2PVHA

Structure-based design of pyrazolo[1,5-a][1,3,5]triazine derivatives as potent inhibitors of protein kinase ck2
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
328
structure length
327
Chain Sequence
MSKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNAYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Casein kinase II subunit alpha
publication title Structure-based design, synthesis, and study of pyrazolo[1,5-a][1,3,5]triazine derivatives as potent inhibitors of protein kinase CK2.
pubmed doi rcsb
source organism Zea mays
molecule tags Transferase
total genus 110
structure length 327
sequence length 328
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2pvhA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2pvhA02
3DZOA 4O7RA 2YIQA 2PVHA 4I21A 4IAKA 3NCGA 4S30A 5FWKK 3RVGA 4GT5A 4BRXA 3UIXA 3FZ1A 2O8YA 3Q4TA 4IAYA 4L53A 2ITYA 1JQHA 3Q5ZA 3A4PA 2GCDA 2NRUA 4U43A 5DPVA 3QCXA 4AE6A 5LMAA 4DFNA 5EYCA 5LVPA 5M56A 4O83A 4B8MA 2J5EA 4WBOA 3NUPA 5AX3A 5D10A 3M11A 2GNIA 4UZDA 2BDWA 5IUIA 1WVYA 3P86A 4J96A 1KSWA 5EKNA 3QWJA 2O0UA 1OL2A 5AV3A 2RL5A 4FEXA 4X0MA 4QRCA 4DH7A 4O0VA 3MI9A 5HQ0A 3JY9A 4FT9A 3WI6A 5E4HA 5KKRC 5JK3A 2IZSA 2OXXA 3QGYA 1Q99A 4IQ6A 4Z3VA 1FINA 5A14A 4FV9A 1APME 2QD9A 2A2AA 4G31A 5A46A 4GK4A 3ZM4A 4S32A 1PXOA 2CLQA 4O84A 2QOBA 4EOSA 2I40A 4BTMA 4J8NA 4BDDA 3ACJA 1T46A 5HORA 2QR7A 1YVJA 3F6XA 2PL0A 4IDVA 1S9JA 5AR5A 4FSWA 5E8TA 3NYNA 3VO3A 4J8MA 3DCVA 3RM7A 1YWVA 3WBLA 4IC8A 5AAEA 5BVNA 2IW9A 4FT3A 3TL8A 3OW3A 3IOKA 5DMZA 2P55A 4C33A 4O21A 2V5QA 4L67A 1U5RA 2ERKA 2C5YA 1XBCA 4JDHA 4FSRA 5EDPA 2ZV9A 4H1MA 5J79A 5JH6A 4AT3A 3VS6A 4O82A 2BRBA 4I41A 5ETCA 4FV2A 2YJSA 4KB8A 2Y6OA 4KABA 2HWOA 4UYAA 4F99A 2PUNA 4CGAA 4KIKB 3SXSA 4CT1A 4U5JA 4ZZNA 3P1AA 1Q97A 4RX7A 4YHFA 2E9UA 2PVMA 3CBLA 3Q6UA 5BVFA 3UO5A 2JLDA 1E1XA 4XLIA 3MBLA 5CAVA 1H08A 4FG8A 2PE1A 1OI9A 5IQBA 5JFXA 3CGOA 4L43A 2YM6A 3FLQA 4DG3E 2QHNA 1V1KA 3TI1A 3S2PA 4O86A 4MF1A 5M06A 1OZ1A 3MTLA 2BKZA 3BEAA 2I0HA 2J6MA 1WVXA 5CXHA 3OHTA 4WD5A 3O51A 3R00A 4RLKA 3WARA 3NW7A 1PXJA 3T3VA 1ZARA 5CF8A 1F5QA 4Q5HA 5AUZA 4BHZA 4R78A 2R2PA 4IXPA 2BIKB 5HG8A 4QTDA 4HVDA 4O0TA 2PSQA 3ZDUA 4YZ9A 3W2RA 4EK4A 2ITTA 4R5YA 4QT1A 2W06A 3FE3A 4RLLA 4QTBA 4M69B 3UOJA 2OICA 1OVEA 4FZ7A 2GQRA 2VWVA 5JSMA 1ATPE 3TIZA 5LJJA 4PDYA 4IAZA 2BILB 4P2KA 4X2GA 4D28A 3QD2B 2YZLA 3OUNB 3W8QA 5GJDA 2HW6A 3COKA 3TZ9A 4TYHB 5M07A 4NW5A 2CGVA 4GU9A 1WBOA 2WMQA 3OOGA 4RC3A 1NA7A 1FGKA 4FTJA 4LGHA 4RGJA 4YTHA 2PZIA 4YTIA 5I0BA 3DXNA 3SGCA 3ODZX 3QQUA 4BCMA 1U5QA 3MS9A 4NTTA 4D9TA 4CCUA 4XRLA 4O1OA 1PMUA 4QP8A 2W5HA 4HGTA 4GT3A 3QQHA 3UQFA 3JVRA 3CQWA 1WBVA 2XA4A 4XP3A 4QMPA 4DC2A 4EOPA 4GJ3A 4RIOA 5A4QA 1H1RA 4BTKA 2R3RA 3R28A 3R7VA 5AA9A 3GU7A 3VS0A 4CT2A 2XNPA 2YEXA 1VYZA 4L44A 1OIRA 3H10A 3KKVA 3UTOA 1PYEA 3VS3A 2JFMA 4F09A 2XIYA 5I9WA 2DQ7X 3RM6A 1PJKA 2PVYA 4BGQA 2XKCA 2R3KA 3EOCA 3F3UA 5CU3A 5LCKA 3AMBA 3HV3A 2ITXA 3C50A 4BDHA 1JKTA 4ZEGA 3I0OA 4I6QA 2QHMA 4N6ZA 4FNZA 2WELA 2ETRA 2UW0A 1Q24A 3KMWA 3HRBA 4IFGA 4JG7A 3IOPA 4QMOA 2IO6A 3DK6A 3QQLA 1SM2A 2G2HA 3DPKA 2O63A 2YZAA 4UXLA 5ETFA 2F7XE 3QTRA 4UB7A 3FJQE 2PVKA 3R63A 3TEIA 4E8AA 2HELA 3E92A 2H96A 4AA4A 4JRNA 2QO2A 1BKXA 2WOUA 2OJGA 3R9NA 2R5TA 3WF6A 5E8ZA 3ZFXA 2X6EA 4AP7A 4S2ZA 5FEEA 5IQGA 1UWJA 2HZ0A 3KU2A 5J1VA 2H6DA 3MY0A 4TXCA 3MJ2A 5ANGA 3TKIA 4WNOA 2X8EA 4YJNA 3CQUA 5KMJA 4ACMA 4O38A 2RGPA 3PJ3A 3BYMA 1NT2A 3MPTA 3QF9A 4LOOA 4CFFA 4CQGA 4R7HA 4YU2A 5HCZA 4F0IA 5EI8A 1UV5A 1NVSA 5AP1A 5F1ZA 3FZOA 4LGDA 3CY2A 3R30A 5CS6A 3PRFA 2E9VA 4O0SA 1CKIA 3RAWA 3KRXA 4GJ2A 5ANDA 1GZKA 4X6QC 4O7TA 2ZDTA 5AR4A 4CXAA 2F9GA 3LMIA 4JG6A 4EJNA 1O6LA 4AZSA 3OWPA 3DLZA 3ZSHA 4RWKA 4WBBB 3JY0A 4R3PA 3QD0A 4KKGA 4P7EA 1V0OA 4GS6A 5HO6A 4XCUA 4FL1A 3W2PA 5DEWA 3FI8A 1B38A 3KMUA 4IJPA 5CT0A 3PE1A 3F88A 1REKA 3TV7A 3V04A 3QLFA 4ALVA 1LR4A 5TOZA 3R9RA 2I6LA 2X0GA 3E93A 2C0OA 4TW9A 1PRYA 1OL6A 3FMHA 1Z57A 2PY3A 1UNLA 4I6BA 3E62A 3GU5A 5GZ8A 3QWKA 4YJRA 3KXZA 3DLSA 4DLJA 4AN9A 5DBXA 4XLVA 4ZTQA 5DR2A 5D12A 3RHXA 4FKSA 3OBJA 4LYNA 4NJ3A 4QYYA 3R9HA 3PIXA 1UU7A 2REIA 1CKJA 2OXYA 3ZC5A 4ZMEA 5EW3A 3VC4A 1SYKA 2R7BA 3HP2A 4U42A 5KMKA 3ORKA 5C01A 4OTQA 4QMQA 4APCA 4R7IA 3TDWA 4QMNA 4GYIA 3TM0A 1YXUA 4RJ3A 1DI9A 3FMEA 5C8KA 2PUPA 3Q52A 4CKJA 4F6SA 3S00A 4ZTLA 3DQWA 1WBNA 2WQOA 5CF6A 5D41A 4L00A 1ND4A 4FV1A 5J87A 4BFMA 5IQDA 3PDTA 3D14A 4V04A 3PSBA 5FUTA 4N70A 4LRKA 4FV0A 5DG5A 3SW4A 2ZDUA 4YPSA 3Q6WA 3WF9A 3CD8A 1RQQA 5KZ0A 2HCKA 3A7IA 4YLLA 3H9RA 3LCTA 3UVRA 2YIWA 3UOHA 4IWPA 2FSOX 3OEZA 2C1BA 5KZIA 3PRIA 2X9FA 5GZAA 4WRGA 3RPSA 5IQFA 3JUHA 1YKRA 3N4VA 3SV0A 4N6YA 4EHEA 4EEVA 3BU3A 5AP5A 3LMGA 3K5VA 5M4IA 4D5HA 2BVAA 3BBTB 3LJ0A 2J0JA 3SDJA 5KUPA 4U3YA 1O6KA 1Y6AA 3F5GA 3HMNA 3R21A 3SOCA 5KCVA 2PHKA 3BGPA 3R7EA 5CZIA 2E9NA 3IW8A 3R22A 3EQPA 4BZNA 3D5UA 1DAWA 4GU6A 3C4ZA 5CAOA 3BLQA 4JVGA 2JAMA 2VGPA 3AC1A 5KMLA 2GPHA 4L6QA 4DFLA 1H28A 3UGCA 1P14A 3UNJA 2NP8A 4O27B 1ZYJA 4E6QA 3BU6A 3HV4A 4C3PA 4USDA 2YIYA 4O96A 3V51A 4FUYA 4C8BA 3BYUA 5EM8A 4CZTA 4JT3A 4IAAA 2OH0E 4B7TA 1Y91A 5L3AA 4BDCA 4DEAA 3QD4A 3LFNA 4D0WA 4DGNA 4G3CA 4ERWA 4YZMA 4GIHA 5CVFA 3FKLA 4C3RA 5AUUA 3GOKA 2UVZA 4A4XA 3LQ8A 3OF0A 4HVGA 4RIXA 3G6GA 3TG1A 3T8OA 2QKWB 4ZMFA 2UZDA 4XP2A 5DR9A 1QL6A 3KC3A 4RQKA 2WU7A 4DG2E 4YBKA 1YOJA 4KWPA 2FSTX 2YM5A 3QRJA 4FKIA 4R5SA 4RFZA 4X3JA 4YC3A 5L6WL 4LUEA 3KRRA 2YCFA 4QQTA 2JKOA 3E64A 3FEGA 3EFKA 1O6YA 2WKMA 3QRIA 4FIIA 3TKUA 4JDKA 1STCE 1U59A 4PDPA 4U7ZA 1P4OA 3L1SA 3SAYA 2WTDA 2OFVA 3GB2A 3OUKA 2XYNA 1S9IA 2QO9A 2YWPA 4MF0A 5HVJA 4M84A 1SVGA 3O96A 4YJVA 3VULA 5FTGA 2B4SB 4XEYA 1V0PA 2EVAA 3R02A 2G15A 1MQ4A 3Q9YA 3HX4A 4V05A 2EB2A 3IECA 4O0XA 4MBLA 4B9DA 4G16A 3A99A 3TIYA 1BMKA 4BYIA 4TYGA 1YXSA 3ORXA 1P5EA 3QKKA 3DBDA 4IB5A 3ULZA 2ZV7A 5L8LA 4FV3A 1ZMVA 4N4SA 3EFJA 1U46A 2Q0NA 2QQ7A 2B55A 4IVAA 3V6SA 4IH8A 4RC2A 2J5FA 3ZONA 4CMUA 4D1SA 1FMKA 4E7WA 4E73A 4OAUC 4IIRA 4PV0A 4FEUA 2XJ2A 4LMUA 1ZMUA 3R73A 3IDBA 4R1YA 4YUQA 4EH9A 1SVEA 5CX9A 4C58A 2F49A 1NXKA 4PL3A 3U6IA 3LXKA 4BDGA 3CKWA 4MHAA 2XIKA 2C3KA 4DCAA 3ZO1A 3T9IA 3NSZA 3TNHA 3QYWA 4J53A 2PTKA 4MD7E 3CPBA 3RTPA 5CTPA 2OSCA 4XOYA 3VRZA 1JSUA 4E5BA 3VUHA 4MQ1A 5IU2A 1XKKA 3SD0A 4NYEA 4LG4A 4QMYA 4L7SA 5L8JA 4AACA 4FL3A 4RWLA 5AV2A 5HICA 2BALA 4I92A 3QKMA 5K0KA 4EL9A 4O91A 3D15A 3F3ZA 3PLAE 5H8GA 1Z5MA 3DDPA 3JXWA 4XV3A 4HVSA 2RFEA 3LIJA 3E5AA 3Q32A 4DT8A 3PY3A 4LL5A 3NAXA 4L3PA 4E3CA 1LEZA 4ZLZA 2RFDA 2HIWA 4RG0A 1H25A 2WPAA 5HVKA 5KKRB 3BIZA 1PXKA 3CR0A 2GNHA 5AP7A 4ZTSA 5KBRA 3IQ7A 2WQEA 2UZBA 3IONA 3KRWA 4KS7A 5EW8A 3R8PA 5CEMA 2C6EA 5ANOA 4DFYA 5JZNA 2C0IA 4EBVA 2C6TA 3E8CA 5IDNA 4ORKA 3QZGA 3GU8A 3V8WA 3BE9A 4MH7A 1E9HA 4D2VA 4KS8A 3QFVA 4KAOA 3E3PA 1VJYA 2A1AB 3ROCA 4CZUA 2YIXA 1KE5A 2OJ9A 5FQDC 3MFRA 4JIAA 4C62A 2HWPA 4CFWA 4CRSA 4EOKA 5I4NA 3NEWA 1PXMA 1LEWA 4J99A 4FNWA 3BGZA 5GHVA 1OIYA 1PKDA 3RGFA 4AW1A 4F7SA 4U79A 2H34A 3QTXA 3R7YA 4BB4A 1HCLA 4ACCA 1XH7A 1PW2A 5F94A 4C34A 2EWAA 4YJTA 4CV9A 4G3EA 2O64A 3BYVA 3NNWA 3QRTA 2PMOX 3WIGA 3GP0A 2HZIA 3BHYA 2W99B 4FKOA 4K6ZA 4TY1A 1P4FA 4XBUA 2R3OA 3R71A 3NX8A 4GK2A 3QLGA 3UZTA 3I7BA 2GHLA 3SG9A 4I93A 3GCQA 1OECA 1J1CA 5IEYA 4F7NA 1YHWA 2GQSA 3E8NA 5KHWA 3ZO2A 4RC4A 1EH4A 1T45A 1AGWA 3F7ZA 3MY1A 2VTRA 3O7LB 4D58A 3Q60A 5I3RA 3RAKA 1FQ1B 1XH4A 3KRJA 2GMXA 4MYGA 5EQEA 5M09A 4HOKA 3CGFA 3EB0A 5CU6A 3R1QA 3DA6A 4MXAA 1R0PA 3SLSA 3IDPA 1XH5A 3H9FA 3FI3A 4FZ6A 2X9EA 1WMKA 4FIFA 5LARA 1Q8TA 3ZLWA 4USFA 5DHJA 2BHEA 2C3LA 1TVOA 4Q9ZA 2O3PA 3FHRA 2C30A 2DS1A 3DBEA 4E4NA 3VBVA 3OCBA 4IX4A 4ASZA 1K2PA 4UXQA 4DTBA 3LFQA 4YJUA 3N9XA 4BY9E 3ZFMA 1XO2B 2XK7A 4AOIA 2R3JA 3KQ7A 5I9XA 2P3GX 3M42A 3DBQA 2CCHA 3THBA 3U9NA 4OBPA 2YA9A 4H3PA 2LGCA 4ZZMA 4GV1A 5DT0A 1G5SA 5KBQA 4LOPA 4YLKA 5T68A 4XG6A 4CRLA 2XNGA 1H1WA 4DINA 3NNVA 5CVGA 5LXMA 4X6RA 1FVVA 2XRWA 4A4OA 1B6CB 5EYMA 3RK5A 2ITWA 4TWOA 5EQPA 4U97A 1OITA 3MW1A 1QPDA 4CEGA 2WEIA 3FC1X 3FZPA 5CSWA 2IZUA 3GFWA 2HENA 4FOBA 2XK6A 4BDBA 5IISA 5IQIA 4C59A 3LM5A 3LCOA 3A61A 4OR5A 3PYYA 5AIRA 1HOWA 5EOLA 4X3FA 4JG8A 3FLWA 4EI4A 3QA8A 4MWIA 1XBBA 1MQBA 3EL7A 3GU4A 4F9BA 3MH3A 1YDTE 3KN5A 4M0ZA 3V5PA 2VX3A 4WRSA 1CDKA 4AA5A 4NU1A 4JX7A 2B53A 2FB8A 2GNJA 4L3LA 4YZCA 5L2IA 1WBTA 5M4UA 2XNNA 4AE9A 5CXZA 3Q9WA 4G5PA 4G6LA 4FR4A 4FF8A 5J9ZA 4QMWA 3W32A 4I0SA 3UC3A 2W4KA 3Q04A 1M2PA 4FKLA 5ACKA 4WUNA 3AMAA 3BX5A 5C27A 4FT0A 1PHKA 1IG1A 3OMVA 1H4LA 4NFNA 5EHOA 3I1AA 4ZJJA 5B2MA 5D7AA 2A4LA 2XIZA 3HKOA 4FSMA 1CTPE 2G2IA 3WOWA 4BIEA 4BN1A 3ORNA 4E4MA 5HD4A 3NIZA 4YZNA 5FD2A 3MA6A 1Y6BA 5DRBA 5E8YA 3C4FA 2BFYA 4RZWA 3R1SA 3SQQA 1YOLA 2X4FA 3AD5A 4O7NA 4FYOA 5HO8A 5CWZA 4IB1A 3PXZA 1H0WA 4QP1A 3RKBA 4QPAA 4QYFA 3VUGA 4C4IA 4C37A 1PXIA 1J7UA 4AF3A 2QONA 2V7OA 4NL0A 5IH6A 2CGXA 4RPVA 2C69A 1H26A 4Y8DA 3E8EA 5AM7A 3O17A 4FKWA 3ATSA 1BL6A 3U51A 4F9WA 3DBCA 4CTBA 4YO4A 4FTOA 3LM0A 2VX1A 5A6NA 2VTAA 2VUWA 2JFLA 4FNYA 4FSQA 3MN3A 4MD8E 4QD6A 4XRJA 3UG2A 4X2KA 4A9TA 2VTIA 2WMUA 3G9NA 3HRCA 5TO8A 3E63A 1CKPA 4IACA 4BVUA 4JJRA 3AC3A 3W2CA 5HBJA 4O6LA 3F3TA 2B9HA 2VWYA 2QNJA 2XVDA 4XS2A 4AX8A 1YHVA 3G2FA 3QYZA 5FM2A 1K3AA 4G3GA 4NM7A 3LFDA 4FA2A 3GFEA 3OT3A 2A27A 3OTUA 4ZIMA 2UW6A 2YM4A 5AIKA 3ZUTA 1A48A 1ZOEA 5D1JA 3VS4A 5EK7A 2LAVA 3CKXA 5AP6A 4E4LA 3FPMA 3GCVA 3UVPA 1SZMA 4BBEA 4PDOA 4EWHA 2CKPA 3EYGA 2IZRA 4XG3A 3PG3A 4OW8A 3MY5A 4D4SA 2QOOA 2G9XA 5BUJA 4GK3A 3LFAA 3D5WA 4FIHA 5GINE 1E1VA 2Q83A 3ZO4A 1LPUA 4ZOGA 4ARKA 1GZNA 4Z7HA 3W2OA 4G17A 2QOKA 3A60A 4YZBA 5DNRA 4OAVB 2BZIB 1PMNA 3ALOA 4FIJA 4I0RA 5LVLA 5BYYA 5LQFA 5EYDA 1OBGA 5B2LA 5CSXA 5CAPA 4I1ZA 4YJQA 4JI9A 5BVDA 4IX3A 4D9UA 2RF9A 2XKDA 3V5LA 5HNIX 3U6JA 5EHYA 2JKMA 4QQJA 5FP6A 3VJOA 4KSQA 4O22A 1RJBA 2OF2A 5M53A 2XEYA 4Y72A 3MB7A 5H2UA 3OFMA 5DRDA 4I5HA 5AUXA 2VWUA 4BCQA 4PMPA 2Y6MA 1DAYA 4BWXA 5C4LA 3KF4A 3O8TA 2JBPA 4W4VA 3QQKA 2GHMA 3DKOA 1KE7A 2UZUE 1PF8A 4ENYA 4AOTA 1BI8A 4PTCA 3PXKA 3CJGA 3LZBA 3LQ3A 3C0IA 4BDJA 4B99A 4O0RA 2W4JA 3Q2JA 3TV6A 4RSSA 2P2IA 2RFNA 3IW6A 4X2FA 5I9YA 3D5XA 2RKUA 3LFBA 4J7BA 1KE6A 3RMFA 2QODA 3KVWA 3BHVA 4JRVA 5HNBA 1QPJA 3F61A 2XJ0A 3VUTA 3CD3A 4RT7A 4IC7A 3SA0A 2WAJA 4IWQA 5J1WA 3BEGA 5FXSA 4D2WA 2VRXA 4BL1A 2UW4A 4L3JA 3MA3A 1G3NA 1FOTA 3KRLA 3Q3BA 4X3FB 4LGGA 5BVWA 3N4UA 4LOQA 3OOMA 3C1XA 4FOCA 3WILA 2CN5A 4EH7A 4MVFA 4EZ7A 4J52A 2I0EA 2XRUA 4XUFA 1ZZLA 5ANIA 1XH6A 5L6OA 5L6PA 2XCKA 2WB8A 4HVHA 3NYXA 2GU8A 4IWDA 4DE4A 1M2QA 4BDKA 5BPYA 4EK6A 3MDYA 3R7OA 5HOAA 4OLIA 4D2RA 2VTJA 3PVBA 4AN3A 5CQUA 4EH2A 2OK1A 3FAAA 1GOLA 4R7BA 4CNHA 4BCGA 3SVVA 4FZAB 4X2NA 3V8TA 1H01A 3VF9A 2EUFB 4DG0E 3C4EA 5DVRA 4ZSLA 4DGGA 4G9RA 4O0YA 3QTQA 4PPBA 4A9RA 3IO7A 3ZH8A 1W8CA 4R77A 3W1FA 3VBQA 4M66A 4EH4A 3IG7A 3N51A 5DT3A 2OXDA 1R0EA 2YJRA 2OU7A 3O0GA 4FTLA 4MXXA 4TWCA 4YC8A 3UQGA 1FPUA 3C5UA 3RPRA 3L9PA 4FIGA 4PNKA 2XM8A 4OTIA 2JAVA 2OIDA 2X1NA 5IA1A 1W7HA 4QMSA 5IDPA 3PG1A 4QP9A 3QBNA 2GNLA 2GQGA 5DR6A 5FLFA 5AADA 5IKWA 3BV2A 1YI3A 2ITQA 2IJMA 3VHKA 4U45A 4IVCA 4H39A 3FLSA 4RZVA 1ZYSA 2XMYA 4TT7A 4YR8A 3GXLA 3TDVA 2BAJA 3UIUA 2GDOA 5E90A 5TE0A 3SXFA 4ALWA 1OKZA 3EFWA 2Y4IC 3NUYA 1DI8A 3TV4A 2VD5A 3ANQA 5M55A 5A4TA 3QZIA 3VS1A 2WTKB 5AR2A 4I24A 3MVHA 3HVCA 2X7GA 3FHIA 3ZTXA 2QKRA 4DLIA 4AXAA 5EQYA 4W8DA 1TKIA 1BL7A 2YM8A 4PWNA 5FXQA 4CZYB 1H00A 4M8TA 3L8VA 4UALA 1YI4A 3HDNA 1L8TA 2PYWA 1VEBA 3ZUVA 4F70A 3O7LD 5AP4A 3UO4A 4D4RA 4K8AA 3LQ5A 4RJ5A 3HMIA 5E1EA 2W1HA 3TJCA 4BDEA 2CGUA 2VWZA 3HECA 4PMTA 3EMGA 3MFUA 2X7FA 2YCSA 4NZWB 2GSFA 4AZWA 1SVHA 3SKCA 4JNWA 2FH9A 4F7JA 4G1WA 4E93A 4BBMA 4EJ7A 4D2SA 4FVRA 5FBNC 3Q9ZA 4HCVA 4BCNA 2R9SA 3FL4A 4FIEA 5ANEA 4C4JA 1GIJA 4FMQA 4NK9A 4OBOA 3RINA 5LWNA 4AGWA 3P23A 1ZRZA 3E88A 2XNBA 4YLJA 4PMMA 2WMTA 4RJ4A 1J7IA 4HZRA 4P90A 3D5VA 4FKVA 5G6VA 5AAGA 4WG5A 5I9ZA 5CU0A 4EK8A 4IM3A 1H8FA 4L7FA 1R3CA 2Z7SA 3FZTA 3QCSA 4RIYA 1GZOA 2VZ6A 5E1SA 4QQ5A 2RFSA 2I7QA 5L2QA 4DFXE 4U81A 3R0TA 3C5IA 3ATTA 4NWMA 4G34A 4BBFA 5AUTA 4EKKA 5K0XA 4QYHA 2IVVA 4B8LA 1R78A 3VUDA 3F5UA 3BU5A 3BI6A 4L45A 2VTMA 3C7QA 4C7TA 4UYNA 3WYXA 2HW7A 3DY7A 4EC9A 4EWQA 3I5ZA 1H24A 5KMIA 1H1QA 3CE3A 4K33A 3RP9A 3ALNA 3AC5A 2VTNA 4D2PA 5EG3A 4DFZE 3I5NA 2WTJA 3OWJA 5HX8A 1JLUE 2IVUA 3PY0A 2YAKA 4FKTA 2WMRA 3DBFA 4B0GA 4MTAA 4BC6A 2OJFE 4KA3A 3NW5A 4ACGA 4BTJA 2UVYA 3BYOA 4FV8A 4NCTA 2XZSA 4G5JA 5E8VA 5EH0A 1LP4A 3I6WA 4BWKA 4NEUA 4PL4A 4CG8A 3QHRA 3EQDA 4DTKA 3PP1A 4BWPA 4G9CA 3O23A 5BUEA 3OCTA 3U87A 4RIWA 3IW7A 4KBAA 3KXMA 3HNGA 3WF8A 1RE8A 3HP5A 1Q62A 4W4WA 4ZZOA 1H0VA 5AMNA 2E2BA 3PVGA 2WTWA 4WO5A 4MKCA 1KOBA 4IANA 1BYGA 2UVXA 2WQNA 3ZHPC 4GRBA 1YXTA 5K9IA 3NUSA 3AT2A 2OFUA 3IK3A 3BKBA 2QVSE 2X8DA 3LHJA 2BDJA 3ZZWA 1G8SA 4X21A 3DKCA 2HZ4A 4U0IA 4LFIA 3NVKI 5EYKA 2R3IA 3EN4A 5KMNA 3QTWA 4AU8A 4R6VA 4RVKA 3PJCA 4NTSA 5CSVA 5AA8A 4OTGA 2BDFA 2QCSA 3FYJX 4JDIA 4BR3A 3DXQA 2AYPA 4HGSA 2F7EE 4L01A 5HG5A 3FY0A 2NRYA 1R1WA 4ZTRA 3R9DA 4Z55A 2E9OA 4O7VA 3RK9A 4R3CA 2BZKB 2OO8X 1YXVA 3MSSA 5B0XA 4EOIA 4CG9A 3ORLA 2VTSA 4EHZA 4NFMA 1SMHA 3ERKA 2YDIA 2CJMA 3CC6A 4FZDB 4QPSA 5HBHA 5CEKA 4DCEA 2QLUA 4E6CA 3VW8A 1JVPP 4A9YA 3IKAA 4MCVA 3ELJA 4Z9LA 3REPA 2PVFA 2W7XA 3GGFA 5BVKA 5C26A 2O5KA 4O6EA 3B2TA 2BCJA 3R9OA 3TT0A 4DN5A 2RIOA 3UE4A 2PK9A 3EZVA 4PTGA 3LJ1A 3LLTA 4JBOA 4EZ5A 2PZRA 5M44A 4QMTA 3UOLA 4X3FC 3HMMA 4GT4A 2W9ZB 3AQVA 3ZEWA 2ZOQA 3W18A 4CKRA 2BTRA 5J9LA 5BX0A 5HE3A 2C6IA 4BCJA 4CMOA 4BKYA 1TQPA 1WAKA 2FSLX 4CLIA 3HAVA 1JSTA 1Y8YA 4FK3A 3T9TA 1OIQA 2H9VA 3R8ZA 4EH3A 3A7HA 4YJSA 2R3GA 1NVRA 5FM3A 3FZRA 3I7CA 3RAHA 1OL1A 2O65A 3PP0A 3BZ3A 4HNFA 3NIEA 3V8SA 4AZEA 4D5KA 3QHWA 4F9YA 3QGWA 5A3XA 4WA9A 4YTCA 2RG6A 3NS9A 4CTCA 2HY0A 2VV9A 3DU8A 4RFMA 2VWXA 3GC9A 1PYXA 4BZOA 4GSBA 2GTMA 4KD1A 4I5CA 4FNXA 4QYEA 3IDCA 4YGAA 3L9NA 4IB3A 3R1YA 3PXFA 3VIDA 2PULA 4FUXA 4MWHA 4UMQA 2J90A 3PTGA 4GKHA 4FV4A 5JFSA 2PUUA 3CTQA 5HGIA 3JR1A 1XQZA 1W83A 4ZSJA 3ORTA 2YWVA 5JZJA 4IX6A 4F1OA 4EONA 3VUKA 5IEVA 2WZJA 3V5WA 2OJIA 3ID6C 3OXZA 4RVTA 4UV0A 3MPAA 3PIZA 1YI6A 4UMUA 4RIYB 2R0UA 2Z7LA 2C0TA 5M57A 4H05A 4FC0A 2WMAA 4KSPA 3PIYA 4IAIA 2QI8A 4QO9A 5FDPA 3VF8A 2CDZA 1Q8YA 4EK5A 2XNOA 5DEYA 4LQMA 4LL0A 3OC1A 4IZ7A 2IW8A 5CAUA 4C0TA 2KTYA 2WTKC 2V7AA 3NYOA 4NIFA 1MRYA 5CEPA 4W8EA 3NUUA 4JBVA 1R39A 5HESA 3PUPA 3FUPA 5BUIA 3NVMB 2WIHA 3EQIA 1J3HA 3OXIA 4C36A 3BLRA 4R8QA 3ENHA 1B39A 2VNWA 1PXPA 3GENA 2VO6A 3II5A 4OUCA 3OCGA 1ZZ2A 2OGVA 3FLYA 2ERZE 2GNFA 4JR3A 4DBNA 3EWHA 3R1NA 2FGIA 4QMZA 5CENA 2CSNA 2HK5A 4A06A 5EW9A 3PA5A 5B2KA 2X81A 4FKPA 3CXWA 3HV5A 5F4NA 4BZDA 3JYAA 4IFCA 2ZAZA 5JFWA 5LVNA 3SG8A 2CGWA 3FL5A 3Q4UA 4OTPA 4X2JA 4QNAA 4RIWB 3OVVA 4ZSGA 1O9UA 3NWWA 5ACBC 1UNHA 3DAKA 3LMHA 3BWJA 3QU0A 1BI7A 3FPQA 2ZV8A 1CM8A 4I23A 5AM6A 3U6HA 2WNTA 4FKGA 4FGBA 4I22A 5CZHA 1OMWA 1WVWA 2JITA 1IRKA 5EHLA 4I6HA 2W96B 5EI2A 1M17A 4XP0A 2GS7A 3IGGA 4MK0A 3OG7A 3DTCA 4NT4A 4ERKA 3QUPA 2FYSA 3NYVA 2B52A 4NUSA 4A07A 1ZYLA 3Q53A 4H36A 3KGAA 1PMVA 2JDVA 5CLPA 3QX2A 4JOAA 5J7HA 1WBSA 2FSMX 2G1TA 3LW0A 5J7BA 3UQCA 3U54A 3BPRA 3UDBA 5FEDA 3TNWA 4D4YA 2CKOA 2IWIA 2ONLA 4NM0A 4TRLA 3RWQA 4GUBA 4R1VA 2Y9QA 5AJQA 3PFQA 3LAUA 3CTHA 3AGMA 3HV7A 5IA2A 2B7AA 1CSNA 2X2KA 4FKRA 4AT5A 5A54A 3ZXTA 2YN8A 3L9LA 4HNIA 2ZJWA 3LE6A 4K11A 4EUUA 3E3BX 5HE1A 4S34A 2ZMDA 4RA4A 5CEOA 4GFGA 2JBOA 5IA0A 5H9BA 2R3PA 5TF9A 4K1BA 1L3RE 3QUDA 4JBQA 1JKSA 4N57A 3ODYX 3O71A 3PLSA 3L8XA 3EN5A 2UW7A 4IDTA 4U44A 5C1QB 4BI0A 5K3YA 5TR6A 3Q4ZA 4MEDA 1ERKA 3LJ2A 3K54A 4XG8A 2VWBA 4ASDA 3KULA 2XK3A 3DTWA 5KMOA 3OBGA 2OZAA 4GUEA 3FXZA 3WF7A 1F3MC 4EH6A 3AC2A 3TTIA 2X6DA 4WNKA 4D55A 5H3QA 3ZO3A 2JKKA 3S4QA 3MIAA 3KB7A 3C9WA 3KREA 3HAMA 2J7TA 4FSNA 2IVSA 2OI4X 4D4VA 5HX6A 2WIPA 3H3CA 3V5JA 4AG8A 1OIUA 3ENMA 2EU9A 4YZDA 5M4FA 1GY3A 3TACA 3LCKA 4KKEA 1WFCA 5CVHA 3KCFA 3TJDA 4FSZA 3U4UA 3KN6A 4TYEA 4HJOA 4PX6A 1PY5A 1Q8UA 4U3ZA 5LMKA 3DFCB 3K2LA 4FE2A 1ZMWA 2QO7A 2OG8A 4EOMA 1YWRA 5M51A 2PPQA 4EBWA 4F7LA 3OTVA 2ITVA 1H27A 2VGOA 4I94A 4PF4A 4DBXA 2WTIA 3VQUA 4C57A 2GS2A 4C4HA 3MYGA 2W1IA 1MRVA 1IAHA 3A62A 4W4XA 2X7OA 1JPAA 2B1PA 2FVDA 4TNDA 3QRUA 4ACHA 4YTFA 3CLYA 3S0OA 2CNVA 2CPKE 2UUEA 5H8BA 5BVEA 1BUHA 3ZM9A 2ITPA 4M68A 2BIYA 5FRIA 4CKIA 4XX9A 4F6UA 3GBZA 3DDQA 4JS8A 2UW9A 3DNDA 5EKOA 4AW0A 5A9UA 5I9VA 1K9AA 4H3QA 1KE9A 3BHUA 2HOGA 4EK3A 4EOLA 3H30A 4A9UA 3NUXA 5HIEA 3HDMA 2DWBA 2QOFA 3NW6A 3FKNA 3UMXA 5HE0A 1WBPA 4D0XA 3EFLA 3WE4A 5LMBA 4QMXA 2Y4IB 2WHBA 4WIHA 2BFXA 1KV2A 2XBJA 1H07A 3CY3A 5AR7A 3U9CA 4C61A 3G5DA 4NIFB 1RDQE 1KUTA 1M52A 4L46A 5I9UA 5EI6A 2J50A 3IGOA 5IZFA 4NKSA 3Q96A 4DT9A 4I4EA 4DYMA 3EZRA 3P5KA 4G3DA 3HMOA 4TKSA 3PJ2A 5ANJA 4BCPA 3LXPA 4E6AA 5AV4A 2VX0A 3JVSA 5HI2A 4DHFA 4XV9A 5BMSA 4UMTA 5G1XA 4RWIA 3GCPA 3ZLSA 5FP5A 1IR3A 4L9IA 4BTFA 3A7JA 4CSVA 3I79A 3QTUA 3UO6A 4FV5A 2QOLA 5HU9A 2XNEA 3MTFA 2UV2A 3F5XA 4ZTNA 3ZLXA 5M4CA 2C5VA 2J9MA 3RNIA 2BRHA 3QRKA 4XG2A 3G6HA 2VTOA 2SRCA 2YHVA 3KF7A 3PA3A 4YBJA 4JLCA 4HPTE 4XOZA 4RJ6A 3PZHA 5BYLA 2GFCA 4WHZA 3RAIA 5IH4A 5JGAA 3TUDA 3SX9A 3QC9A 3LKMA 3HZTA 3Q5IA 2J2IB 4FI1A 2HAKA 3FC2A 5IQHA 2W5AA 4A9SA 4FTAA 4RRVA 5ANKA 4AOJA 3PZEA 5AR8A 3F9NA 2WU6A 2YAAA 4ALUA 2OIBA 3EQBA 2R7IA 3H4JA 3QD3A 4W4YA 1SNXA 2B54A 4FKJA 4GIIA 4XG4A 2W1CA 4ANOA 3F2RA 2C6OA 4EOQA 3LPBA 3ORZA 2XKFA 4ZLOA 4GYGA 1CMKE 1GIIA 3W2QA 4KUJA 3KXXA 4EOJA 3UBDA 2W05A 4AUAA 2QU6A 4UX9A 2YACA 3QQGA 3G0FA 4RWJA 4HW7A 3IPHA 4IB0A 3HA6A 3R8LA 1FVTA 4FTTA 2BZJA 3L8SA 5CU4A 5I5ZA 1G8AA 4OBQA 4FYNA 3VS5A 4C4GA 1A9UA 4J95A 4O7YA 4NM3A 3GQLA 4DEHA 2R3NA 5J8IA 3GC8A 3FLZA 3P7AA 4OT6A 3A7GA 3R6XA 2VN9A 5BVOA 5EM6A 3NNXA 4RX9A 3UNZA 4ASXA 1M7QA 3FI2A 4UWYA 4PQNA 2P33A 5L2WA 1KE8A 3ZZEA 3ORIA 4KRDA 2JC6A 1OPKA 3EIDA 2P2HA 1FVRA 3HLLA 3HYHA 5CQWA 3ZUUA 4NCTC 1TQIA 4PRJA 4E1ZA 2PU8A 4KIPA 4JQ7A 4GVAA 3F3VA 4Y85A 5CAQA 5B7VA 4IADA 3UZPA 3KULB 3UYSA 3C4WA 2OZAB 1MRUA 3I6UA 3KA0A 2PUIA 2YM3A 4GFMA 4JR7A 5AEPA 4P5ZA 1JKLA 4YNEA 4ZY4A 2CKQA 3W8LA 5L2TA 5GNKA 4KIQA 4CMTA 2HYYA 4YSMA 4EOOA 5HIDA 4IX5A 4Y5QA 3NZ0A 1JWHA 4H58A 2YABA 3ANRA 4BCHA 2ZM4A 4UMPA 4BIBA 1UU9A 5JRQA 4OTHA 1OKWA 4BF2A 4TL0A 5HO7A 3P4KA 3NUAA 3FMKA 5C4KA 3PY1A 5HTIA 3H0ZA 4BIDA 3UNKA 2AC3A 2WMWA 5JQ8A 1VYWA 5HTCA 1KOAA 3SOAA 3B8QA 4ITJA 4Q2AA 4FTUA 1ZY5A 4ACDA 4ID7A 3UOKA 4FL2A 4IVDA 4UMRA 4IVBA 3QC4A 3DJ7A 4J98A 4F65A 3R2BA 4LV5A 3ITZA 4ZP5A 4LUDA 1H1PA 2WO6A 4XYFA 3F3WA 3GQIA 3PPZA 1QMZA 3M1SA 5CU2A 3IW4A 3V01A 3P7BA 4U6RA 5H8EA 3LXNA 4LRJA 3EL8A 3FMMA 4QMUA 2VWIA 4DEEA 4JIKA 3ZCLA 4FZFB 4K18A 4AFJA 1OBDA 4M13A 3MH0A 4BKJA 2HXQA 3D9VA 4QOXA 3KVXA 2FA2A 3OROA 5E9EA 4NH1A 2JDTA 3D2IA 3OT8A 2WQBA 4Z7GA 4XMOA 2XH5A 3PXYA 3PXQA 2YITA 3WF5A 5C9CA 4L52A 4O0WA 3D7TA 1OUYA 5AP3A 5CALA 3PE2A 2ETKA 4ANQA 4NJDA 5AWMA 3P08A 3C4XA 2W1DA 2JDSA 4JDJA 3LCDA 4PDSA 1Q61A 3V5QA 4ZY6A 2BMCA 4PY1A 1U54A 3JS2A 2W4OA 4F63A 4F4PA 1LUFA 3F5PA 4QP3A 3E87A 4WOVA 3KMMA 2YCQA 4M12A 3W33A 3WYYA 3DS6A 3G33A 3DK7A 4DEDA 4DA5A 1PMEA 1NY3A 2C5NA 2VO0A 3FDNA 3R2YA 4Q5EA 3RWPA 1ZLTA 2WMSA 3GVUA 4BYJA 4BDIA 4P4CA 4Y95A 5L8KA 4RJ7A 5CF5A 4O7SA 1OKVA 5K4JA 4HCUA 3BWFA 2B0QA 1JNKA 3BBWA 3DT1A 4PNIA 2C6LA 3TTJA 5K5XA 4RVMA 3GOPA 2GS6A 3C0HA 3RPOA 3ULIA 1J7LA 3AT3A 4L8MA 4Y73A 3AD4A 5J5TA 2UZTA 2WMVA 4W9XA 3V6RA 2X39A 3D7ZA 2R3QA 3DKFA 4K9YA 1V0BA 3A4OX 3KY2A 3NRMA 4ITIA 3DK3A 3DKGA 3HUCA 4FKUA 3NLBA 4GMYA 2A0CX 4FKQA 5EDQA 3WZJA 4YURA 2EXEA 5IPJA 4ITHA 3EKKA 3ZBXA 4DFBA 4GG7A 4OGRA 4XG7A 4E26A 3EQRA 5DH3A 2ZV2A 2OJJA 4GCJA 2UZLA 5ETIA 2GTNA 1W84A 2JGZA 4AAAA 3CQEA 3DXPA 3QQFA 3MH2A 4JBPA 2VNYA 2CNUA 1IASA 5IG1A 5A4LA 2IVTA 1KV1A 3Q9XA 3EQFA 3UJGA 2UZEA 3TKHA 1P2AA 2C5XA 2IZTA 2RSVA 3DV3A 3MVJA 3UC4A 3VRYA 5BNJA 4K77A 2QR8A 1BX6A 3I81A 2Q0BA 4RMZA 4XV1A 4FEVA 4XBRA 4EHGA 3S1HA 5AUWA 4CFVA 5IUGA 2VO3A 2YLFA 3LFSA 2BRMA 4U80A 1UWHA 3GEQA 5CSHA 2OWBA 4MBIA 3B8RA 3D83A 3U8WA 4B6LA 4OTDA 4PPAA 2B9IA 3FMDA 1PXNA 4M15A 4I6FA 4O0UA 5CNOA 4BCOA 3KK9A 4LRMA 2XEZA 5AP0A 5IUHA 4TNBA 1SNUA 2HZNA 3F2NA 3TUCA 4KRCA 3ZSGA 1JAMA 3NCZA 4KNBA 5IEXA 3A7FA 5FBOA 4QMVA 4Q9SA 4ENXA 2R3FA 3P7CA 4RBLA 3TNPC 1ZYDA 3EN9A 2C5OA 1YW2A 2F57A 3F66A 3ZYAA 4AW5A 5A4EA 3GCUA 2PZYA 1ZYCA 2XNMA 3FQSA 1Y57A 4BDFA 5JEBA 5JGBA 3AD6A 4EQMA 4QTEA 2XIXA 5IQCA 3FSKA 3G90X 1YDSE 2JIIA 5HHWA 4IJ9A 4AZFA 5KX8A 4PUZA 4JAIA 1OUKA 2B9FA 3BHTA 2PE2A 2J51A 3QAME 4EUTA 5HBEA 5KO1A 2PMNX 2IG7A 3SRVA 3GU6A 4C2WA 3WE8A 5E8UA 3PJ8A 1NVQA 5DLSA 4AGUA 4DEGA 3N4TA 3S95A 4EHVA 1QPEA 1AQ1A 2Y0AA 3KXHA 4LV8A 4AFEA 2F4JA 3GI3A 3NUNA 3BHHA 5CSPA 5CI7A 2PZPA 2XK9A 3POOA 3CIKA 4IZYA 4BICA 3W55A 3ACKA 2CCIA 4TYIA 3ZS5A 4DTAA 2QU5A 2XJ1A 5ITAA 3POZA 4WKQA 3G0EA 2PVLA 4ZTHA 3ZLYA 3FMLA 2WGJA 3WIKA 2WTCA 5FTQA 3ORPA 3ET7A 4H3BA 4QTCA 3RJCA 4BGGA 2ONLC 4TN6A 5HKMA 1YDRE 3CTJA 3OS3A 2C68A 2C1AA 5C8NA 2PVNA 5M08A 3DZQA 4O2PA 4ANLA 5CANA 2CMWA 2IN6A 2XK4A 4IEBA 3R04A 3FSFA 2G01A 3M2WA 3QXPA 3UODA 4EORA 4M0YA 4WSYA 3MIYA 1ZOGA 2QURA 5CT7A 3EHAA 3LXLA 4AS0A 1URWA 4MXYA 4PP9A 3GNIB 3NGAA 4FG7A 4EYJA 4FT7A 1JSVA 1UNGA 1HCKA 2WEVA 5DI1A 5DIAA 2JDRA 3RPVA 2Z7QA 5HE2A 3OP5A 2GNGA 3ZC6A 4S31A 3RI1A 2JD5A 2QOCA 4EH5A 5HU3A 5HCXA 4KBKA 4CFMA 2J0KA 3OWKA 3R83A 3FY2A 4GVJA 3D7TB 5HIBA 2I0YA 2UZOA 3DAEA 3PSDA 4QMLA 4RX8A 4AN2A 4TYJA 4HYSA 1UU3A 2EXCX 2Z2WA 3BRBA 4N0SA 5AP2A 3UMWA 2WOTA 5ETAA 2W17A 1IEPA 2YDKA 5HLNA 2V0DA 4AQCA 4ANNA 3EYHA 3VBXA 4F1MA 3BELA 5LCJA 2W1ZA 4ZS0A 2OZOA 2BHHA 4FTMA 4AZTA 4CCBA 1ZXEA 5AAFA 4DH3A 5FGKA 1U54B 3GC0A 4XH6A 2OIQA 3DQXA 3QCQA 5HLWA 5EOBA 1URCA 1Q5KA 4A7CA 1ZY4A 4DITA 4DEIA 4MNFA 1QPCA 2CHLA 4QYGA 1IA8A 4I3ZA 2BROA 5LMKC 4X7QA 2ACXA 2YERA 4E5WA 4A4LA 4FVPA 4DH8A 2GFSA 1UVRA 2VTLA 3CSVA 3QA0A 2CLXA 5T3QA 2J4ZA 2C47A 1UA2A 2I1MA 3UIBA 2VU3A 4MXCA 2XKEA 4BCFA 2IW6A 4D1ZA 1GNGA 5FTOA 5CYIA 4B4LA 4Z16A 3UYTA 2FO0A 2H8HA 4QQCA 2BR1A 4DGMA 3G51A 4FTCA 3ETAA 3K3JA 4ZS4A 2P0CA 2ETMA 4DGOA 4LI5A 2QOQA 2ZB0A 5IMEA 3P9JA 3HV6A 3NDMA 4W9WA 4NKAA 5JGDA 4G6OA 1KWPA 3FWQA 5DN3A 4FTIA 3KK8A 3RPYA 4FK6A 5BMMA 5HEZA 2VTTA 3DOGA 4QP7A 3O8UA 3QKLA 4ZXTA 3HRFA 4DAWA 4F64A 3EH9A 4FVQA 2PVRA 3TNQB 3VAPA 2AC5A 3P79A 4F0GA 2KULA 4O7LA 3GCSA 2EXMA 3BLHA 5CEIA 5C8MA 3F82A 3UP7A 4ANMA 3R01A 5LWMA 3ZOSA 2C3JA 4J71A 3F69A 4U8ZA 3GUBA 4UWBA 4ZSEA 2UW5A 1OL5A 4RA5A 4TPTA 1ZOHA 1XJDA 5CI6A 4UWCA 3VBWA 2JDOA 3DB8A 3KFAA 4ZK5A 5IQEA 4FICA 2W9FB 2C6MA 5AFVA 1WBWA 5E8XA 3P0MA 2W1FA 2CKEA 3R8VA 3S3IA 3D0EA 3ZDIA 4USEA 2R3MA 3JPVA 5EM5A 4IWOA 1UU8A 3FBVA 1MP8A 4M14A 5E92A 4HYUA 3NR9A 4C38A 4PMSA 4GEOA 4HPUE 5CF4A 2XUUA 2C6KA 2Z8CA 3AC4A 3VUIA 5LVOA 3PPKA 3ZXZA 3O50A 3FLNC 2PVJA 2F2CB 4GFOA 2ZVAA 4GKIA 3RBWA 4CLJA 3Q2MA 3VN9A 4DFUA 1MUOA 3DGKA 3IW5A 4KKHA 3PPJA 3TZMA 4E4XA 4MXZA 1A06A 2UZNA 4RQVA 4WG4A 4YNOA 4CFXA 4FGRA 3TZ8A 4Y83A 1WCCA 4QP6A 2ZMCA 1ZAOA 5JMSA 5LOHA 5BQ0A 1VR2A 3SRVB 4V0GA 4WSQA 4BI2A 5L2SA 4AGDA 3WZEA 1TQMA 3E7OA 2OH4A 1JOWB 3OD6X 4FTQA 3DFAA 3RZFA 3VS2A 1FBNA 2VTQA 4J97A 4BDAA 4CFNA 3F7WA 1VZOA 5F20A 4F9AA 3CEKA 4U40A 2JEDA 5HCYA 2NO3A 4NM5A 5FXRA 4HVIA 1OPLA 2B9JA 2YLEA 1F0QA 2R3LA 3EJ1A 4I5PA 4YJOA 5FDXA 4HGLA 3HEGA 2O2UA 3QTIA 3ZEPA 4AT4A 3Q4CA 1NW1A 3ZBFA 3G15A 2CNQA 2XBAA 3LFFA 5E8SA 2PWLA 2VTHA 4FV6A 3MJ1A 3NPCA 3QUEA 4QP2A 4E20A 3RZBA 4GH2A 3ZRLA 4MNEA 4XNEA 4PTEA 2BZHB 3SC1A 4WUAA 3W16A 3T3UA 4G6NA 2W0JA 4K0YA 4C2VA 3SW7A 3AXWA 3HUBA 1Q3WA 4K2RA 4IAFA 3B2WA 2PE0A 3QZFA 3MB6A 1OGUA 4QTAA 5DA3A 2BPMA 2JIUA 4O81A 3AOXA 1XH9A 1YWNA 2W1EA 5IA3A 3DB6A 5HG9A 3DJ5A 3EN7A 5KE0A 4UEUA 4BCKA 5DWRA 3UPXA 4EH8A 3QTSA 4ANBA 3OWLA 1Q8ZA 1XBAA 4QNYA 1X8BA 4MXOA 5HD7A 5J95A 4DH5A 2UZWE 4II5A 4HCTA 2ITNA 4YO6A 3E8DA 4F9CA 4F6WA 5IMXA 4I4FA 3W2SA 4UY9A 4FSUA 3RK7A 4FSTA 2R3HA 4JQ8A 5LVMA 3KXNA 5T6KA 4ZJVA 2IPXA 4O7ZA 4S33A 3L9MA 2VWWA 3MESA 1J91A 2XIRA 3AT4A 3MV5A 2WD1A 2YFXA 4PPCA 3TWJA 3DNEA 2OBJA 4ZSAA 1I44A 3UPZA 1XWSA 1QCFA 1YHSA 3VVHA 1U4DA 1XR1A 3QX4A 4V01A 4TWNA 2BAQA 2YDJA 3AGLA 3L8PA 1H1SA 1OL7A 4DH1A 3BCEA 3W10A 4CFUA 2JIVA 3A2CA 2R64A 3TXOA 3GT8A 4APPA 3KL8A 3QZHA 4Y5HA 3FXWA 2Y8OA 2PMIA 3MPMA 4RFYA 3ZFYA 2CN8A 5DT4A 3E7VA 3VJNA 5J5SA 1I09A 2X2LA 4OTRA 3OXTA 4GL9A 4YHJA 3ZMMA 4CVAA 5CEQA 4EKLA 1UKHA 4NW6A 3F2AA 3VBYA 3VS7A 4BCIA 2OF4A 1Q8WA 2Z7RA 5HTBA 5IA4A 5CASA 2YCRA 3I60A 4IM2A 4TTHB 3SXRA 3CPCA 3DJ6A 5AUYA 3VWAA 4EYMA 5DE2A 3BYSA 5KNJA 1RW8A 2FUMA 3BQRA 2PZ5A 2EB3A 3CJFA 2Y7JA 3I0QA 3PWYA 1M14A 2XS0A 1YRPA 3WZKA 3FMJA 4ANSA 3A8WA 2AUHA 2YISA 4BGHA 3DAJA 3EQHA 4DEBA 5DYJA 2R4BA 3HA8A 4FBXA 2UZVA 4M7IA 4WT6A 5A4CA 3OEFX 5CNNA 3R7IA 3WZDA 5GZ9A 3QL8A 3TUBA 3MFTA 4O1PA 1M7NA 1FMOE 4XG9A 3O8PA 2YIRA 2WTVA 4WNMA 4H1JA 4EZ3A 3BE2A 4D1XA 3K5UA 5E8WA 5AR3A 4IZ5A 4JXFA 4TWPA 3V5TA 2Z60A 3COHA 5DGZA 3V3VA 4L68A 4DF3A 4KIOA 5HLPA 1DS5A 3FYKX 2WQMA 2V55A 2ZM1A 2QG5A 1WZYA 1GJOA 3U4WA 4FTRA 5BYZA 4YC6A 4JQEA 4ZY5A 3FMNA 3ZRKA 2X4ZA 5J9YA 2P4IA 2F2UA 5D11A 3SHEA 3KXGA 2YM7A 4LMNA 3EQCA 4BHNA 2WMXA 2HY81 4FSYA 2JKQA 4NSTA 2XYUA 4JL9A 4MX9A 3D94A 5TT7A 4WG3A 4QMMA 2WXVA 3BQCA 5JQ5A 3EKNA 1OPJA 4ZAUA 5JT2A 5EDRA 5AUVA 2OKRA 2ITZA 3LFEA 4YMJA 1OM1A 2R0IA 3R8MA 2NNWB 3EN6A 4KINA 4CYJA 5IF1A 3VNTA 1PXLA 5EFQA 5HG7A 2ESMA 4YHTA 4ZTMA 2BRNA 5I3OA 4AZVA 4MD9E 4HYHA 1XH8A 3BGQA 4F1TA 5ICPA 2QG7A 4UZHA 2E9PA 3CP9A 4FEWA 3BV3A 3UZRA 4BI1A 1Q41A 4MQ2A 5F95A 1W0XC 1GIHA 5DOSA 3OZ6A 2J0MB 3PWDA 1XHAA 4V0GB 3FV8A 4TZRA 2C4GA 5E7RA 4CV8A 2C3IB 5IQAA 4FEQA 4I20A 4QPMA 4RIXB 3PVUA 5GJFA 3QQJA 2BAKA 5AV0A 5GIPE 4YPDA 3MVLA 3ZSIA 4UN0C 3R8UA 5JRSA 2J0IA 4KBCA 4HZSA 3RCJA 3FXXA 1Q4LA 4M3QA 2X2MA 3HMPA 3UVQA 2UW3A 4XJ0A 4DGLC 4C35A 2F7ZE 3WZUA 4ZLYA 3A8XA 4FTKA 4CYIA 2BTSA 5EM7A 4YP8A 4F08A 2Y4PA 3KCKA 4OTWA 4MNEB 1W82A 4IZAA 2Z02A 3VUMA 4WNPA 5FG8A 2OW3A 2J0LA 5HVYA 3UG1A 4AA0A 3VQHA 2VAGA 3LFCA 4O2ZA 4I5MA 1M2RA 1YXXA 3LOKA 3RHKA 2DYLA 2VTPA 3LVPA 5KHXA 4KIKA 4R3RA 1W98A 4M67A 4O7WA 3VBTA 3LCSA 4J1RA 3TNIA 1J1BA 4FODA 3CCNA 1OKYA 4FT5A 5JN2A 1ZWSA 4GW8A 4EQCA 1Y8GA 4OTFA 3D4QA 3O2MA 5D7VA 4MAOA 2UW8A 3U55A 1AD5A 2XP2A 3D2KA 4IW0A 3COMA 5C03A 2BKKA 2ZM3A 3LLAA 3NMUF 5FEQA 4IE9A 2W5BA 4PL5A 4XV2A 4P5QA 4C02A 1IA9A 2W1GA 2VO7A 3PJ1A 5DFPA 4L42A 5TKDA 3RCDA 4YSJA 4IM0A 5HZNA 4U9AA 4ONAA 3AMYA 3FQEA 3CS9A 4GG5A 3PVWA 3TN8A 5E91A 4PP7A 5IH5A 1REJA 3GC7A 2NPQA 5L4QA 4YJPA 3HGKA 3K3IA 3ROYA 4CQEA 3OY3A 4AGCA 3OW4A 3PXRA 3KEXA 3MFSA 3RNYA 2BRGA 3TZ7A 2XK8A 3VHEA 1IAJA 2OLCA 3MGYA 3TCPA 2QOHA 2WFYA 3R7GA 3MH1A 4RX5A 4AWIA 5IA5A 4FX3A 4C4EA 1Q3DA 3FKOA 2XB7A 2XM9A 5K4IA 4M69A 5F9EA 2ITOA 4LM5A 4G2FA 3C0GA 3P78A 1FGIA 4UBAA 4FG9A 5D9HA 1Z9XA 4ZJIA 2I0VA 4QP4A 2GHGA 2PMLX 1PKGA 3QTZA 4C4FA 3OY1A 2BUJA 3C13A 2XCHA 3C4CA 3C51A 3COIA 4TYHA 1YQJA 3ZRMA 5K5NA 5GJGA 2C6DA 4FTNA 3PA4A 2DUVA 3AG9A 4HYIA 5HNGA 1GZ8A 3PSCA 4JAJA 4RVLA 1UKIA 2WMBA 2XF0A 1DM2A 3MVMA 3R7UA 3RALA 2QC6A 4E6DA 3G9LX 3I4BA 1JKKA 2X8IA 4G3FA 5AX9A 3AC8A 3UIMA 2G2FA 3UP2A 3NNUA 3OCSA 4IMYA 3ZU7A 1BLXA 3MWUA 4C3FA 1GAGA 5AV1A 3EQGA 5JFVA 4EQUA 4D2TA 3FZSA 4Y46A 3QCYA 2V62A 4IBMA 4XHKB 4CD0A 4ASEA 1YOMA 2A19B 4JX3A 3QALE 4EC8A 2ZB1A 3HL7A 4IHPA 5GIOE 3NAYA 3QXOA 3VW6A 5JKGA 1OB3A 2HXLA 4FV7A 4I0TA 3H9OA 3ORMA 2RG5A 4HGEA 4U41A 4MBJA 1JBPE 4AW2A 5A6OA 2ITUA 5KMMA 3FQHA 2ZYBA 2QOIA 4OT5A 5CY3A 3FI4A 3IS5A 4E5AX 2QLQA 4F0FA 4BKZA 3H0YA 2V22A 4M97A 4RJ8A
chains in the Genus database with same CATH superfamily
3DZOA 4O7RA 2YIQA 2PVHA 4I21A 4IAKA 3NCGA 4S30A 5FWKK 3RVGA 4GT5A 4BRXA 3UIXA 3FZ1A 2O8YA 3Q4TA 4IAYA 4L53A 2ITYA 1JQHA 3Q5ZA 3A4PA 2GCDA 2NRUA 4U43A 5DPVA 3QCXA 4AE6A 5LMAA 4DFNA 5EYCA 5LVPA 5M56A 4O83A 4B8MA 2J5EA 4WBOA 3NUPA 5AX3A 5D10A 3M11A 2GNIA 4UZDA 2BDWA 5IUIA 1WVYA 3P86A 4J96A 1KSWA 5EKNA 3QWJA 2O0UA 1OL2A 5AV3A 2RL5A 4FEXA 4X0MA 4QRCA 4DH7A 4O0VA 3MI9A 5HQ0A 3JY9A 4FT9A 3WI6A 5E4HA 5KKRC 5JK3A 2IZSA 2OXXA 3QGYA 1Q99A 4IQ6A 4Z3VA 1FINA 5A14A 4FV9A 1APME 2QD9A 2A2AA 4G31A 5A46A 4QDEA 4GK4A 3ZM4A 4S32A 1PXOA 2CLQA 4O84A 2QOBA 4EOSA 2I40A 4BTMA 4J8NA 4BDDA 3ACJA 1T46A 5HORA 2QR7A 1YVJA 3F6XA 2PL0A 4IDVA 1S9JA 5AR5A 4FSWA 5E8TA 3NYNA 3VO3A 4J8MA 3DCVA 3RM7A 1YWVA 3WBLA 4IC8A 5AAEA 5BVNA 2IW9A 4FT3A 3TL8A 3OW3A 3IOKA 5DMZA 2P55A 4C33A 4O21A 2V5QA 4L67A 1U5RA 2ERKA 2C5YA 1XBCA 4JDHA 4FSRA 5EDPA 2ZV9A 4H1MA 5J79A 5JH6A 4AT3A 3VS6A 3AKJA 4O82A 2BRBA 4I41A 5ETCA 4FV2A 2YJSA 4KB8A 2Y6OA 4KABA 2HWOA 4UYAA 4F99A 2PUNA 3VONA 4CGAA 4KIKB 3SXSA 4CT1A 4U5JA 4ZZNA 3P1AA 1Q97A 4RX7A 4YHFA 2E9UA 2PVMA 3CBLA 3Q6UA 5BVFA 3UO5A 2JLDA 1E1XA 4XLIA 3MBLA 5CAVA 1H08A 4FG8A 2PE1A 1OI9A 5IQBA 5JFXA 3CGOA 4L43A 2YM6A 3FLQA 4DG3E 2QHNA 1V1KA 3TI1A 3S2PA 4O86A 4MF1A 5M06A 1OZ1A 3MTLA 2BKZA 3BEAA 2I0HA 2J6MA 1WVXA 5CXHA 3OHTA 4WD5A 3O51A 3R00A 4RLKA 3WARA 3NW7A 1PXJA 3T3VA 1ZARA 5CF8A 1F5QA 4Q5HA 5AUZA 4BHZA 4R78A 2R2PA 4IXPA 2BIKB 5HG8A 4QTDA 4HVDA 4O0TA 2PSQA 3ZDUA 4YZ9A 3W2RA 4EK4A 2ITTA 4R5YA 4QT1A 2W06A 3FE3A 4RLLA 4QTBA 4M69B 3UOJA 2OICA 1OVEA 4FZ7A 2GQRA 2VWVA 5JSMA 1ATPE 3TIZA 5LJJA 4PDYA 4IAZA 2BILB 4P2KA 4X2GA 4D28A 3QD2B 2YZLA 3OUNB 4DDIA 3W8QA 5GJDA 2HW6A 3COKA 3TZ9A 4TYHB 5M07A 4NW5A 2CGVA 4GU9A 1WBOA 2WMQA 3OOGA 4RC3A 1NA7A 1FGKA 4FTJA 4LGHA 4RGJA 4YTHA 2PZIA 4YTIA 5I0BA 3DXNA 3SGCA 3ODZX 3QQUA 4BCMA 1U5QA 3MS9A 4NTTA 4D9TA 4CCUA 4XRLA 4O1OA 1PMUA 4QP8A 2W5HA 4HGTA 4GT3A 3QQHA 3UQFA 3JVRA 3CQWA 1WBVA 2XA4A 4XP3A 4QMPA 4DC2A 4EOPA 4GJ3A 4RIOA 5A4QA 1H1RA 3P5JC 4BTKA 2R3RA 3R28A 3R7VA 5AA9A 3GU7A 3VS0A 4CT2A 2XNPA 2YEXA 1VYZA 4L44A 1OIRA 3H10A 3KKVA 3UTOA 1PYEA 3VS3A 2JFMA 4F09A 2XIYA 5I9WA 2DQ7X 3RM6A 1PJKA 2PVYA 4BGQA 2XKCA 2R3KA 3EOCA 3F3UA 5CU3A 5LCKA 3AMBA 3HV3A 2ITXA 3C50A 4BDHA 1JKTA 4ZEGA 3I0OA 4I6QA 2QHMA 4N6ZA 4FNZA 2WELA 2ETRA 2UW0A 1Q24A 3KMWA 3HRBA 4IFGA 4JG7A 3IOPA 4QMOA 2IO6A 3DK6A 3QQLA 1SM2A 2G2HA 3DPKA 2O63A 2YZAA 4UXLA 5ETFA 2F7XE 3QTRA 4UB7A 3FJQE 2PVKA 3R63A 3TEIA 4E8AA 2HELA 3E92A 2H96A 4AA4A 4JRNA 2QO2A 1BKXA 2WOUA 2XAOA 2OJGA 3R9NA 2R5TA 3WF6A 5E8ZA 3ZFXA 2X6EA 4AP7A 4S2ZA 5FEEA 4DDGA 5IQGA 1UWJA 2HZ0A 3KU2A 5J1VA 2H6DA 3MY0A 4TXCA 3MJ2A 5ANGA 3TKIA 4WNOA 2X8EA 4YJNA 3CQUA 5KMJA 4ACMA 4O38A 2RGPA 3PJ3A 3BYMA 1NT2A 3MPTA 3QF9A 4LOOA 4CFFA 4CQGA 4R7HA 4YU2A 5HCZA 4F0IA 5EI8A 1UV5A 1NVSA 5AP1A 5F1ZA 3FZOA 4LGDA 3CY2A 3R30A 5CS6A 3PRFA 2E9VA 4O0SA 1CKIA 3RAWA 3KRXA 4GJ2A 5ANDA 1GZKA 4X6QC 4O7TA 2ZDTA 5AR4A 4CXAA 2F9GA 3LMIA 4JG6A 4EJNA 1O6LA 4AZSA 3OWPA 3DLZA 3ZSHA 4RWKA 4WBBB 3JY0A 4R3PA 3QD0A 4KKGA 4P7EA 1V0OA 4GS6A 5HO6A 4XCUA 4FL1A 3W2PA 5DEWA 3FI8A 1B38A 3KMUA 4IJPA 5CT0A 3PE1A 3F88A 1REKA 3TV7A 3V04A 3QLFA 4ALVA 1LR4A 5TOZA 3R9RA 2I6LA 2X0GA 3E93A 2C0OA 4TW9A 1PRYA 1OL6A 3FMHA 1Z57A 2PY3A 1UNLA 4I6BA 3E62A 3GU5A 5GZ8A 3QWKA 4YJRA 3KXZA 3DLSA 4DLJA 4AN9A 5DBXA 4XLVA 4ZTQA 5DR2A 5D12A 3RHXA 4FKSA 3OBJA 4LYNA 4NJ3A 4QYYA 3R9HA 3PIXA 1UU7A 2REIA 1CKJA 2OXYA 3ZC5A 4ZMEA 5EW3A 3VC4A 1SYKA 2R7BA 3HP2A 4U42A 5KMKA 3ORKA 5C01A 4OTQA 4QMQA 4APCA 4R7IA 3TDWA 4QMNA 4GYIA 3TM0A 1YXUA 4RJ3A 1DI9A 3FMEA 5C8KA 2PUPA 3Q52A 4CKJA 4F6SA 3S00A 4ZTLA 3DQWA 1WBNA 2WQOA 5CF6A 5D41A 4L00A 1ND4A 4FV1A 5J87A 4BFMA 5IQDA 3PDTA 3D14A 4V04A 3PSBA 5FUTA 4N70A 4LRKA 4FV0A 5DG5A 3SW4A 2ZDUA 4YPSA 3Q6WA 3WF9A 3CD8A 1RQQA 5KZ0A 2HCKA 3A7IA 4YLLA 3H9RA 3LCTA 3UVRA 2YIWA 3UOHA 4IWPA 2FSOX 3OEZA 2C1BA 5KZIA 3PRIA 2X9FA 5GZAA 4WRGA 3RPSA 5IQFA 3JUHA 1YKRA 3N4VA 3SV0A 4N6YA 4EHEA 4EEVA 3BU3A 5AP5A 3LMGA 3K5VA 5M4IA 4D5HA 2BVAA 3BBTB 3LJ0A 2J0JA 3SDJA 5KUPA 4U3YA 1O6KA 1Y6AA 3F5GA 3HMNA 3R21A 3SOCA 5KCVA 2PHKA 3BGPA 3R7EA 5CZIA 2E9NA 3IW8A 3R22A 3EQPA 4BZNA 3D5UA 1DAWA 4GU6A 3C4ZA 5CAOA 3BLQA 4JVGA 2JAMA 2VGPA 3AC1A 5KMLA 2GPHA 4L6QA 4DFLA 1H28A 3UGCA 1P14A 3UNJA 2NP8A 4O27B 1ZYJA 4E6QA 3BU6A 3HV4A 4C3PA 4USDA 2YIYA 4O96A 3V51A 4FUYA 4C8BA 3BYUA 5EM8A 4CZTA 4JT3A 4IAAA 2OH0E 4B7TA 1Y91A 5L3AA 4BDCA 4DEAA 3QD4A 3LFNA 4D0WA 4DGNA 4G3CA 4ERWA 4YZMA 4GIHA 5CVFA 3FKLA 4C3RA 5AUUA 3GOKA 2UVZA 4A4XA 3LQ8A 3OF0A 4HVGA 4RIXA 3G6GA 3TG1A 3T8OA 2QKWB 4ZMFA 2UZDA 4XP2A 5DR9A 1QL6A 3KC3A 4RQKA 2WU7A 4DG2E 4YBKA 1YOJA 4KWPA 2FSTX 2YM5A 3QRJA 4FKIA 4R5SA 4RFZA 4X3JA 4YC3A 5L6WL 3W0SA 4LUEA 3KRRA 2YCFA 4QQTA 2JKOA 3E64A 3FEGA 3EFKA 1O6YA 2WKMA 3QRIA 4FIIA 3TKUA 4JDKA 1STCE 1U59A 4PDPA 4U7ZA 1P4OA 3L1SA 3SAYA 2WTDA 2OFVA 3GB2A 3OUKA 2XYNA 3W0MA 1S9IA 2QO9A 2YWPA 4MF0A 5HVJA 4M84A 1SVGA 3O96A 4YJVA 3VULA 5FTGA 2B4SB 2XALA 4XEYA 1V0PA 2EVAA 3R02A 2G15A 1MQ4A 3Q9YA 3HX4A 4V05A 2EB2A 3IECA 4O0XA 4MBLA 4B9DA 4G16A 3A99A 3TIYA 1BMKA 4BYIA 4TYGA 1YXSA 3ORXA 1P5EA 3QKKA 3DBDA 4IB5A 3ULZA 2ZV7A 5L8LA 4FV3A 1ZMVA 4N4SA 3EFJA 1U46A 2Q0NA 2QQ7A 2B55A 4IVAA 3V6SA 4IH8A 4RC2A 2J5FA 3ZONA 4CMUA 4D1SA 1FMKA 4E7WA 4E73A 4OAUC 4IIRA 4PV0A 4FEUA 2XJ2A 4LMUA 1ZMUA 3R73A 3IDBA 4R1YA 4YUQA 4EH9A 1SVEA 5CX9A 4C58A 2F49A 1NXKA 4PL3A 3U6IA 3LXKA 4BDGA 3CKWA 4MHAA 2XIKA 2C3KA 4DCAA 3ZO1A 3T9IA 3NSZA 3TNHA 3QYWA 4J53A 2PTKA 4MD7E 3BL7A 3CPBA 3RTPA 5CTPA 2OSCA 4XOYA 3VRZA 1JSUA 4E5BA 3VUHA 4MQ1A 5IU2A 1XKKA 3SD0A 4NYEA 4LG4A 4QMYA 4L7SA 4AXCA 5L8JA 4AACA 4FL3A 4RWLA 5AV2A 5HICA 2BALA 4I92A 3QKMA 5K0KA 4EL9A 4O91A 3D15A 3F3ZA 3PLAE 5H8GA 1Z5MA 3DDPA 3JXWA 4XV3A 4HVSA 2RFEA 3LIJA 3E5AA 3Q32A 4DT8A 3PY3A 4LL5A 3NAXA 4L3PA 4E3CA 1LEZA 4ZLZA 2RFDA 2HIWA 4RG0A 1H25A 2WPAA 5HVKA 5KKRB 3BIZA 1PXKA 3CR0A 2GNHA 5AP7A 4ZTSA 5KBRA 3IQ7A 4DHZA 2WQEA 2UZBA 3IONA 3KRWA 4KS7A 5EW8A 3R8PA 5CEMA 2C6EA 5ANOA 4DFYA 5JZNA 2C0IA 4EBVA 2C6TA 3E8CA 5IDNA 4ORKA 3QZGA 3GU8A 3V8WA 3BE9A 4MH7A 1E9HA 4D2VA 4KS8A 3QFVA 4KAOA 3E3PA 1VJYA 2A1AB 3ROCA 4CZUA 2YIXA 1KE5A 2OJ9A 5FQDC 3MFRA 4JIAA 4C62A 2HWPA 4CFWA 4CRSA 4EOKA 5I4NA 3NEWA 1PXMA 3KIOC 1LEWA 4J99A 4FNWA 3BGZA 5GHVA 1OIYA 1PKDA 3RGFA 4AW1A 4F7SA 4U79A 3UDSA 1TZDA 2H34A 3QTXA 3R7YA 4BB4A 1HCLA 4ACCA 1XH7A 1PW2A 5F94A 4C34A 2EWAA 4YJTA 4CV9A 4G3EA 2O64A 3BYVA 3NNWA 3QRTA 2PMOX 3WIGA 3GP0A 2HZIA 3BHYA 2W99B 4FKOA 4K6ZA 4TY1A 1P4FA 4XBUA 2R3OA 3R71A 3NX8A 4GK2A 3QLGA 3UZTA 3I7BA 2GHLA 3SG9A 4I93A 3GCQA 1OECA 1J1CA 5IEYA 4F7NA 1YHWA 2GQSA 3E8NA 5KHWA 3ZO2A 4RC4A 1EH4A 1T45A 1AGWA 3F7ZA 3MY1A 2VTRA 3O7LB 4D58A 3Q60A 5I3RA 3RAKA 1FQ1B 1XH4A 3KRJA 2GMXA 4MYGA 5EQEA 5M09A 4HOKA 3CGFA 3EB0A 5CU6A 3R1QA 3DA6A 4MXAA 1R0PA 3SLSA 3IDPA 1XH5A 3H9FA 3FI3A 4FZ6A 2X9EA 1WMKA 4FIFA 5LARA 1Q8TA 3ZLWA 4USFA 5DHJA 2BHEA 2C3LA 1TVOA 4Q9ZA 2O3PA 3FHRA 4MUQA 2C30A 2DS1A 3DBEA 4E4NA 3VBVA 3OCBA 4IX4A 4ASZA 1K2PA 4UXQA 4DTBA 3LFQA 4YJUA 3N9XA 4BY9E 3ZFMA 1XO2B 2XK7A 4AOIA 2R3JA 3KQ7A 5I9XA 3ML1A 2P3GX 3M42A 3DBQA 2CCHA 3THBA 3U9NA 4OBPA 2YA9A 4H3PA 2LGCA 4ZZMA 4GV1A 5DT0A 1G5SA 5KBQA 4LOPA 4YLKA 5T68A 4XG6A 4CRLA 2XNGA 1H1WA 4DINA 3NNVA 5CVGA 5LXMA 4X6RA 1FVVA 2XRWA 4A4OA 1B6CB 5EYMA 3RK5A 2ITWA 4TWOA 5EQPA 4U97A 1OITA 3MW1A 1QPDA 4CEGA 2WEIA 3FC1X 3FZPA 5CSWA 2IZUA 3GFWA 2HENA 4FOBA 2XK6A 4BDBA 5IISA 5IQIA 4C59A 3LM5A 3LCOA 3A61A 4OR5A 3PYYA 5AIRA 1HOWA 5EOLA 4X3FA 4JG8A 3FLWA 4EI4A 3QA8A 4MWIA 1XBBA 1MQBA 3EL7A 3GU4A 4F9BA 3MH3A 1YDTE 3KN5A 4M0ZA 3V5PA 2VX3A 4WRSA 1CDKA 4AA5A 4NU1A 4JX7A 2B53A 2FB8A 2GNJA 4L3LA 4YZCA 5L2IA 1WBTA 5M4UA 2XNNA 4AE9A 5CXZA 3Q9WA 4G5PA 4G6LA 4FR4A 4FF8A 5J9ZA 4QMWA 3W32A 4I0SA 3UC3A 2W4KA 3Q04A 1M2PA 4FKLA 5ACKA 4WUNA 3AMAA 3BX5A 5C27A 4FT0A 1PHKA 1IG1A 3OMVA 1H4LA 4NFNA 5EHOA 3I1AA 4ZJJA 5B2MA 5D7AA 3BLAA 2A4LA 2XIZA 3HKOA 4FSMA 1CTPE 2G2IA 3WOWA 4BIEA 4BN1A 3ORNA 4E4MA 5HD4A 3NIZA 4YZNA 5FD2A 3MA6A 1Y6BA 5DRBA 5E8YA 3C4FA 2BFYA 4RZWA 3R1SA 3SQQA 1YOLA 2X4FA 3AD5A 4O7NA 4FYOA 5HO8A 5CWZA 4IB1A 3PXZA 1H0WA 4QP1A 3RKBA 4QPAA 4QYFA 3VUGA 4C4IA 4C37A 1PXIA 1J7UA 4AF3A 2QONA 2V7OA 4NL0A 5IH6A 2CGXA 4RPVA 2C69A 1H26A 4Y8DA 3E8EA 5AM7A 3O17A 4FKWA 3ATSA 1BL6A 3U51A 4F9WA 3DBCA 4CTBA 4YO4A 4FTOA 3LM0A 2VX1A 5A6NA 2VTAA 2VUWA 2JFLA 4FNYA 4FSQA 3MN3A 4MD8E 4QD6A 4XRJA 3UG2A 4X2KA 4A9TA 2VTIA 2WMUA 3G9NA 3HRCA 5TO8A 3E63A 1CKPA 4IACA 4BVUA 4JJRA 3AC3A 3W2CA 5HBJA 4O6LA 3F3TA 2B9HA 2VWYA 2QNJA 2XVDA 4XS2A 4AX8A 1YHVA 3G2FA 3QYZA 5FM2A 1K3AA 4G3GA 4NM7A 3LFDA 4FA2A 3GFEA 3OT3A 2A27A 3OTUA 4ZIMA 1VLRA 2UW6A 2YM4A 5AIKA 3ZUTA 1A48A 1ZOEA 5D1JA 3VS4A 5EK7A 2LAVA 3CKXA 5AP6A 4E4LA 3FPMA 3GCVA 3UVPA 1SZMA 4BBEA 4PDOA 4EWHA 2CKPA 3EYGA 2IZRA 4XG3A 3PG3A 4OW8A 3MY5A 4D4SA 2QOOA 2G9XA 5BUJA 4GK3A 3LFAA 3D5WA 4FIHA 5GINE 1E1VA 2Q83A 3ZO4A 1LPUA 4ZOGA 4ARKA 1GZNA 4Z7HA 3W2OA 4G17A 2QOKA 3A60A 4YZBA 5DNRA 4OAVB 2BZIB 1PMNA 3ALOA 4FIJA 4I0RA 5LVLA 5BYYA 5LQFA 5EYDA 1OBGA 5B2LA 5CSXA 5CAPA 4I1ZA 4YJQA 4JI9A 5BVDA 4IX3A 4D9UA 2RF9A 2XKDA 3V5LA 5HNIX 3U6JA 5EHYA 2JKMA 4QQJA 5FP6A 3VJOA 4KSQA 3PFYA 4O22A 1RJBA 2OF2A 5M53A 2XEYA 4Y72A 3MB7A 5H2UA 3OFMA 5DRDA 4I5HA 5AUXA 2VWUA 4BCQA 4PMPA 2Y6MA 1DAYA 4BWXA 5C4LA 3KF4A 3O8TA 2JBPA 4LV7A 4W4VA 3QQKA 2GHMA 3DKOA 1KE7A 2UZUE 1PF8A 4ENYA 4AOTA 1BI8A 4PTCA 3PXKA 3CJGA 2X0PA 3LZBA 3LQ3A 3C0IA 4BDJA 4B99A 4O0RA 2W4JA 3Q2JA 3TV6A 4RSSA 2P2IA 2RFNA 3IW6A 4X2FA 5I9YA 3D5XA 2RKUA 3LFBA 4J7BA 1KE6A 3RMFA 2QODA 3KVWA 3BHVA 4JRVA 5HNBA 1QPJA 3F61A 2XJ0A 3VUTA 3CD3A 4RT7A 4IC7A 3SA0A 2WAJA 4IWQA 5J1WA 3BEGA 5FXSA 4D2WA 2VRXA 4BL1A 2UW4A 4L3JA 3MA3A 1G3NA 1FOTA 3KRLA 3Q3BA 4X3FB 4LGGA 5BVWA 3N4UA 4LOQA 3OOMA 3C1XA 4FOCA 3WILA 2CN5A 4EH7A 4MVFA 4EZ7A 4J52A 2I0EA 2XRUA 4XUFA 4O4EA 1ZZLA 5ANIA 1XH6A 5L6OA 5L6PA 2XCKA 2WB8A 4HVHA 3NYXA 2GU8A 4IWDA 4DE4A 1M2QA 4BDKA 3W0NA 5BPYA 4EK6A 3MDYA 3R7OA 5HOAA 4OLIA 4D2RA 2VTJA 3PVBA 4AN3A 5CQUA 4EH2A 2OK1A 3FAAA 1GOLA 4R7BA 4CNHA 4BCGA 3SVVA 4FZAB 4X2NA 3V8TA 1H01A 3VF9A 2EUFB 4DG0E 3C4EA 5DVRA 4ZSLA 4DGGA 4G9RA 4O0YA 3QTQA 4PPBA 4A9RA 3IO7A 3ZH8A 1W8CA 4R77A 3W1FA 3VBQA 4M66A 4EH4A 3IG7A 3N51A 5DT3A 1ST4A 2OXDA 1R0EA 2YJRA 2OU7A 3O0GA 4FTLA 4MXXA 4TWCA 4YC8A 4FRFA 3UQGA 1FPUA 3C5UA 3RPRA 3L9PA 4FIGA 4PNKA 2XM8A 4OTIA 2JAVA 2OIDA 2X1NA 5IA1A 1W7HA 4QMSA 5IDPA 3PG1A 4QP9A 3QBNA 2GNLA 2GQGA 5DR6A 5FLFA 5AADA 1XMLA 5IKWA 3BV2A 1YI3A 2ITQA 2IJMA 3VHKA 4U45A 4IVCA 4H39A 3FLSA 4RZVA 1ZYSA 2XMYA 4TT7A 4YR8A 3GXLA 3TDVA 2BAJA 3UIUA 2GDOA 5E90A 5TE0A 3SXFA 4ALWA 1OKZA 3EFWA 2Y4IC 3NUYA 1DI8A 3TV4A 2X0OA 2VD5A 3ANQA 5M55A 5A4TA 3QZIA 3VS1A 2WTKB 5AR2A 4I24A 3MVHA 3HVCA 2X7GA 3FHIA 3ZTXA 2QKRA 4DLIA 4AXAA 5EQYA 4W8DA 3BL9A 1TKIA 1BL7A 2YM8A 4PWNA 5FXQA 4CZYB 1H00A 4M8TA 3L8VA 4UALA 1YI4A 3HDNA 1L8TA 2PYWA 1VEBA 3ZUVA 4F70A 3O7LD 5AP4A 3UO4A 4D4RA 4K8AA 3LQ5A 4RJ5A 3HMIA 5E1EA 2W1HA 3TJCA 4BDEA 2CGUA 2VWZA 3HECA 4PMTA 3EMGA 3MFUA 2X7FA 2YCSA 4NZWB 2GSFA 4AZWA 1XMMA 1SVHA 3SKCA 4JNWA 2FH9A 4F7JA 4G1WA 4E93A 4BBMA 4EJ7A 4D2SA 4FVRA 5FBNC 3Q9ZA 4O4CA 4HCVA 4BCNA 2R9SA 3FL4A 4FIEA 5ANEA 4C4JA 1GIJA 4FMQA 4NK9A 4OBOA 3RINA 5LWNA 4AGWA 3P23A 1ZRZA 3E88A 2XNBA 4YLJA 4PMMA 2WMTA 4RJ4A 1J7IA 4HZRA 4P90A 3D5VA 4FKVA 5G6VA 5AAGA 4WG5A 3TYKA 5I9ZA 5CU0A 4EK8A 4IM3A 1H8FA 4L7FA 1R3CA 2Z7SA 3FZTA 3QCSA 4RIYA 1GZOA 2VZ6A 5E1SA 4QQ5A 2RFSA 2I7QA 5L2QA 4DFXE 4U81A 3R0TA 3C5IA 3ATTA 4NWMA 4G34A 4BBFA 5AUTA 4EKKA 5K0XA 4QYHA 2IVVA 4B8LA 1R78A 3VUDA 3F5UA 3BU5A 3BI6A 4L45A 2VTMA 3C7QA 4C7TA 4UYNA 3WYXA 2HW7A 3DY7A 4EC9A 4EWQA 1W2FA 3I5ZA 1H24A 5KMIA 1H1QA 3CE3A 4K33A 3RP9A 3ALNA 3AC5A 2VTNA 4D2PA 5EG3A 4DFZE 3I5NA 2WTJA 3OWJA 5HX8A 1JLUE 2IVUA 3PY0A 2YAKA 4FKTA 2WMRA 3DBFA 4B0GA 4MTAA 4BC6A 2OJFE 4KA3A 3NW5A 4ACGA 4BTJA 2UVYA 3BYOA 4FV8A 4NCTA 2XZSA 4G5JA 5E8VA 5EH0A 1LP4A 3I6WA 4BWKA 4NEUA 4PL4A 4CG8A 3QHRA 3EQDA 4DTKA 3PP1A 4BWPA 4G9CA 3O23A 5BUEA 3OCTA 3U87A 4RIWA 3IW7A 4KBAA 3KXMA 3HNGA 3WF8A 1RE8A 3HP5A 1Q62A 4W4WA 4ZZOA 1H0VA 5AMNA 2ZFYA 2E2BA 3PVGA 2WTWA 4WO5A 4MKCA 1KOBA 4IANA 1BYGA 2UVXA 2WQNA 3ZHPC 4GRBA 1YXTA 5K9IA 3NUSA 3AT2A 2OFUA 3IK3A 3BKBA 2QVSE 2X8DA 3LHJA 2BDJA 3ZZWA 1G8SA 4X21A 3DKCA 2HZ4A 4U0IA 4LFIA 3NVKI 5EYKA 2R3IA 3EN4A 5KMNA 3QTWA 4AU8A 4R6VA 4RVKA 3PJCA 4NTSA 5CSVA 5AA8A 4OTGA 2BDFA 2QCSA 3FYJX 4O4FA 4JDIA 4BR3A 3DXQA 2AYPA 4HGSA 2F7EE 4L01A 5HG5A 3FY0A 2NRYA 1R1WA 4ZTRA 3R9DA 4Z55A 2E9OA 4O7VA 3RK9A 4R3CA 2BZKB 2OO8X 1YXVA 3MSSA 5B0XA 4EOIA 4CG9A 3ORLA 2VTSA 4EHZA 4NFMA 1SMHA 3ERKA 2YDIA 2CJMA 3CC6A 4FZDB 4QPSA 5HBHA 5CEKA 4DCEA 2QLUA 4E6CA 3VW8A 1JVPP 4A9YA 3IKAA 4MCVA 3ELJA 3NFFB 4Z9LA 3REPA 2PVFA 2W7XA 3GGFA 5BVKA 5C26A 2O5KA 4O6EA 3B2TA 2BCJA 3R9OA 3TT0A 4DN5A 2RIOA 3UE4A 2PK9A 3EZVA 4PTGA 4AQKA 3LJ1A 3LLTA 4JBOA 4EZ5A 2PZRA 5M44A 4QMTA 3UOLA 4X3FC 3HMMA 4GT4A 2W9ZB 3AQVA 3ZEWA 2ZOQA 3W18A 4CKRA 2BTRA 5J9LA 5BX0A 5HE3A 2C6IA 4BCJA 4CMOA 4BKYA 1TQPA 1WAKA 2FSLX 4CLIA 3HAVA 4DHJA 1JSTA 1Y8YA 4FK3A 3T9TA 1OIQA 2H9VA 3R8ZA 4EH3A 3A7HA 4YJSA 2R3GA 1NVRA 5FM3A 3FZRA 3I7CA 3RAHA 1OL1A 2O65A 3PP0A 3BZ3A 4HNFA 3NIEA 3V8SA 4AZEA 4D5KA 3QHWA 4F9YA 3QGWA 5A3XA 4WA9A 4YTCA 2RG6A 3NS9A 4CTCA 2HY0A 2VV9A 3DU8A 4RFMA 2VWXA 3GC9A 1PYXA 4BZOA 4GSBA 2GTMA 4KD1A 4I5CA 4DHIB 4FNXA 4QYEA 3IDCA 4YGAA 3L9NA 4IB3A 3R1YA 3PXFA 3VIDA 2PULA 4FUXA 4MWHA 4UMQA 2J90A 3PTGA 4GKHA 4FV4A 5JFSA 2PUUA 3CTQA 5HGIA 3JR1A 1XQZA 1W83A 4ZSJA 3ORTA 2YWVA 5JZJA 4IX6A 4F1OA 4EONA 3VUKA 5IEVA 2WZJA 3V5WA 2OJIA 3ID6C 3OXZA 4RVTA 4UV0A 3MPAA 3PIZA 1YI6A 4UMUA 4RIYB 2R0UA 2Z7LA 2C0TA 5M57A 4H05A 4O4BB 4FC0A 2WMAA 4KSPA 3PIYA 4IAIA 2QI8A 4QO9A 5FDPA 3VF8A 2CDZA 1Q8YA 2IF8A 4EK5A 2XNOA 5DEYA 4LQMA 4LL0A 3OC1A 4IZ7A 2IW8A 5CAUA 4C0TA 2KTYA 2WTKC 2V7AA