A 3AQVA 3R8UA 3RJCA 4FSQA 3FY0A 2X2LA 5CZIA 4YTHA 3LOKA 3OBJA 5DI1A 4ZK5A 3R30A 3ZSHA 3BYVA 4F08A 4CFWA 2BALA 1Y8YA 2CN5A 3F6XA 3RM6A 1CKIA 5M4IA 2ERZE 1R1WA 3U4WA 2CGVA 5A4CA 2YM7A 1GZOA 2XNEA 4IWPA 1Q8ZA 5CLPA 2HY0A 4IZ7A 4ANSA 1FOTA 3OXIA 4U44A 3R8MA 3D5UA 3ODYX 3SRVB 4AS0A 2XK8A 4X21A 5M53A 3DU8A 3VBXA 1M7QA 2JDSA 4ARKA 3BLRA 4KB8A 2BAQA 2H9VA 4GJ3A 5A3XA 4WG4A 2Y4IC 2GS2A 3CQEA 4GK3A 4N4SA 4N6ZA 4RGJA 5CVFA 5AR7A 4D9TA 4OT6A 3NVKI 2WMVA 2JGZA 3EL7A 4EOLA 3WF5A 4JT3A 2OKRA 4BCOA 4O82A 2CDZA 2WMAA 3VS0A 5A4LA 3BE2A 4FUXA 3ORLA 2V7AA 4Y8DA 2Y4PA 4FI1A 4FTJA 4PMSA 1WFCA 2QQ7A 2XKEA 4RSSA 4G3CA 1WZYA 2PE2A 2PPQA 3E62A 1OKZA 3U9CA 3TT0A 3C4XA 4YSMA 3O96A 4V0GB 2WD1A 3NUPA 2IVUA 1XO2B 4LOPA 3DDPA 2I1MA 5B0XA 4QTAA 5TF9A 2WMQA 3DJ7A 4B4LA 4EOMA 1FQ1B 1OPJA 3D5XA 4FTQA 4O0XA 5FDXA 3MA3A 3W16A 4AT4A 3U55A 3ODZX 3ZRLA 3HV4A 4YLLA 4L45A 4YUQA 3F66A 4XG4A 3UIMA 4C62A 3EJ1A 2BRHA 4NUSA 4MD7E 3W8LA 2R4BA 4JNWA 4F6UA 4YJUA 5ANEA 3UPXA 1PMVA 2GNGA 5HVKA 4DFZE 1PMUA 4L43A 4K2RA 4C3PA 4NCTA 5HD7A 1EH4A 2C6KA 2X8IA 4GU9A 2R7BA 1WVWA 1Q8TA 4O81A 4AE6A 2R3JA 3FLWA 2OIBA 3BV3A 2PMLX 5M55A 4Z16A 3GU5A 4BCGA 2GMXA 3HMNA 4LM5A 3LFFA 4RG0A 3DV3A 4R1YA 2GCDA 3ZSIA 4BN1A 4IVDA 4U0IA 1YQJA 2XNGA 1OL7A 3ALNA 4PPCA 2GFCA 4ACMA 4TPTA 3RMFA 3TI1A 3BKBA 3LJ0A 5HORA 3NMUF 5M56A 5EI6A 2Y9QA 3UC4A 3SXRA 2EXMA 3LFBA 1YI6A 5CQWA 4BWKA 1ZYSA 4J95A 2WTIA 5HBHA 3VS3A 5TOZA 3U6HA 1W7HA 3OCTA 5AA9A 4RX9A 1GY3A 4FKPA 4AN9A 3HAVA 4KUJA 4PTCA 2PVNA 4FT9A 3OWPA 4QYYA 2UW6A 4D4SA 1R0EA 4L00A 3DBDA 5D7AA 4BBFA 4BYJA 4HW7A 3KU2A 3F3WA 1H07A 5L3AA 4FIFA 1MRVA 1PXIA 3DGKA 4AAAA 4R3PA 3PG1A 4H3PA 3SXSA 2BDFA 4Y85A 3TV7A 5L6OA 4FZAB 3FE3A 3UQCA 4FV0A 2F4JA 1O6YA 1CTPE 3IQ7A 3WZUA 3WIKA 4U81A 5IPJA 2OZOA 4C57A 4JG7A 5GINE 2FSTX 2B4SB 4M15A 4NJ3A 4O1OA 2X39A 3H0ZA 4OTQA 2R7IA 5HO6A 1Q5KA 4ENYA 2W05A 4NT4A 3FZOA 4C34A 4AQCA 3LMHA 4CFXA 3IOKA 3R71A 5CEKA 4QMXA 2G2HA 2PVJA 2WEVA 4EOIA 1PMNA 3RI1A 3Q96A 2SRCA 1H8FA 2J5FA 3GNIB 4M13A 4QD6A 1GJOA 5CAUA 1WBOA 3LVPA 2WKMA 1A9UA 1TKIA 4NTTA 1IEPA 3T9IA 4DG2E 4IC8A 1J7UA 4EL9A 1IG1A 4OUCA 3LW0A 3L9PA 2IO6A 2G15A 3COKA 4AACA 2UW9A 3E8DA 2RKUA 4Z9LA 4Z3VA 1JKLA 3RWPA 2YDIA 3QRIA 3QZHA 2XK6A 4I3ZA 4N0SA 4TYJA 5CEQA 5HIEA 3GOKA 4L3PA 3LCOA 3ZFYA 3F5UA 3JPVA 2RL5A 3HGKA 5LCKA 2OG8A 2QI8A 3RK9A 3D2IA 3DBEA 3UTOA 2B0QA 3LJ1A 4USDA 4O6EA 1QPCA 4TYGA 5BVFA 5AUTA 5KMLA 3T3UA 4EH6A 3DBQA 3OXZA 2ITTA 4NCTC 4QP4A 3MIYA 4R7IA 1OIRA 4NWMA 3L1SA 4RJ4A 2GNIA 2W4JA 1ND4A 4FMQA 3QL8A 4KS7A 5LVOA 4U80A 4CNHA 3I5NA 3QQLA 5E91A 3QQFA 3G9NA 4FODA 3QUDA 1YDRE 5CTPA 3ZO3A 3GT8A 3OWJA 2XMYA 3P4KA 4AOTA 2WU6A 3LAUA 2C0IA 5ANDA 4FR4A 5HNIX 2XH5A 1OIYA 2F9GA 5C4LA 2G01A 4YLJA 4G5JA 2VNWA 2C0OA 3ENMA 4ZS0A 3JUHA 4IW0A 4O7TA 3CD8A 4D4YA 2IW9A 4GH2A 3SA0A 5L2TA 1ZY4A 4XV2A 5BX0A 5E4HA 2PK9A 2YLFA 3OTVA 5LMAA 3ACKA 5AV3A 4RJ7A 3Q9XA 4WNPA 2EXEA 4C0TA 4CKRA 2HELA 5GZ9A 4EKKA 2ZOQA 3KMWA 1XH6A 3COIA 4FZDB 4IAYA 4AZSA 1GOLA 4XLVA 3TM0A 4FKGA 2XK7A 2CSNA 3ZZEA 4CZYB 4RVMA 2QOCA 3CD3A 1UNHA 4M8TA 2E2BA 3QA8A 3RHXA 1G8SA 3R8LA 3SOAA 1JKTA 3PSBA 4E93A 4QMOA 4FK3A 5EW8A 1MUOA 5DT4A 2EU9A 3A8WA 3PVBA 3LFAA 4E5WA 5IA2A 2BZJA 3AC2A 4OAVB 3CXWA 4F0GA 2UZWE 3Q60A 4DFYA 3BHYA 5GNKA 4HGSA 4II5A 4I23A 3VUKA 3NW7A 2HAKA 3PIYA 3V5LA 5C1QB 5IEXA 5IKWA 4ZXTA 4L7FA 4O0VA 2CKEA 3OBGA 4FKIA 4I93A 3HUBA 4GG7A 2QLUA 5D10A 2Z02A 5AX9A 1FBNA 5JZJA 4EH5A 2VTSA 4QQ5A 4AGCA 3ORTA 4BKZA 2PZIA 2YIXA 4IAFA 3A2CA 4GUEA 2UW4A 5HD4A 2R3HA 4ENXA 5FP5A 3Q04A 5DRBA 3VAPA 4A4OA 4B8LA 1PYXA 2Z7SA 3FSKA 2WTJA 4QYGA 3EZVA 2W1GA 2ITNA 3DAKA 3LFDA 5KZ0A 3Q4TA 4GYIA 2F2UA 2YIQA 4XBUA 2R3RA 3GCPA 4FG8A 4XG3A 2WPAA 3SLSA 3RAKA 4F4PA 4G5PA 3F2RA 4H1JA 5C8KA 4QMPA 2IZUA 2CMWA 2WO6A 2W1IA 3F88A 3ZOSA 5M07A 1Z9XA 2AUHA 4FSNA 4IAIA 4FA2A 1U54B 4FGBA 4FKLA 5CAOA 2I0EA 2W4OA 2Y8OA 4ACHA 2AYPA 5HHWA 3HX4A 3WILA 4F70A 2BUJA 3OG7A 4AP7A 1WCCA 1PXMA 2OK1A 2ZV9A 3K3IA 3PZEA 4NU1A 4YO6A 5AM6A 3V3VA 3ATTA 4DAWA 5AUUA 5KMNA 3QGWA 5HVYA 4OBQA 5E8TA 4BDDA 4BTFA 3RPOA 4MXXA 3MIAA 1SVGA 5CAVA 2YCSA 4YPDA 4FV1A 4IAAA 1W0XC 1YOLA 4BI2A 4GMYA 4X2FA 4JXFA 3CE3A 4JR3A 4I21A 5B2LA 4X6QC 3E5AA 3VRZA 3QX2A 5EQPA 1SM2A 4Y72A 1H24A 1RW8A 4UY9A 4F99A 2R0UA 4OTFA 4YTCA 4TY1A 4U7ZA 3A7FA 3ET7A 2OH4A 5EYCA 1B6CB 4AFJA 4EBWA 3ANRA 4GSBA 1YRPA 2OJ9A 3D7TA 4M66A 3PIZA 2GNLA 4Y5HA 5E1SA 5ETCA 3HV6A 3ZO4A 3QUEA 4YR8A 2R3PA 2QOQA 4KBAA 4FIIA 4BZOA 4A07A 3VBWA 2YABA 3VUIA 4DG0E 5JN2A 5JFWA 4LUDA 2C6LA 4BCQA 1GIJA 4CT1A 5BUEA 1KSWA 4H36A 2B7AA 4R5SA 3R83A 3SC1A 3TIZA 3QGYA 3FWQA 3FYKX 3V5WA 4YMJA 2ZV8A 4ZJVA 4PTEA 2VWVA 2VTLA 2QD9A 1E9HA 2O3PA 4I22A 2BROA 4F0IA 3EN4A 4ZTLA 1B38A 4YU2A 3GENA 5LQFA 4OLIA 1PXLA 3P86A 2GTMA 4K6ZA 4BWXA 4L01A 3G0EA 1Q41A 3TL8A 2QCSA 5HIDA 5CNNA 4C33A 2CKQA 5DFPA 4IAKA 4FIEA 2ZYBA 3OOMA 3UOLA 4AN2A 2YHVA 5EHLA 4E5AX 1Q99A 1CSNA 4QMUA 3KXXA 1KE8A 4FIJA 3BWJA 2QU6A 4KINA 3C5UA 1BLXA 3KXMA 2HZIA 4FT5A 3DZOA 5BYZA 4ZZNA 3POOA 2OLCA 2YEXA 1XH8A 5FG8A 4R3RA 3DB8A 3A61A 5DT3A 5FEQA 3E88A 1PXNA 2FB8A 2QKWB 4UMTA 2WB8A 3KRJA 4RWIA 2GNHA 2XKDA 3D5WA 3UZPA 2ITPA 3LZBA 4A9RA 4EQMA 4HVGA 5AP5A 3TDWA 4L7SA 2V7OA 2R3NA 3UQFA 5J9ZA 4EH3A 4S33A 2C1BA 1H0VA 5KKRC 2IW6A 4PRJA 3BX5A 4KS8A 3F3TA 4I0RA 1DS5A 3E3BX 5HGIA 2YIWA 3PVGA 1OL6A 2PE1A 4ACGA 3KVWA 3QTQA 3V01A 1CDKA 4F9CA 1RQQA 2BZKB 3DXQA 4O83A 3SG8A 2ZMCA 3CR0A 5M4UA 3ZLSA 1P4OA 3BU6A 1MRUA 3UPZA 4MH7A 5M44A 2NO3A 5HBJA 2XIRA 1YXSA 3IPHA 4GFMA 2VV9A 3GXLA 1NA7A 4G34A 3COMA 4USFA 3FXZA 3O71A 3AD4A 4EUUA 4HPTE 2WQOA 4AZEA 3HV5A 2X6DA 3GFWA 2WHBA 5JH6A 3CEKA 2ITQA 3SD0A 2YISA 2J4ZA 2OXDA 5AP3A 3KGAA 3DTWA 5DHJA 3GC8A 5JGAA 4DF3A 4IWOA 4R3CA 3WE8A 1VYWA 3EN5A 3EL8A 1P14A 4UX9A 1XHAA 5EKOA 4AGDA 3JXWA 4L3LA 3G6GA 2RGPA 5K9IA 4BDJA 5FM2A 3RWQA 3HMMA 4C7TA 1OL1A 1REKA 3NUXA 3UODA 3MVLA 3UO4A 5LMBA 3F69A 2C6DA 2CLXA 3HA6A 1XBBA 4JVGA 4MXCA 4FV7A 1OZ1A 3EIDA 4DGLC 4ZJJA 1J3HA 4H58A 3TACA 1K3AA 4CZUA 3C5IA 1M2PA 4PP7A 2V22A 4E20A 2GQRA 5CU6A 1YWRA 3R2YA 4MWHA 4ZEGA 3RP9A 2YJSA 3CGOA 2J7TA 2C6EA 3CY3A 3P08A 3DKFA 4M12A 3EOCA 1AQ1A 5KHXA 2YJRA 5H8GA 3R63A 4UN0C 3AMAA 2XK4A 4PPBA 4DCAA 5J7BA 3F2AA 4RJ8A 4BHZA 1ZAOA 4WD5A 3VHEA 4NFMA 3PY3A 2BHEA 1R78A 4L42A 4QPAA 2PVLA 4DEAA 4DYMA 5DMZA 3VWAA 5F20A 3NSZA 2X7OA 2IPXA 3CBLA 4KSQA 4FL2A 2PVRA 1BUHA 4TYHA 3D2KA 4A9TA 4F7JA 2J9MA 3KRWA 5DGZA 3UNJA 4L9IA 3E8CA 3Q3BA 4GJ2A 5CYIA 2GU8A 3G90X 4EK5A 5CWZA 3DXNA 3D5VA 4X2KA 3QTSA 4G6NA 4I5MA 4RFZA 1Y8GA 2X4ZA 5H3QA 3OS3A 4Y95A 3VW6A 5FWKK 3AC4A 3OY3A 2XYUA 2JIUA 4EC9A 2XIZA 4XG7A 4BY9E 5BMSA 4UMQA 3ZZWA 4ZMEA 4JBPA 4U3ZA 5EDRA 2XS0A 4D4RA 4IMYA 5BVKA 4CFNA 5L2SA 3VS4A 1WVXA 2V5QA 2VWZA 4ANLA 4FSMA 3C0IA 3EYGA 4O7NA 4FEQA 1NVRA 5DR2A 3UDBA 3QCYA 3KEXA 4CV8A 4LOQA 4DINA 4CYJA 1H1WA 1KE5A 5IUIA 2YAAA 4V04A 2UW5A 4PV0A 2UUEA 1H1QA 5AP4A 4YZMA 4C3RA 4ANMA 2B9IA 1DAYA 4IB3A 3R9OA 4B9DA 5TKDA 5GJGA 3RNYA 1NW1A 4EOKA 3O51A 4RFMA 5HU3A 2YACA 3GCUA 3ZO1A 2C0TA 4EQCA 1YXUA 3EKKA 2I0YA 5ETFA 4RX5A 3B2TA 5IUGA 1TQIA 3ANQA 5M06A 5HIBA 4ZSEA 3IW7A 2W5HA 3HA8A 3NNUA 3BU3A 3NS9A 3QZIA 3KC3A 2O5KA 4D9UA 2CJMA 3H30A 4C4GA 3CP9A 4KBCA 3FUPA 4FZ6A 4BRXA 4FV2A 2AC5A 3WZEA 3W2SA 5HEZA 3ZUTA 5AUVA 5TE0A 3NZ0A 5CF5A 3NAYA 3FLQA 1JVPP 3IW8A 1UNGA 5E8WA 5IMEA 4BYIA 5DEWA 3COHA 5ANJA 4JR7A 3HP5A 3NUUA 3OROA 3TWJA 4M84A 3SX9A 4MHAA 3QFVA 4OTHA 5AR5A 3UIXA 4RWJA 2O63A 3E7OA 3RVGA 4ZSGA 5CF4A 4BCJA 4P2KA 3Q4CA 4M3QA 3ZONA 4ZS4A 1IR3A 2PVHA 2XRUA 4JDKA 3GCSA 3A4PA 4ZSJA 5H8BA 3OUNB 1FPUA 4S30A 3QRUA 4CD0A 4ZTNA 1BI7A 4JDJA 3FMMA 4IFCA 4PPAA 2VD5A 3MH1A 4WOVA 2FUMA 2CN8A 3IONA 5HG9A 4U8ZA 4DBNA 4YC8A 5IDNA 3JS2A 4X3FC 1Z57A 3GUBA 1T46A 4MVFA 5CEIA 4EH8A 3DS6A 3EFWA 1IA9A 2VX3A 4D55A 5L4QA 3FKOA 4MBIA 1FMKA 3TEIA 3UJGA 1A06A 4WKQA 2YIRA 4A06A 4E4XA 3EQDA 3PWDA 4WBBB 3CJGA 4C35A 2YCQA 3RCDA 3VBYA 2HZ4A 4BC6A 4EKLA 2HY81 4Z7GA 4WNKA 3LHJA 4EOOA 3R7GA 2XBAA 4QQJA 3MN3A 4YZBA 4E8AA 3QTZA 3D0EA 4YHJA 4ZY5A 5ACBC 5HNBA 3U87A 1URWA 3WIGA 2OJGA 1OBGA 3U6IA 3R22A 4GU6A 3I0QA 4E6DA 3AC1A 3QX4A 4DG3E 3FQHA 3FC1X 4CFMA 3SHEA 4HNFA 4IB0A 4IM0A 3TKHA 4BCHA 1UKHA 1W98A 2OIQA 4FK6A 4JAJA 2XJ0A 3AT4A 5BUJA 5FUTA 3NUYA 2W0JA 2FSMX 1WMKA 4FV9A 3LQ3A 3FPQA 4CG8A 4I5HA 5EOLA 3UP2A 2HCKA 3FJQE 5DIAA 4FL1A 1KOAA 5IA3A 3FLZA 5DG5A 3TG1A 3LM5A 4NZWB 4XV3A 3R9NA 3NYVA 5JQ8A 5L8KA 3FMJA 4DA5A 4FTKA 4XBRA 1FVRA 3ORXA 2YZAA 4YZ9A 4S2ZA 3EZRA 2BRNA 1H1SA 4M69B 4ITHA 4NH1A 5FXQA 4EH2A 2RFEA 3W10A 4BDFA 4XMOA 2IZTA 4NYEA 1QPDA 3VUDA 2B1PA 1L8TA 3M1SA 4DFXE 3O17A 4F6SA 3PE1A 4EWHA 3VUMA 4MXYA 1P4FA 1M2QA 4QP8A 1UWJA 1U5QA 2KTYA 2JKKA 1KUTA 4EC8A 3LIJA 3FZ1A 4G3DA 4JG8A 3UP7A 3A60A 5HICA 5FXRA 3POZA 5F9EA 3DAEA 4C61A 3QD2B 3EHAA 4YNEA 4D2TA 3A7HA 2CPKE 3WF7A 4C4EA 3H3CA 5AFVA 5GJFA 3U9NA 3AC8A 1Q3DA 1PXOA 1UNLA 3GQLA 2FYSA 5JMSA 1CKJA 3R8ZA 4DT8A 3L8PA 3Q52A 1ZOEA 3NNXA 4FICA 4IM2A 2YM6A 2BIKB 3GC7A 3A7GA 3A7JA 2BHHA 4QMWA 3SRVA 3TV6A 5C01A 4R77A 2LGCA 4HGLA 2C5XA 3HUCA 5ANOA 2VWUA 2X81A 4PL5A 2C47A 2YAKA 3HRBA 3N51A 5AIKA 4UXLA 4DCEA 2JKQA 5F1ZA 3MA6A 4RVLA 5BPYA 3P7AA 5TO8A 4O7RA 2G2FA 4CQEA 3CKXA 4F1MA 5A14A 4QMMA 4HZRA 3LFEA 4BWPA 1ZY5A 3E7VA 4AX8A 4D2RA 4FV6A 5C8MA 5EI2A 3EFLA 4DEDA 2H96A 3MB7A 4UZHA 5ANGA 2HWOA 2JBPA 1H25A 4IADA 4QPMA 4ZP5A 5AR8A 5CU3A 5I3OA 4DEBA 2R3IA 3IG7A 4WBOA 5BMMA 4FIHA 4XG6A 4WUAA 5IEVA 4EONA 2YCRA 4F9AA 4ZSLA 3F7WA 4G2FA 4EJ7A 1YHVA 4IM3A 4PDSA 3FZPA 1XH5A 4IB1A 5BUIA 4G17A 4J7BA 5FBOA 4EK6A 4QTCA 2ETKA 1BKXA 5FP6A 4DLIA 2OFUA 4MNFA 2V0DA 3NUSA 3KQ7A 2IZRA 4RJ3A 3QQGA 3RPYA 3V8SA 1KV2A 4EK8A 3U4UA 2CKPA 3WARA 3H4JA 3H9FA 4HYUA 4ANOA 1OL5A 4CZTA 3UC3A 2QKRA 4G3FA 5GZAA 4B0GA 1RDQE 4PDPA 2WTCA 3BGPA 2WTVA 3UMXA 1XBCA 1XH4A 3T8OA 2Z7RA 3MDYA 4DFBA 2ITZA 4L6QA 2JDVA 2X7FA 4OBPA 4QYEA 2JEDA 4D2SA 5LVPA 2WZJA 2XJ2A 4FL3A 3THBA 3WF9A 5IQFA 3JY9A 4G31A 3VUHA 2PUNA 4EEVA 4FSZA 2PMNX 4MF0A 2ZMDA 3PP1A 4LFIA 4RIYA 4YJVA 3A7IA 4IBMA 3TXOA 3U54A 4C4JA 1KV1A 2C6IA 3C4WA 2PMIA 3G0FA 1OGUA 4P90A 2EVAA 4BKYA 2XM8A 3Q6WA 3TZ8A 1IA8A 2QOHA 4M97A 2J6MA 3IGOA 4RT7A 4GL9A 2R9SA 3UVRA 3K54A 2IVVA 3EQFA 5EDQA 4DLJA 2WMXA 2B53A 4X0MA 3NNVA 1V0OA 3BRBA 4K9YA 2WFYA 4FOCA 4APCA 3PFQA 4QP3A 5LJJA 4IZ5A 4O7WA 3V8TA 3FZSA 3LLTA 4RX8A 3GP0A 2WQMA 5AADA 1OKWA 3MH3A 4AW1A 3IDBA 1JKSA 2O2UA 3ID6C 5K3YA 4TL0A 1JKKA 4FTNA 5EM8A 2H6DA 2VRXA 2JIIA 2VTOA 5IA5A 5HX8A 3CSVA 5EQEA 2OW3A 3JYAA 2HOGA 3ZS5A 5HTBA 4I6HA 3ALOA 3QYWA 2QLQA 1JAMA 3TNIA 3FBVA 4CYIA 4RBLA 4A4XA 2WOUA 3GB2A 4MCVA 5D41A 3TNPC 5CT0A 4F7SA 1OBDA 4GIIA 5HVJA 5TR6A 4HGTA 1OIUA 5I9YA 3SW7A 3FI2A 4CGAA 2J0JA 3A4OX 3DLSA 5AIRA 5AV1A 3ZFXA 4HGEA 4F09A 4XHKB 4KNBA 3RNIA 4GS6A 2VWBA 4PF4A 2OBJA 4I0TA 3P1AA 3ITZA 5ICPA 1UU3A 4FEWA 5DBXA 4O7ZA 4L8MA 2UVYA 4HOKA 3PA4A 5BVEA 2WMUA 5BVOA 3NCZA 3R0TA 5FTOA 3QHRA 3C0GA 1PHKA 3FSFA 5CVGA 5JSMA 3FY2A 4BDCA 4EOQA 1NXKA 3GU6A 3VW8A 4IIRA 2YDJA 4FUYA 1UA2A 3MV5A 3QRTA 3TZMA 4HVSA 4C4HA 2BAJA 1UU8A 2X2KA 4KKGA 3E93A 2W1EA 4FVQA 4RMZA 2ERKA 5AP0A 3ZBFA 3IW4A 2WOTA 4AA4A 5K5XA 2VTMA 1ZARA 5HO8A 2PL0A 4I4FA 4FX3A 4BCNA 4IAZA 2XP2A 4RX7A 5JFXA 3I6WA 3EMGA 5LVMA 2ZJWA 2DYLA 4IVBA 5IA1A 4XS2A 2VWIA 1M7NA 4F9BA 3C0HA 4FSRA 4R7BA 4IE9A 3ZLWA 4NEUA 1J7LA 1JWHA 4GKHA 3DBFA 3ZBXA 3QC4A 3ZC5A 2QODA 2J90A 3PJ8A 3VIDA 1ZXEA 3DKOA 3NW5A 1YXTA 3V8WA 4FEUA 4A7CA 2F7XE 3RM7A 3IECA 5T68A 4DEHA 3GGFA 1JBPE 3O8TA 3OHTA 4LMNA 3R02A 3HDMA 4M7IA 4EK3A 2QG5A 3F82A 3O7LB 3OY1A 3R73A 4MXZA 4JRVA 3LMGA 4U45A 5CY3A 2OJJA 4BGHA 1YHSA 3OZ6A 4HCVA 4L52A 2PY3A 5AUZA 4BDEA 5M09A 2IW8A 4M68A 4YJOA 2ITWA 2VTHA 2OF2A 3A62A 4FT7A 4HCTA 4KIQA 1S9IA 4NFNA 4P5ZA 2H8HA 4YLKA 3OFMA 4KKEA 3KN6A 4LOOA 4RIOA 4JX3A 3DAJA 5IQBA 3VJNA 4QOXA 4EI4A 3O8UA 3GI3A 2YWVA 4HYSA 4QMLA 3UIUA 3TZ9A 3R21A 3CKWA 3MJ1A 2VTJA 4FC0A 4NIFB 2OFVA 2PZYA 1K2PA 2OIDA 3P7CA 5HE2A 2C69A 5FD2A 3CS9A 3AC3A 3NYNA 5I9WA 4RIWA 3MPTA 2WEIA 2YCFA 1BYGA 3QALE 5CNOA 5D11A 5G6VA 5AEPA 5M08A 3UOJA 3IW6A 3DLZA 1WBVA 4MX9A 5EM6A 4HVIA 4OTPA 2C5NA 2YA9A 2C6TA 3R1QA 3D4QA 4C3FA 4LGDA 5CASA 4BHNA 5AAGA 3K2LA 4JL9A 2X9FA 4TTHB 2JC6A 4BTKA 4DN5A 5EQYA 1SVHA 4Q9SA 3UO5A 3TV4A 3TKIA 2LAVA 5AUXA 4WUNA 3ZM9A 4KBKA 4FT0A 4BTJA 2JDOA 4RFYA 1PRYA 4E1ZA 4DT9A 3O8PA 2QOIA 4KD1A 4X3FB 3RAIA 2RG5A 3MFRA 4RQVA 4TYHB 4UZDA 3U51A 4EYJA 4HVHA 3N4TA 5H9BA 4OTGA 4TYIA 4U41A 1E1XA 3B2WA 4MQ2A 3DB6A 4K18A 4NIFA 4JQ8A 3FHIA 5HKMA 1YW2A 4PY1A 3S0OA 3D94A 3R9HA 1IAJA 5C8NA 2I0VA 4FG7A 3WF8A 2BZIB 1ZOHA 5CVHA 4E3CA 5AX3A 5IU2A 3U6JA 4O7LA 3NNWA 1NY3A 3EKNA 3JVSA 4YZNA 3QQUA 3A99A 3UBDA 2HXLA 2WTKC 4Q9ZA 3LKMA 4FNXA 1M52A 4IX6A 2ONLA 4PQNA 3PXYA 3RALA 4L53A 1ZYLA 3F3VA 2J2IB 3KVXA 4W4WA 5CANA 2R3FA 4Z7HA 5T3QA 1ZRZA 5EHYA 1ZYCA 4QP2A 4UXQA 4DE4A 4MYGA 3GFEA 3BHUA 3BV2A 4AZTA 3W2QA 4C36A 3NAXA 4BICA 1Q24A 1QMZA 4YHTA 3UNKA 4MD9E 1OI9A 2B9JA 4I0SA 3F61A 4QP9A 4R7HA 5E1EA 4AU8A 1H1PA 2ZB0A 4GCJA 3VF9A 3LM0A 4IANA 2GHMA 2X8EA 3GEQA 3QCXA 2C30A 4PX6A 1Q8YA 4WSQA 4PDOA 4EHEA 2I6LA 2REIA 4BB4A 1YDSE 2ZAZA 3EQHA 4G6OA 5HX6A 4MTAA 3LMIA 3OEFX 2Z7QA 4LL5A 4M0YA 2X6EA 4EH7A 5B7VA 5EKNA 2VO3A 5EOBA 3EQCA 3HL7A 1CM8A 1VYZA 3MPAA 5BVNA 4ITJA 5CXZA 1V0PA 2CLQA 3LLAA 2VU3A 3S4QA 3ETAA 5AV0A 3L9LA 2J0LA 3SDJA 4R8QA 1L3RE 3RPRA 1I09A 2GQGA 4ITIA 3VS7A 1J1BA 1M2RA 4FZFB 2W5AA 3D14A 4V05A 2NRYA 1H08A 3G6HA 5K4JA 4NSTA 1H00A 3C4ZA 2HZNA 5AWMA 5EYDA 3F2NA 1TQPA 3UG2A 4O27B 3AMYA 4RIXA 4EORA 2UZEA 3ZUVA 3LCTA 2PU8A 3C9WA 2XM9A 4WIHA 5EW9A 2XZSA 2R3MA 4J53A 4AG8A 5CT7A 4QTEA 1OMWA 3AOXA 5FDPA 3EYHA 1OITA 3C4FA 3B8QA 3RBWA 3Q9ZA 3BIZA 3UG1A 5K4IA 3H10A 5B2MA 4OAUC 4Q5HA 4KABA 4YZDA 3BBTB 4B99A 4FKTA 2WMTA 2PWLA 1PXPA 5DNRA 5KUPA 2CNVA 2PUIA 3P7BA 2IVSA 3TJCA 3Q6UA 2VWXA 3FL5A 3NW6A 2KULA 4QO9A 3SV0A 3V5PA 2FSLX 3BHHA 3FLSA 3LFSA 4UWBA 4EH9A 2QNJA 2OJIA 4TZRA 4EHZA 4D1XA 3UO6A 1FMOE 5CQUA 4TW9A 4O96A 1XWSA 1PYEA 1ZZLA 3DNEA 4CKJA 3BEGA 2PUUA 2WTWA 4W8EA 4CMOA 5ANIA 1T45A 5IH4A 4N70A 3CC6A 4GKIA 3WZKA 3PG3A 2VWYA 4GW8A 2OZAB 3LE6A 5F94A 5KBRA 3BYMA 4C38A 4HNIA 3FQSA 4LYNA 5HG8A 4MBJA 4FZ7A 2RFSA 5CZHA 4FTIA 4DEGA 3QQJA 2GTNA 3HP2A 3GU7A 4ZTMA 5L6WL 1STCE 1J7IA 3Q32A 4I24A 3W33A 2PVMA 3D7ZA 4IWQA 1AGWA 3W18A 4MQ1A 2RG6A 3Q5IA 1F3MC 4AWIA 1U4DA 2Q83A 3ENHA 2HYYA 5BNJA 2J0IA 2PMOX 1V1KA 4TKSA 5C26A 3O23A 2BKZA 4J96A 4D0WA 3E64A 4RJ5A 3VVHA 3MTFA 3ZC6A 3PXZA 3GU4A 5L2IA 3I4BA 1GIIA 1OB3A 3IGGA 4JIKA 5CSWA 4AUAA 2A4LA 2H34A 2CNUA 1JLUE 3BGZA 4I20A 4O1PA 3VRYA 5LMKA 4TYEA 2YZLA 4NKSA 2NPQA 5E8VA 5F95A 4CLIA 3BQCA 2O8YA 3OF0A 4FYOA 4IFGA 1XR1A 2XIKA 4PNIA 3NYXA 5BYYA 3Q4ZA 4I6FA 2IWIA 3E87A 4JX7A 1WAKA 3QC9A 4FV8A 4O21A 5FQDC 3S2PA 5HTCA 5AMNA 3ZDIA 3ZYAA 4CFUA 4EOJA 4C4FA 1H1RA 4PMTA 3NDMA 3JY0A 4RLKA 2XNBA 2OZAA 3ROCA 3D83A 4N6YA 4DGGA 1VJYA 3NLBA 2OICA 2E9OA 3FKLA 4IJ9A 5A46A 4BIBA 5K0XA 4BCPA 4FBXA 5I9VA 4FIGA 2C68A 3R1NA 3IDCA 4NK9A 4U5JA 4I5CA 5M4CA 5LOHA 4QRCA 4TNDA 4XOZA 4FVRA 4IQ6A 5AP7A 4XG2A 3W2OA 2C3LA 4CSVA 4B8MA 3DKGA 3R7VA 3ZXZA 5J87A 3RHKA 2FO0A 4E6AA 3PA3A 2BTSA 5HZNA 4MXAA 2PHKA 1ZWSA 5L8JA 1ZMWA 2QONA 3MH2A 2QVSE 3G51A 4UYNA 4OGRA 4WNMA 3DK7A 5HLNA 3AT3A 2BILB 4LV5A 2PZPA 4RC2A 5HCZA 3TIYA 5E8ZA 4HVDA 4IX5A 3ZO2A 1H26A 4AW0A 3PYYA 3UVQA 5LXMA 2PUPA 3QTIA 3EWHA 4DGOA 1LEZA 4YURA 5HTIA 2DQ7X 2OO8X 3ORKA 5KMOA 1KOBA 4IX4A 2C5OA 3LQ8A 5J5SA 2P4IA 3SAYA 5E9EA 2DUVA 4IHPA 2BDWA 5FM3A 3PJ3A 3VJOA 4JI9A 2RFNA 3PZHA 3PE2A 3TCPA 3QLGA 3TJDA 4BGQA 4D0XA 1LP4A 4BCFA 3NUNA 3PXFA 5IA0A 4O7YA 5M51A 3AGLA 3G2FA 3QKMA 4C8BA 5DH3A 2ZB1A 1VZOA 1Y6AA 4YSJA 3UMWA 4H3BA 4XX9A 3OUKA 4J52A 3DK3A 2J0MB 4GFOA 1ATPE 4I92A 4DGMA 5KCVA 4JLCA 5E8SA 3L9MA 3DJ6A 2XBJA 5JZNA 4AN3A 4C2VA 4C59A 4CRSA 5KX8A 5LWNA 4RVTA 2QO9A 3P78A 4OT5A 2ITXA 1URCA 4LG4A 4TT7A 4YP8A 4C4IA 3PSCA 4I41A 5FGKA 2W4KA 1JPAA 4WHZA 5HG5A 1HCKA 4X2JA 4O22A 3DCVA 3TNQB 1RJBA 3PPJA 3QQKA 1J91A 1XBAA 5LWMA 3DXPA 3R28A 4QMTA 3R01A 4AZWA 3WYYA 4E26A 2W1HA 1ZYDA 3OEZA 4GRBA 2GQSA 5DEYA 2ONLC 2B9FA 5CENA 3LCDA 4BZDA 2C4GA 3G9LX 2UZNA 2WMWA 5KMKA 5FEEA 2OI4X 4FEXA 2JFLA 1OKYA 1BL6A 3NGAA 4RZVA 4YJQA 4AA0A 3S00A 5EI8A 4WRSA 3TZ7A 4EWQA 5KHWA 3SGCA 3K5VA 4EUTA 1BMKA 4H3QA 4D1ZA 3E92A 4UWYA 4HZSA 3QTXA 3QD0A 3DQXA 5CSXA 4DFLA 5KO1A 3MWUA 2PE0A 3DY7A 2XCHA 3BZ3A 3HEGA 3LFCA 4FTRA 5J1WA 4PMPA 3HKOA 1OUKA 4GIHA 4ASDA 4RIYB 4CG9A 5E8XA 1U5RA 4GFGA 2WIHA 4EH4A 4RC4A 1SYKA 3RK5A 3KRLA 1PXKA 3W8QA 4BDAA 2ESMA 3OWLA 4UMPA 2UW0A 4IH8A 4RC3A 4ZLOA 4ZLZA 5JQ5A 1E1VA 4L44A 3I81A 1YI3A 5C9CA 2HENA 2YLEA 4D58A 1PF8A 2WGJA 5IQIA 2P2HA 4NM7A 3UZTA 3UYSA 3KXHA 4IZYA 4CV9A 3EN7A 3DJ5A 3PXKA 4JIAA 4O0SA 2VGOA 2WQNA 4GEOA 4HYHA 1UWHA 4N57A 3SG9A 3H0YA 2OXYA 3V04A 3ELJA 4IVCA 4ZY4A 2VTRA 2AC3A 4JAIA 2C1AA 3FMHA 3LXPA 2BPMA 3F7ZA 2VWWA 4D4VA 5A9UA 4S34A 2YERA 4F9YA 1YWVA 4MD8E 3E63A 4XEYA 2A2AA 3HNGA 3LPBA 3ZDUA 3PVWA 1APME 2DS1A 2W1CA 3OP5A 5IZFA 4CTCA 4FSYA 4XG9A 1IRKA 1ZOGA 1MRYA 1JNKA 2XK3A 4FTOA 4GT4A 3FC2A 3RAHA 3M11A 5IQGA 2ZM3A 4YC6A 5A4EA 2ZVAA 4ACDA 4LQMA 2ETRA 3L8XA 4BDKA 4LRMA 5CSPA 2J0KA 5DR9A 3VC4A 2X0GA 2X8DA 3OVVA 4FNWA 5E8YA 3KK8A 2X9EA 1J1CA 4XOYA 3ROYA 2OH0E 2R3OA 1Y91A 5HE0A 3L8SA 4ANBA 4DBXA 3HMPA 4K1BA 1S9JA 2BFXA 3FXXA 3NYOA 4Y46A 3JR1A 4FKWA 3CTJA 2PZ5A 1OVEA 3ACJA 5AAEA 5D12A 5DYJA 2V55A 2FSOX 3GVUA 2BCJA 2QG7A 4RVKA 3D15A 4O7SA 4ZIMA 2J50A 2XKFA 3QTUA 4YNOA 5L8LA 1JSVA 2UW7A 1Q3WA 3NIEA 2GDOA 5AUWA 2PULA 2GFSA 1MP8A 3HV3A 3R1SA 3UOHA 1W83A 5AR2A 2BRMA 3FMLA 3S95A 3QU0A 2JAMA 2YN8A 3QKLA 2QC6A 4U79A 4K8AA 4W4XA 3R7YA 4C02A 4NTSA 3P23A 5I3RA 3FZRA 4LUEA 2VGPA 4NW6A 2HXQA 4I6BA 3PLAE 3AD5A 3I6UA 3ZEWA 2BTRA 4NW5A 5HESA 5IISA 1I44A 2QHNA 3E8EA 3H9RA 4FV5A 3KXNA 5IEYA 3BWFA 1DI8A 3FL4A 5CU4A 2YIYA 3BU5A 5I9ZA 3VBQA 5K0KA 5BVDA 4DH3A 2WNTA 3PPZA 4UMRA 2P3GX 5I9XA 2GNJA 3KXZA 2WELA 4DH7A 2QR8A 2CCIA 2Y6MA 3P9JA 4FTCA 1WBWA 1GIHA 1TQMA 3HZTA 4O0UA 4U43A 4CQGA 3ZXTA 3TDVA 3HDNA 1YDTE 4FKSA 4QMSA 4F1OA 5J5TA 4FNYA 3CPBA 5A54A 1XH7A 4F6WA 2F7EE 4U97A 3ZRKA 5CEMA 4JG6A 2WQEA 4QMNA 2PVKA 3IOPA 1U46A 4UBAA 3V5TA 2BR1A 5ACKA 3AMBA 4ONAA 3OT3A 3R7EA 3BYSA 2Y6OA 5BVWA 2PTKA 4NM0A 5KZIA 4YTIA 2ZM4A 4OTDA 4BIDA 4AOJA 3UYTA 3G33A 4X7QA 3FMNA 4FE2A 3B8RA 3C4CA 3BHTA 5H8EA 1Y6BA 2ACXA 4UEUA 3EQRA 4TRLA 4YTFA 1WBSA 5HBEA 3GBZA 1WVYA 5LARA 4FTTA 5HCYA 3LQ5A 3C50A 3H9OA 3ULIA 4LV8A 4BFMA 1MQBA 4ZTSA 2BIYA 4DH5A 4FKVA 4IDVA 4APPA 1Q8WA 2J51A 3EQIA 2UZTA 5EDPA 3Q9YA 4NKAA 3ZH8A 4FG9A 4ALUA 2C5VA 1YWNA 4Y73A 3Q53A 5J9YA 1G5SA 4PDYA 1JQHA 4ZZOA 2VO7A 4QMVA 5JRSA 4E4NA 1K9AA 2QURA 1G3NA 4HYIA 4XUFA 3TNHA 3VHKA 2HW6A 2O64A 4XV1A 4DITA 3EQBA 4LMUA 3PVUA 4RA5A 2IN6A 3P79A 3NUAA 2BFYA 3CQWA 4M0ZA 4AXAA 1DAWA 4JDIA 4R1VA 5A4TA 4PWNA 2NP8A 1Z5MA 4P5QA 4FNZA 2VNYA 5JGBA 4YBKA 4E7WA 5ETAA 4ANQA 3NVMB 4FGRA 4M67A 5LVLA 2OF4A 4FKQA 4BGGA 2E9PA 3PY0A 3ATSA 3KRRA 2WTDA 4FV4A 4W4YA 3MVMA 3BCEA 4NM3A 2ZDUA 4ID7A 3W1FA 3QRJA 4LI5A 5GZ8A 4U9AA 1PJKA 5GHVA 1OM1A 4QQTA 4IWDA 4CVAA 2JKMA 5KMIA 1VEBA 1WBPA 4QYFA 3R8VA 1OPLA 4GG5A 3CPCA 5DLSA 3I7BA 3RTPA 2GPHA 3NIZA 4ZAUA 4NL0A 3T3VA 3F5XA 4YJPA 3TUBA 4JRNA 5EM5A 4F63A 1Q4LA 1UVRA 4AZFA 3C13A 4F0FA 4QNYA 3KKVA 4DFNA 3N4UA 3K3JA 4BKJA 3ZTXA 2BRBA 2G2IA 2OJFE 5FXSA 2JAVA 4A4LA 5CAPA 5FLFA 2OXXA 3ZHPC 4ZJIA 4QMYA 1FINA 4AOIA 2W17A 3QRKA 4D2VA 5FEDA 2XK9A 4V0GA 2JLDA 4EHVA 2VN9A 3FPMA 5C03A 1XH9A 4UMUA 2XKCA 2EWAA 1SNUA 1KE7A 4FV3A 3LCSA 4ANNA 4FKOA 1UU9A 4JS8A 4EOSA 3FMKA 4TNBA 4J97A 4QT1A 5FRIA 4RRVA 2OGVA 2JBOA 3R7IA 2G1TA 1UKIA 3VUGA 5AP1A 3ZM4A 4JBQA 2YFXA 2EXCX 5J9LA 3WI6A 5LMKC 4BZNA 3D7TB 4KSPA 3HMOA 2RF9A 2OU7A 2UZUE 4PP9A 4ZOGA 3UNZA 4BL1A 4YJSA 2BZHB 3CGFA 5FTGA 3QF9A 1H0WA 1YKRA 4GT3A 4PNKA 5KKRB 2DWBA 5GJDA 3P0MA 3ULZA 4TWOA 3CTQA 2F2CB 2P0CA 3IW5A 4IVAA 5DA3A 4CMUA 1ZMUA 2XUUA 4JBOA 2C3JA 4WNOA 4AZVA 2B55A 1H01A 4DGNA 2PVYA 4XP2A 3FKNA 2X2MA 3RZFA 3MVHA 1GZKA 4XCUA 5J8IA 1P2AA 3LJ2A 5EM7A 3N4VA 4C37A 4XRJA 2BVAA 4UALA 4CXAA 2CHLA 2CCHA 2VTAA 4IB5A 4MXOA 4B6LA 3CY2A 3EQGA 1FVVA 2R3KA 3KF4A 3OCSA 2RFDA 4EJNA 2E9VA 3KXGA 2VTTA 3DPKA 3QZFA 4XJ0A 4YBJA 3MSSA 5KE0A 3FEGA 4WT6A 2WMBA 2P33A 4KIKA 3QBNA 3KMMA 4XG8A 5JRQA 2WQBA 2R3GA 1OIQA 2P2IA 3AXWA 4PMMA 2XB7A 3RAWA 3QWJA 3MBLA 4FKRA 3HAMA 3LXKA 4XP3A 4FKJA 3FI8A 2QOBA 3ORZA 3DTCA 3P5KA 2XRWA 1YXXA 3R2BA 2XNPA 3PTGA 3QYZA 4W9XA 3UVPA 5AR4A 1M14A 4HJOA 3VULA 3QWKA 4OTRA 1LR4A 3QTRA 3UE4A 1HCLA 3KMUA 2NNWB 5IG1A 3BGQA 3PXQA 3AG9A 1KE9A 3AT2A 3GCQA 4TWPA 3VS6A 5AAFA 4YC3A 2WMSA 3KRXA 3QCQA 3FYJX 4YGAA 5CALA 4BR3A 2XNMA 4ZTRA 3WBLA 5IUHA 1O6LA 1ZMVA 2OWBA 3R04A 5AR3A 2IG7A 3MESA 4EZ3A 4ACCA 1ERKA 5JK3A 3R8PA 4KAOA 5ANKA 3BBWA 4E5BA 4RIWB 3GCVA 3ZCLA 2FH9A 4R5YA 1Q8UA 3RPVA 3SOCA 2C5YA 3WF6A 5CEOA 2HK5A 5E92A 2UZLA 3KA0A 3KCKA 5HLPA 3R9DA 4EZ5A 4DTAA 1ZLTA 3TTIA 3KY2A 3UGCA 4CCUA 4FT3A 5CXHA 3F5GA 5BQ0A 4A9YA 3NR9A 3VS1A 1DI9A 2Q0BA 3DFCB 1H28A 3BYUA 4BI0A 4E6QA 3PA5A 3PPKA 1YOJA 4KKHA 2QOLA 2YWPA 4KIOA 5IQCA 3FMEA 2W1ZA 1KWPA 5IA4A 1O9UA 3IDPA 3OMVA 1LPUA 4DEIA 4DTKA 4Z55A 4MNEB 3SKCA 4O7VA 2Z60A 3V6SA 5KMMA 4I4EA 2W1FA 3CIKA 4TXCA 3MI9A 2GHGA 4EOPA 3REPA 4XH6A 4S32A 3LXNA 2XIYA 5BYLA 3I79A 3ZRMA 3PRFA 4RWLA 1DM2A 4KRDA 2WXVA 2BRGA 4F65A 1REJA 5AM7A 3AC5A 2UVXA 4C2WA 4MAOA 1KE6A 4F1TA 4L67A 3PY1A 1QCFA 5EYKA 5LCJA 3KL8A 4LGGA 5J95A 2XVDA 4PUZA 4CLJA 4R6VA 3V5JA 1AD5A 1JSUA 5JFSA 2NRUA 3R9RA 3EH9A 5EW3A 1YOMA 2VTIA 3I1AA 4QYHA 2OSCA 3CTHA 4MBLA 5CI7A 4G1WA 3C1XA 5AUYA 3NEWA 3FLYA 4ORKA 2A27A 2YITA 4FYNA 2R64A 4NM5A 4AE9A 1XKKA 1MQ4A 5IDPA 3ORNA 2W9ZB 4AF3A 4CT2A 4O91A 4WRGA 3UIBA 2Y7JA 4L68A 3QZGA 5AP6A 2JDRA 5E8UA 1LEWA 2UZVA 4TN6A 3II5A 4BCKA 3PXRA 5HG7A 3MW1A 5A4QA 1OUYA 3QD3A 2UZBA 2WU7A 4QNAA 5IQDA 4G3EA 3NPCA 4JOAA 4G9CA 4K11A 5J1VA 4Q2AA 5K5NA 4JJRA 4GK4A 2IZSA 3KREA 3I60A 4CFVA 5AV2A 3QUPA 3VO3A 4V01A 3RK7A 4CFFA 4CMTA 4R78A 3I5ZA 4EQUA 3DZQA 1QPEA 3HLLA 4U40A 2WMRA 2YM3A 5DPVA 1FGKA 3O50A 2R3LA 3WOWA 3HYHA 3V5QA 1P5EA 5L2WA 5IQAA 4XP0A 5DR6A 3OT8A 1ZYJA 3VF8A 4AGWA 5JFVA 2XNNA 4XLIA 4RZWA 5DOSA 3OC1A 3ZMMA 3ORMA 5HCXA 5DN3A 2HW7A 1G8AA 1UU7A 5C4KA 3FXWA 4B7TA 5GIPE 3PRIA 4H1MA 3Q2JA 3PJ2A 2BAKA 5EHOA 5AP2A 1NVSA 3PWYA 2VX0A 4FVPA 3BYOA 2CGWA 3ZFMA 3Q2MA 4F7NA 2XEYA 3DNDA 4ZTHA 4OW8A 4ERWA 5I0BA 2Z7LA 3QHWA 3E8NA 3O7LD 4AFEA 4E73A 5KNJA 3HVCA 5KBQA 3R1YA 4I5PA 4BBMA 4MWIA 1YXVA 3BI6A 3MTLA 3L8VA 5J79A 2GHLA 4MKCA 3VS2A 4AGUA 2XA4A 4J8MA 3I7CA 5CAQA 1YHWA 3MFUA 4QPSA 1GZ8A 2C6OA 4RJ6A 4LRKA 4TWNA 3BEAA 3VBTA 4BDIA 3KCFA 5M4FA 2ZDTA 3N9XA 3QCSA 5GIOE 2ZM1A 3FHRA 4G9RA 4K77A 5DVRA 2BKKA 2QHMA 4FOBA 4XRLA 1ZZ2A 4DC2A 3GOPA 5J7HA 3DDQA 2F7ZE 4GK2A 4G16A 4P4CA 3FI3A 2CKOA 2UV2A 1JOWB 2PYWA 3PP0A 3OOGA 3OW3A 4IZAA 2JKOA 5HQ0A 2RSVA 2XNOA 2BDJA 5HLWA 2QR7A 1HOWA 2VTQA 3NRMA 3VQUA 4BCMA 2J5EA 3LXLA 3VBVA 3EQPA 2VAGA 5G1XA 2QU5A 2HWPA 2JDTA 3PDTA 4ZMFA 3ORPA 3NWWA 5DWRA 4K33A 1XQZA 3SXFA 4ASZA 2X4FA 3QAME 2QOOA 4EBVA 4PTGA 4YZCA 4IEBA 1OKVA 4W4VA 4BDBA 5JT2A 4W9WA 2JD5A 2A0CX 2JIVA 4DH8A 4FF8A 1BI8A 4GYGA 2PVFA 1V0BA 3PJ1A 5DE2A 3MB6A 5T6KA 2WAJA 3KK9A 4U3YA 3LCKA 4H05A 2ITOA 2W99B 2E9NA 2EUFB 5HE3A 3UQGA 4BCIA 4BI1A 3PJCA 4BVUA 5I4NA 2W1DA 4YHFA 1JSTA 1W8CA 2ZV7A 3MH0A 4X2GA 4DHFA 4KA3A 1GNGA 3DT1A 3OTUA 4O0YA 4D2WA 3VQHA 4F64A 4GT5A 3KB7A 5TT7A 1VR2A 2W96B 5ITAA 4AW2A 3BHVA 3VS5A 4ZTQA 4JDHA 3VNTA 5CF6A 1GZNA 2IJMA 1BL7A 3GU8A 5C27A 4KRCA 4BIEA 5JGDA 3OW4A 1WBTA 4FTUA 1RE8A 5L2QA 3W2CA 2QOKA 2UZOA 4HCUA 5HU9A 3UZRA 4ZSAA 3PSDA 3GC9A 2Y0AA 2JFMA 3BELA 3C4EA 4CKIA 3ZLXA 5HOAA 3ZU7A 5AA8A 5CX9A 1OL2A 2EB3A 4D2PA 2C3KA 4QP7A 4YJTA 2BMCA 4Q5EA 3EN9A 2QO2A 4WO5A 2B52A 3OWKA 4UV0A 1A48A 2QO7A 3W32A 1FVTA 3GC0A 4S31A 4O2PA 3OXTA 4L46A 3BQRA 3ORIA 3HRFA 3VN9A 3F3ZA 3ZLYA 5DRDA 4O6LA 4ASXA 5KMJA 3IK3A 3T9TA 3F3UA 3HMIA 1UV5A 3DBCA 3RZBA 3FQEA 3R7OA 1SVEA 3MY1A 4O2ZA 1PW2A 4QMZA 2P55A 1PKDA 4MEDA 4UB7A 5CF8A 4AT5A 4KIPA 4WA9A 4BDGA 4PL3A 3DKCA 4D28A 3M42A 2FA2A 2W7XA 1SMHA 1R39A 3TN8A 4XYFA 1PKGA 4D1SA 1F5QA 3S1HA 3OCBA 2O0UA 3V51A 4CTBA 3WYXA 2XJ1A 4FSUA 2UVZA 4QTDA 3O2MA 3TUCA 5AV4A 3F5PA 3OD6X 4XV9A 2W5BA 4JBVA 2GS6A 2QOFA 3BLQA 1QL6A 3EFKA 4RWKA 5DT0A 4CRLA 1H4LA 3MS9A 3RINA 3QLFA 4OTIA 4LGHA 4M14A 5IH5A 3FMDA 2X1NA 4J99A 5FBNC 4IACA 5JEBA 2Z8CA 3HV7A 2O65A 4L3JA 4X6RA 3KULB 4G6LA 2R5TA 2WTKB 2VX1A 1CMKE 4I94A 5B2KA 3F9NA 2YDKA 4IX3A 5CI6A 3FAAA 3OCGA 3S3IA 4KWPA 4IJPA 1X8BA 4QQCA 3R00A 3WZJA 4NJDA 3G5DA 3FZTA 1TVOA 2C6MA 4MK0A 2I0HA 3EFJA 4J8NA 4AT3A 4D5HA 5IH6A 3CLYA 3DA6A 5FTQA 5CEPA 4O86A 2JITA 1U54A 3DOGA 2R0IA 2ITYA 2RIOA 3MJ2A 1IAHA 2XYNA 1R3CA 4CEGA 2VO6A 4I6QA 4O0WA 4YJRA 1GAGA 4O84A 2F49A 1Y57A 3W2RA 3R7UA 3AGMA 4FTMA 4G3GA 4OTWA 2EB2A 4DH1A 3AD6A 2ETMA 4ASEA 2YM4A 3TNWA 3DQWA 2A1AB 4GV1A 2B9HA 2R2PA 4RPVA 4Y83A 2GSFA 2Q0NA 3Q5ZA 3MYGA 3MY0A 3DFAA 5M57A 1CKPA 4FSTA 3I0OA 3LFNA 1NT2A 4U6RA 5L6PA 2IVTA 4A9UA 4RLLA 2CGUA 2X7GA 3MFTA 2G9XA 5HNGA 4D5KA 3MPMA 4JQ7A 4DTBA 5HE1A 3IS5A 3EN6A 5CSHA 3WZDA 1FGIA 3KFAA 2ITUA 3Q9WA 3SW4A 4CCBA 2R3QA 5HO7A 4P7EA 5CSVA 3E3PA 3ZUUA 4Y5QA 5JKGA 2VTNA 5IF1A 4DEEA 3C7QA 4X2NA 3QXOA 2UZDA 4EYMA 4EZ7A 4F9WA 2CNQA 4ERKA 4YO4A 4OR5A 3RPSA 2E9UA 4MF1A 3NCGA 1PY5A 4E4MA 1XJDA 3LFQA 4ZLYA 3QXPA 4FEVA 1YI4A 2XEZA 4TWCA 1PXJA 3QTWA 3CJFA 2B54A 4OBOA 3IO7A 3ZEPA 4A9SA 2YM8A 4ZZMA 1Q62A 5CU2A 5CU0A 4O0RA 3RGFA 1LUFA 3W2PA 3QQHA 4GVJA 4BBEA 2C3IB 3BPRA 5I9UA 3MFSA 2VTPA 5E90A 4BDHA 1B39A 3TKUA 4E4LA 3WE4A 3CQUA 2WIPA 1WBNA 4H39A 2XIXA 1Q97A 2Y4IB 1OECA 2HIWA 4U42A 2GS7A 3FV8A 3JVRA 3MGYA 4FTLA 1W82A 2ITVA 4GVAA 4DFUA 3U8WA 3BLHA 3SVVA 4WG3A 4RIXB 5LVNA 1PMEA 3O0GA 4J1RA 4BF2A 3FLNC 4LL0A 2A19B 5IMXA 3G15A 3CCNA 3L9NA 3ERKA
chains in the Genus database with same CATH superfamily
4C58A 4FKUA 4YPSA 5IQHA 4EHGA 3ZSGA 4MNEA 5D9HA 4W8DA 4UYAA 2GNFA 2FGIA 2Z2WA 3TTJA 3GQIA 4J71A 1BX6A 3QA0A 5H2UA 3NX8A 4J98A 4ZY6A 2W9FB 3FDNA 3O5AA 1QPJA 3PUPA 4UWCA 5EH0A 4YJNA 2ZV2A 1U59A 4AW5A 2HZ0A 2XCKA 3QD4A 1SZMA 3HECA 4HPUE 3BE9A 4QP1A 5E7RA 2CGXA 3V6RA 4X3FA 5EG3A 5A6OA 3PLSA 2PZRA 4M69A 3QKKA 3RCJA 2IEWA 3D9VA 3HRCA 3FI4A 2V62A 4WG5A 1O6KA 3MY5A 2UW3A 4X3JA 3C51A 5EFQA 3MVJA 4BTMA 4F7LA 5AJQA 2XF0A 4K0YA 4FSWA 2VO0A 2YM5A 4KIKB 5D7VA 3TUDA 2I7QA 3IKAA 5F4NA 4IDTA 3UOKA 2XAOA 3KULA 3EB0A 4PL4A 3R6XA 5EYMA 1M17A 2W06A 3DK6A 3VUTA 4USEA 4JQEA 1IASA 3KN5A 4XNEA 4IC7A 4QTBA 1W84A 4AA5A 2UW8A 4O0TA 2F57A 3A8XA 5ETIA 2FVDA 5EK7A 4FTAA 4QMQA 4QDVA 3Q4UA 3PIXA 3W55A 1R0PA 5CS6A 2PSQA 1OPKA 1H27A 4RQKA 4RA4A 3M2WA 3RKBA 4ALVA 4E6CA 5I5ZA 1YVJA 3SQQA 5D1JA 4I1ZA 4LRJA 1SNXA 2VZ6A 3KF7A 4GUBA 4IXPA 1F0QA 5A6NA 2VUWA 4ALWA 4WSYA 3W0PA 5HI2A 1NVQA 1Q61A 4EK4A 2I40A 5IQEA 3K5UA 4O38A 4QP6A 3AQVA 3R8UA 3RJCA 4FSQA 3FY0A 2X2LA 5CZIA 4YTHA 3LOKA 3OBJA 5DI1A 4ZK5A 3R30A 3ZSHA 3BYVA 4F08A 4CFWA 2BALA 1Y8YA 2CN5A 3F6XA 3RM6A 1CKIA 5M4IA 2ERZE 1R1WA 3U4WA 2XANA 2CGVA 5A4CA 2YM7A 1GZOA 2XNEA 4IWPA 1Q8ZA 5CLPA 2HY0A 4IZ7A 4ANSA 1FOTA 3OXIA 4U44A 3R8MA 3D5UA 3ODYX 3SRVB 4AS0A 2XK8A 4X21A 5M53A 3DU8A 3VBXA 1M7QA 2JDSA 4ARKA 3BLRA 4KB8A 2BAQA 2H9VA 4GJ3A 5A3XA 4WG4A 2Y4IC 2GS2A 3CQEA 4GK3A 4N4SA 4N6ZA 4RGJA 5CVFA 5AR7A 4D9TA 4OT6A 3NVKI 2WMVA 2JGZA 3EL7A 4EOLA 3WF5A 4JT3A 2OKRA 4BCOA 4O82A 2CDZA 2WMAA 3VS0A 5A4LA 3BE2A 4FUXA 3ORLA 2V7AA 4Y8DA 2Y4PA 4FI1A 4FTJA 4PMSA 1WFCA 4DHJA 2QQ7A 2XKEA 4RSSA 4G3CA 1WZYA 2PE2A 2PPQA 3E62A 1OKZA 3U9CA 3TT0A 3C4XA 4YSMA 3O96A 4V0GB 2WD1A 3NUPA 2IVUA 1XO2B 4LOPA 3DDPA 2I1MA 5B0XA 4QTAA 5TF9A 2WMQA 3DJ7A 4B4LA 4EOMA 1FQ1B 1OPJA 3D5XA 4FTQA 4O0XA 5FDXA 3MA3A 3W16A 4AT4A 3U55A 3ODZX 3ZRLA 3HV4A 4YLLA 4L45A 4YUQA 3F66A 4XG4A 3UIMA 4C62A 3EJ1A 2BRHA 4NUSA 4MD7E 3W8LA 2R4BA 4JNWA 4F6UA 4YJUA 5ANEA 3UPXA 1PMVA 2GNGA 5HVKA 4DFZE 1PMUA 4L43A 4K2RA 4C3PA 4NCTA 4AXCA 5HD7A 1EH4A 2C6KA 2X8IA 4GU9A 2R7BA 1WVWA 1Q8TA 4O81A 4AE6A 2R3JA 3FLWA 2OIBA 3BV3A 2PMLX 5M55A 4Z16A 3GU5A 4BCGA 2GMXA 3HMNA 4LM5A 3LFFA 4RG0A 3DV3A 4R1YA 2GCDA 3ZSIA 4BN1A 4IVDA 4U0IA 1YQJA 2XNGA 1OL7A 3ALNA 3W0SA 4PPCA 2GFCA 4ACMA 4TPTA 1W2DA 3RMFA 3BKBA 3LJ0A 3TI1A 5HORA 3NMUF 5M56A 5EI6A 2Y9QA 3UC4A 3SXRA 2EXMA 3LFBA 1YI6A 5CQWA 4BWKA 1ZYSA 4J95A 2WTIA 5HBHA 3VS3A 5TOZA 3U6HA 1W7HA 3OCTA 5AA9A 4RX9A 1GY3A 4FKPA 4AN9A 3HAVA 4KUJA 4PTCA 2PVNA 4FT9A 3OWPA 4QYYA 2UW6A 4D4SA 1R0EA 4L00A 3DBDA 5D7AA 4BBFA 4BYJA 4HW7A 3KU2A 3F3WA 1H07A 5L3AA 4FIFA 1MRVA 1PXIA 3DGKA 4AAAA 4R3PA 3PG1A 4H3PA 3SXSA 2BDFA 4Y85A 3TV7A 5L6OA 4FZAB 3FE3A 3UQCA 4FV0A 2F4JA 1O6YA 1CTPE 3IQ7A 3WZUA 3WIKA 4U81A 5IPJA 2OZOA 4C57A 4JG7A 5GINE 2FSTX 2B4SB 4M15A 4NJ3A 4O1OA 2X39A 3H0ZA 4OTQA 2R7IA 5HO6A 1Q5KA 4ENYA 2W05A 4NT4A 3FZOA 4C34A 4AQCA 3LMHA 4CFXA 3IOKA 3R71A 5CEKA 4QMXA 2G2HA 2PVJA 2WEVA 4EOIA 1PMNA 3RI1A 3Q96A 2SRCA 1H8FA 2J5FA 3GNIB 4M13A 3TMOA 4QD6A 1GJOA 5CAUA 1WBOA 3LVPA 2WKMA 1A9UA 1TKIA 4NTTA 1IEPA 3T9IA 4DG2E 4IC8A 1J7UA 4EL9A 1IG1A 4OUCA 3LW0A 3L9PA 2IO6A 2G15A 3COKA 4AACA 2UW9A 3E8DA 2RKUA 4Z9LA 4Z3VA 1JKLA 3RWPA 2YDIA 3QRIA 3QZHA 2XK6A 4I3ZA 4N0SA 4TYJA 5CEQA 5HIEA 3GOKA 4L3PA 3LCOA 3ZFYA 3F5UA 3JPVA 2RL5A 3HGKA 5LCKA 2OG8A 2QI8A 3RK9A 3D2IA 3DBEA 3UTOA 2B0QA 3LJ1A 4USDA 4O6EA 1QPCA 4TYGA 5BVFA 5AUTA 5KMLA 3T3UA 4EH6A 3DBQA 3OXZA 2ITTA 4NCTC 4QP4A 3MIYA 4R7IA 1OIRA 4NWMA 3L1SA 4RJ4A 2GNIA 2W4JA 1ND4A 4FMQA 3QL8A 4KS7A 5LVOA 4U80A 4CNHA 3I5NA 3QQLA 5E91A 3QQFA 3G9NA 4FODA 3QUDA 1YDRE 5CTPA 3ZO3A 3GT8A 3OWJA 2XMYA 3P4KA 4AOTA 2WU6A 3LAUA 2C0IA 5ANDA 4FR4A 5HNIX 2XH5A 1OIYA 2F9GA 5C4LA 2G01A 2AQXA 4YLJA 4G5JA 2VNWA 2C0OA 3ENMA 4ZS0A 3JUHA 4IW0A 4LDTA 3CD8A 4D4YA 4O7TA 2IW9A 4GH2A 3SA0A 5L2TA 1ZY4A 4XV2A 5BX0A 5E4HA 2PK9A 2YLFA 3OTVA 5LMAA 3ACKA 5AV3A 4RJ7A 3Q9XA 4WNPA 2EXEA 4C0TA 4CKRA 2HELA 5GZ9A 4EKKA 2ZOQA 3KMWA 1XH6A 3COIA 4FZDB 4IAYA 4AZSA 1GOLA 4XLVA 3TM0A 4FKGA 2XK7A 2CSNA 3ZZEA 4CZYB 4RVMA 2QOCA 3CD3A 1UNHA 4M8TA 2E2BA 3QA8A 3RHXA 1G8SA 3R8LA 3SOAA 1JKTA 3PSBA 4E93A 4QMOA 4FK3A 5EW8A 1MUOA 5DT4A 2EU9A 3A8WA 3PVBA 3LFAA 4E5WA 5IA2A 2BZJA 3AC2A 4OAVB 3CXWA 4F0GA 2UZWE 3Q60A 4DFYA 3BHYA 5GNKA 4HGSA 4II5A 4I23A 3VUKA 3NW7A 2HAKA 3PIYA 3V5LA 5C1QB 5IEXA 5IKWA 4ZXTA 4L7FA 4O0VA 2CKEA 3OBGA 4FKIA 4I93A 3HUBA 4GG7A 2QLUA 5D10A 2Z02A 5AX9A 1FBNA 5JZJA 4EH5A 2VTSA 4QQ5A 4AGCA 3ORTA 4BKZA 2PZIA 2YIXA 4IAFA 3A2CA 4GUEA 2UW4A 2A98A 5HD4A 2R3HA 4ENXA 5FP5A 3Q04A 5DRBA 3VAPA 4A4OA 4B8LA 1PYXA 2Z7SA 3FSKA 2WTJA 4QYGA 3EZVA 2W1GA 2ITNA 3DAKA 3LFDA 5KZ0A 3Q4TA 4GYIA 2F2UA 2YIQA 4XBUA 2R3RA 3GCPA 4FG8A 4XG3A 2WPAA 3SLSA 3RAKA 4F4PA 4G5PA 3F2RA 4H1JA 5C8KA 4QMPA 2IZUA 2CMWA 2WO6A 2W1IA 3F88A 3ZOSA 5M07A 1Z9XA 2AUHA 4FSNA 4IAIA 4FA2A 1U54B 4FGBA 4FKLA 5CAOA 2I0EA 2W4OA 2Y8OA 4ACHA 2AYPA 5HHWA 3HX4A 3WILA 4F70A 2BUJA 3OG7A 4AP7A 1WCCA 1PXMA 2OK1A 2ZV9A 3K3IA 3PZEA 4NU1A 4YO6A 5AM6A 3V3VA 3ATTA 4DAWA 5AUUA 5KMNA 3QGWA 5HVYA 4OBQA 5E8TA 4BDDA 4BTFA 3RPOA 4MXXA 3MIAA 1SVGA 5CAVA 2YCSA 4YPDA 4FV1A 4IAAA 1W0XC 1YOLA 1G8KA 4BI2A 4GMYA 4X2FA 4JXFA 3CE3A 4JR3A 4I21A 5B2LA 4X6QC 3E5AA 3VRZA 3QX2A 5EQPA 1SM2A 4Y72A 1H24A 1RW8A 4UY9A 4F99A 2R0UA 4OTFA 4YTCA 4TY1A 4U7ZA 3A7FA 3ET7A 2OH4A 5EYCA 1B6CB 3W0NA 4AFJA 4EBWA 3ANRA 4GSBA 1YRPA 2OJ9A 3D7TA 4M66A 3PIZA 2GNLA 4Y5HA 5E1SA 5ETCA 3HV6A 3ZO4A 3QUEA 4YR8A 2R3PA 2QOQA 4KBAA 4DHZA 4FIIA 4BZOA 4A07A 3VBWA 2YABA 3VUIA 4DG0E 5JN2A 5JFWA 4LUDA 2C6LA 4BCQA 1GIJA 4CT1A 5BUEA 4F78A 1KSWA 4H36A 2B7AA 4R5SA 3R83A 3SC1A 3TIZA 3QGYA 3FWQA 3FYKX 3V5WA 4YMJA 2ZV8A 4ZJVA 4PTEA 2VWVA 2VTLA 2QD9A 1E9HA 2O3PA 4I22A 2BROA 4F0IA 3EN4A 4ZTLA 1B38A 4YU2A 3GENA 5LQFA 4OLIA 1PXLA 3P86A 2GTMA 4K6ZA 4BWXA 4L01A 3G0EA 1Q41A 3TL8A 2QCSA 5HIDA 5CNNA 4C33A 2CKQA 5DFPA 4IAKA 4FIEA 2ZYBA 3OOMA 3UOLA 4AN2A 4E6QA 2YHVA 5EHLA 4E5AX 1Q99A 1CSNA 4QMUA 3KXXA 1KE8A 4FIJA 3BWJA 2QU6A 4KINA 3C5UA 1BLXA 3KXMA 2HZIA 4FT5A 3DZOA 5BYZA 4ZZNA 3POOA 2OLCA 2YEXA 1XH8A 5FG8A 4R3RA 3DB8A 3A61A 5DT3A 5FEQA 3E88A 1PXNA 2FB8A 2QKWB 4UMTA 2WB8A 3KRJA 4RWIA 2GNHA 2XKDA 3D5WA 3UZPA 2ITPA 3LZBA 4A9RA 4EQMA 4HVGA 5AP5A 4O4EA 3TDWA 4L7SA 2V7OA 2R3NA 3UQFA 5J9ZA 4EH3A 4S33A 2C1BA 1H0VA 5KKRC 2IW6A 4PRJA 3BX5A 4KS8A 3F3TA 4I0RA 1DS5A 3E3BX 5HGIA 2YIWA 3PVGA 1OL6A 2PE1A 4ACGA 3KVWA 3QTQA 3V01A 1CDKA 4F9CA 1RQQA 2BZKB 3DXQA 4O83A 3SG8A 2ZMCA 3CR0A 5M4UA 3ZLSA 1P4OA 3BU6A 1MRUA 3UPZA 4MH7A 5M44A 2NO3A 5HBJA 2XIRA 1YXSA 3IPHA 4GFMA 2VV9A 3GXLA 1NA7A 4G34A 3COMA 4USFA 3FXZA 3O71A 3AD4A 4EUUA 4HPTE 2WQOA 4AZEA 3HV5A 2X6DA 3GFWA 2WHBA 5JH6A 1TFFA 3CEKA 2ITQA 3SD0A 2YISA 2J4ZA 2OXDA 5AP3A 3KGAA 3DTWA 5DHJA 3GC8A 5JGAA 4DF3A 4IWOA 4R3CA 3WE8A 1VYWA 3EN5A 3EL8A 1P14A 4UX9A 1XHAA 5EKOA 4AGDA 2XAMA 3JXWA 4L3LA 3G6GA 2RGPA 5K9IA 4FJVA 4BDJA 5FM2A 3RWQA 3HMMA 4C7TA 3W0RA 1OL1A 1REKA 3NUXA 3UODA 3MVLA 3UO4A 5LMBA 3F69A 2C6DA 2CLXA 3HA6A 1XBBA 4JVGA 4MXCA 4FV7A 1OZ1A 3EIDA 4DGLC 4ZJJA 1J3HA 4H58A 3TACA 1K3AA 4CZUA 3C5IA 1M2PA 4PP7A 2V22A 4E20A 2GQRA 5CU6A 1YWRA 3R2YA 4MWHA 4ZEGA 3RP9A 2YJSA 3CGOA 2J7TA 2C6EA 3CY3A 3P08A 3DKFA 4M12A 3EOCA 1AQ1A 5KHXA 2YJRA 5H8GA 3R63A 4UN0C 3AMAA 2XK4A 4PPBA 4DCAA 5J7BA 3F2AA 4RJ8A 4BHZA 1ZAOA 4WD5A 3VHEA 4NFMA 3PY3A 2BHEA 1R78A 4L42A 4QPAA 2PVLA 4DEAA 4DYMA 5DMZA 3VWAA 5F20A 3NSZA 2X7OA 2IPXA 3CBLA 4KSQA 4FL2A 2PVRA 1BUHA 4TYHA 3D2KA 4A9TA 4F7JA 2J9MA 3KRWA 5DGZA 3UNJA 4L9IA 3E8CA 3Q3BA 4GJ2A 5CYIA 2GU8A 3G90X 4EK5A 5CWZA 3DXNA 3D5VA 4X2KA 3QTSA 4G6NA 4I5MA 4RFZA 1Y8GA 2X4ZA 5H3QA 3OS3A 4Y95A 3VW6A 5FWKK 3AC4A 3OY3A 2XYUA 2JIUA 4EC9A 2XIZA 4XG7A 4BY9E 5BMSA 4UMQA 3ZZWA 4ZMEA 4JBPA 4U3ZA 5EDRA 2XS0A 4D4RA 4IMYA 5BVKA 4CFNA 5L2SA 3VS4A 1WVXA 2V5QA 2VWZA 4ANLA 4FSMA 3C0IA 3EYGA 4O7NA 4FEQA 1NVRA 5DR2A 3UDBA 3QCYA 3KEXA 4CV8A 4LOQA 4DINA 2ZFYA 5BV3A 4CYJA 1H1WA 1KE5A 5IUIA 2YAAA 4V04A 2UW5A 4PV0A 2UUEA 3UDZA 1H1QA 5AP4A 4YZMA 4C3RA 4ANMA 2B9IA 1DAYA 4IB3A 3R9OA 4B9DA 5TKDA 5GJGA 3RNYA 1NW1A 4EOKA 3O51A 4RFMA 5HU3A 2YACA 3GCUA 3ZO1A 2C0TA 4EQCA 1YXUA 3EKKA 2I0YA 5ETFA 4RX5A 3B2TA 5IUGA 1TQIA 3ANQA 5M06A 1G8JA 5HIBA 4ZSEA 3IW7A 2W5HA 3HA8A 3NNUA 3BU3A 3NS9A 3QZIA 3KC3A 2O5KA 4D9UA 2CJMA 3H30A 4C4GA 3CP9A 4KBCA 3FUPA 4FZ6A 4BRXA 4FV2A 2AC5A 3WZEA 3W2SA 5HEZA 3ZUTA 5AUVA 5TE0A 3NZ0A 5CF5A 3NAYA 3FLQA 1JVPP 3IW8A 1UNGA 5E8WA 5IMEA 4BYIA 5DEWA 3COHA 5ANJA 1VLRA 4JR7A 3HP5A 3NUUA 3OROA 3TWJA 4M84A 3SX9A 4MHAA 3QFVA 4OTHA 5AR5A 3UIXA 4RWJA 2O63A 3E7OA 3RVGA 4ZSGA 5CF4A 4BCJA 4P2KA 3Q4CA 4M3QA 3ZONA 4ZS4A 1IR3A 2PVHA 2XRUA 4JDKA 3GCSA 3A4PA 4ZSJA 5H8BA 3OUNB 1FPUA 4S30A 3QRUA 4CD0A 4ZTNA 1BI7A 4JDJA 3FMMA 4IFCA 4PPAA 2VD5A 3MH1A 4WOVA 2FUMA 2CN8A 3IONA 5HG9A 4U8ZA 4DBNA 4YC8A 5IDNA 3JS2A 4X3FC 1Z57A 3GUBA 1T46A 4MVFA 5CEIA 4EH8A 3DS6A 3EFWA 1IA9A 2VX3A 4D55A 5L4QA 3FKOA 4MBIA 1FMKA 3TEIA 3UJGA 1A06A 4WKQA 2YIRA 3UDTA 4A06A 4E4XA 3EQDA 3PWDA 4WBBB 3CJGA 4C35A 2YCQA 3RCDA 3VBYA 2HZ4A 4BC6A 4EKLA 2HY81 4Z7GA 4WNKA 3LHJA 4EOOA 3R7GA 2XBAA 4QQJA 3MN3A 4YZBA 4E8AA 3QTZA 3D0EA 4YHJA 4ZY5A 5ACBC 5HNBA 3U87A 3P5JC 1URWA 3WIGA 2OJGA 1OBGA 3U6IA 3R22A 4GU6A 3I0QA 4E6DA 3AC1A 3QX4A 4DG3E 3FQHA 3FC1X 4CFMA 3SHEA 4HNFA 4IB0A 4IM0A 3TKHA 4BCHA 1UKHA 1W98A 2OIQA 4FK6A 4JAJA 2XJ0A 3AT4A 5BUJA 5FUTA 3NUYA 2W0JA 2FSMX 1WMKA 4FV9A 3LQ3A 3FPQA 4CG8A 4I5HA 5EOLA 4AXFA 3UP2A 2HCKA 3FJQE 5DIAA 4FL1A 1KOAA 5IA3A 3FLZA 5DG5A 3TG1A 3LM5A 4NZWB 4XV3A 3R9NA 3NYVA 5JQ8A 5L8KA 3FMJA 4DA5A 4FTKA 4XBRA 1FVRA 3ORXA 2YZAA 4YZ9A 4S2ZA 3EZRA 2BRNA 1H1SA 4M69B 4ITHA 4NH1A 5FXQA 4EH2A 2RFEA 3W10A 4BDFA 4XMOA 2IZTA 4NYEA 1QPDA 3VUDA 2B1PA 1L8TA 3M1SA 4DFXE 3O17A 4F6SA 3PE1A 4EWHA 3VUMA 4MXYA 1P4FA 1M2QA 4QP8A 1UWJA 1U5QA 2KTYA 2JKKA 1KUTA 2X0OA 4EC8A 3LIJA 3FZ1A 4G3DA 4JG8A 3UP7A 3A60A 5HICA 5FXRA 3POZA 5F9EA 3DAEA 4C61A 3QD2B 3EHAA 4YNEA 4D2TA 3A7HA 2CPKE 3WF7A 4C4EA 3H3CA 5AFVA 5GJFA 3U9NA 3AC8A 1Q3DA 1PXOA 1UNLA 3GQLA 2FYSA 5JMSA 1CKJA 3R8ZA 4DT8A 3L8PA 3Q52A 1ZOEA 3NNXA 4FICA 4IM2A 2YM6A 2BIKB 3GC7A 3A7GA 3A7JA 2BHHA 4QMWA 3SRVA 3TV6A 5C01A 4R77A 2LGCA 4HGLA 2C5XA 3HUCA 5ANOA 2VWUA 2X81A 4PL5A 2C47A 2YAKA 3HRBA 3N51A 5AIKA 4UXLA 4DCEA 2JKQA 5F1ZA 3MA6A 4RVLA 5BPYA 3P7AA 5TO8A 4O7RA 2G2FA 4CQEA 3CKXA 4F1MA 5A14A 4QMMA 4HZRA 3LFEA 4BWPA 1ZY5A 3E7VA 4AX8A 4D2RA 4FV6A 5C8MA 5EI2A 3EFLA 4DEDA 2H96A 3MB7A 4UZHA 5ANGA 2HWOA 2JBPA 1H25A 4IADA 4QPMA 4ZP5A 5AR8A 5CU3A 5I3OA 4DEBA 2R3IA 3IG7A 4WBOA 5BMMA 4FIHA 4XG6A 4WUAA 5IEVA 4EONA 2YCRA 4F9AA 4ZSLA 3F7WA 4G2FA 4EJ7A 1YHVA 4IM3A 4PDSA 3FZPA 1XMMA 1XH5A 4AQKA 4IB1A 5BUIA 4G17A 4J7BA 5FBOA 4EK6A 4QTCA 2ETKA 1BKXA 5FP6A 4DLIA 2OFUA 4MNFA 2V0DA 3NUSA 3KQ7A 2IZRA 4RJ3A 3QQGA 3RPYA 3V8SA 1KV2A 4EK8A 3U4UA 2CKPA 3WARA 3H4JA 3H9FA 4HYUA 4ANOA 1OL5A 4CZTA 3UC3A 2QKRA 4G3FA 5GZAA 4B0GA 1RDQE 3W0MA 4PDPA 2WTCA 3BGPA 2WTVA 3UMXA 1XBCA 1XH4A 3T8OA 2Z7RA 3MDYA 4DFBA 2ITZA 4L6QA 2JDVA 2X7FA 4OBPA 4QYEA 2JEDA 4D2SA 5LVPA 2WZJA 2XJ2A 4FL3A 3THBA 3WF9A 1ST4A 5IQFA 3JY9A 4G31A 3VUHA 2PUNA 4EEVA 4FSZA 2PMNX 4MF0A 2ZMDA 3PP1A 4LFIA 4RIYA 4YJVA 3A7IA 4IBMA 3TXOA 3U54A 4C4JA 4FRFA 1KV1A 2C6IA 3C4WA 2PMIA 3G0FA 1OGUA 4P90A 2EVAA 4BKYA 2XM8A 3Q6WA 3TZ8A 1IA8A 2QOHA 4M97A 2J6MA 3IGOA 4RT7A 4GL9A 2R9SA 3UVRA 3K54A 2IVVA 3EQFA 5EDQA 4DLJA 2WMXA 2B53A 4X0MA 3NNVA 1V0OA 3BRBA 4K9YA 2WFYA 4FOCA 4APCA 3PFQA 4QP3A 5LJJA 4IZ5A 4O7WA 3V8TA 3FZSA 3LLTA 4RX8A 3GP0A 2WQMA 5AADA 1OKWA 3MH3A 1W2FA 4AW1A 3IDBA 1JKSA 2O2UA 3ID6C 5K3YA 4TL0A 1JKKA 4FTNA 5EM8A 2H6DA 2VRXA 2JIIA 2VTOA 5IA5A 5HX8A 1XMLA 3CSVA 5EQEA 2OW3A 3JYAA 2HOGA 3ZS5A 5HTBA 4I6HA 3ALOA 3QYWA 2QLQA 1JAMA 3TNIA 3FBVA 4CYIA 4RBLA 4A4XA 2WOUA 3GB2A 4MCVA 5D41A 3TNPC 5CT0A 4F7SA 1OBDA 4GIIA 5HVJA 5TR6A 4HGTA 1OIUA 5I9YA 3SW7A 3FI2A 4CGAA 2J0JA 3A4OX 3DLSA 5AIRA 5AV1A 3ZFXA 4HGEA 4F09A 4XHKB 4KNBA 3RNIA 4GS6A 2VWBA 4PF4A 2OBJA 4I0TA 3P1AA 3ITZA 5ICPA 1UU3A 4FEWA 5DBXA 4O7ZA 4L8MA 2UVYA 4HOKA 3PA4A 5BVEA 2WMUA 5BVOA 3NCZA 3R0TA 5FTOA 3QHRA 3C0GA 1PHKA 3FSFA 5CVGA 5JSMA 3FY2A 4BDCA 4EOQA 1NXKA 3GU6A 3VW8A 4IIRA 3PUFC 2YDJA 4FUYA 1UA2A 3MV5A 3QRTA 4O4FA 3TZMA 4HVSA 4C4HA 2BAJA 1UU8A 2X2KA 4KKGA 3E93A 2W1EA 4FVQA 4RMZA 2ERKA 5AP0A 3ZBFA 3IW4A 2WOTA 4AA4A 5K5XA 2VTMA 1ZARA 5HO8A 2PL0A 4I4FA 4FX3A 4BCNA 4IAZA 2XP2A 4RX7A 5JFXA 3I6WA 3EMGA 5LVMA 2ZJWA 2DYLA 4IVBA 5IA1A 4XS2A 2VWIA 1M7NA 4F9BA 3C0HA 4FSRA 4R7BA 4IE9A 3ZLWA 4NEUA 1J7LA 1JWHA 4GKHA 3DBFA 3ZBXA 3QC4A 3ZC5A 2QODA 2J90A 3PJ8A 3VIDA 1ZXEA 3DKOA 3NW5A 1YXTA 3V8WA 4FEUA 4A7CA 2F7XE 3RM7A 3IECA 5T68A 4DEHA 3GGFA 1JBPE 3O8TA 3OHTA 4LMNA 3R02A 3HDMA 4M7IA 4EK3A 2QG5A 3F82A 3O7LB 3OY1A 3R73A 4MXZA 4JRVA 3LMGA 4U45A 5CY3A 2OJJA 4BGHA 1YHSA 3OZ6A 4HCVA 4L52A 2PY3A 5AUZA 4BDEA 5M09A 2IW8A 4M68A 4YJOA 2ITWA 2VTHA 2OF2A 3A62A 4FT7A 4HCTA 4KIQA 1S9IA 4NFNA 4P5ZA 2H8HA 4YLKA 3OFMA 4KKEA 3KN6A 4LOOA 4RIOA 4JX3A 3DAJA 5IQBA 3VJNA 4QOXA 4EI4A 3O8UA 3GI3A 2YWVA 4HYSA 4QMLA 3UIUA 3TZ9A 3R21A 3CKWA 3MJ1A 2VTJA 4FC0A 4NIFB 2OFVA 2PZYA 1K2PA 2OIDA 3P7CA 5HE2A 2C69A 5FD2A 3CS9A 3AC3A 3NYNA 5I9WA 4RIWA 3MPTA 2WEIA 2YCFA 1BYGA 3QALE 5CNOA 5D11A 5G6VA 5AEPA 5M08A 3UOJA 3IW6A 3DLZA 1WBVA 4MX9A 5EM6A 4HVIA 4OTPA 2C5NA 2YA9A 2C6TA 3R1QA 3D4QA 4C3FA 4LGDA 5CASA 4BHNA 5AAGA 3K2LA 4JL9A 2X9FA 4TTHB 2JC6A 4BTKA 4DN5A 5EQYA 1SVHA 4Q9SA 3UO5A 3TV4A 3TKIA 2LAVA 5AUXA 4WUNA 3ZM9A 4KBKA 4FT0A 4BTJA 2JDOA 4RFYA 1PRYA 4E1ZA 4DT9A 3O8PA 2QOIA 4KD1A 4X3FB 3RAIA 2RG5A 3MFRA 4RQVA 4TYHB 4UZDA 3U51A 4EYJA 4HVHA 3N4TA 5H9BA 4OTGA 4TYIA 4U41A 2XALA 1E1XA 3B2WA 4MQ2A 3DB6A 4K18A 4NIFA 4JQ8A 3FHIA 5HKMA 1YW2A 4PY1A 3S0OA 3D94A 3R9HA 1IAJA 5C8NA 2I0VA 4FG7A 3WF8A 2BZIB 1ZOHA 5CVHA 4E3CA 5AX3A 5IU2A 3U6JA 4O7LA 3NNWA 1NY3A 3EKNA 3JVSA 4YZNA 3QQUA 3A99A