2PVHA

Structure-based design of pyrazolo[1,5-a][1,3,5]triazine derivatives as potent inhibitors of protein kinase ck2
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
328
structure length
327
Chain Sequence
MSKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNAYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design, synthesis, and study of pyrazolo[1,5-a][1,3,5]triazine derivatives as potent inhibitors of protein kinase CK2.
pubmed doi rcsb
source organism Zea mays
molecule tags Transferase
molecule keywords Casein kinase II subunit alpha
total genus 110
structure length 327
sequence length 328
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2pvhA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2pvhA02
2X6EA 1NA7A 1UWJA 3EJ1A 3QTWA 3VWAA 3OY3A 4AOTA 5C8MA 4RGJA 4R5SA 3QRJA 2R5TA 3OCBA 3BYOA 4WRSA 5AJQA 4ANSA 3DKFA 5HG9A 3MY5A 1U46A 3OWPA 3VUMA 3FLZA 1H25A 1W0XC 3BBWA 3QC4A 4AZVA 2Z7SA 4BYIA 5JQ5A 3Q32A 1L8TA 2OWBA 4ANMA 4FUYA 3QTZA 3Q9ZA 3O50A 3R2BA 4BZDA 5B2LA 3RPOA 2C6LA 4YNOA 5JH6A 5CI7A 3QKLA 4JQEA 3ATSA 5L2WA 4P90A 5IQEA 2PYWA 2R3RA 3U6HA 5D41A 3A7FA 4WBOA 2H34A 2XJ1A 4A07A 3EYHA 5EHLA 4RZWA 1R0PA 5ANIA 2C3KA 3AGMA 2OFVA 3G9LX 3FE3A 2RFDA 3B8QA 3B2TA 4NFMA 4RLLA 2YZLA 3EQCA 2PE2A 1APME 4DGNA 3DDQA 4U3YA 2AC5A 2YITA 3OW3A 2YWVA 2UZWE 3F66A 4EOSA 1OL2A 3AGLA 4ACMA 1PXPA 3UMXA 1H00A 3H9RA 4FKRA 4L3PA 3HRFA 3Q9WA 3QKMA 1ZYJA 4YLLA 4AGDA 4NSTA 2HENA 3VBTA 2W05A 4DLIA 4DA5A 4BKJA 4AX8A 2X8DA 4FV3A 4Y95A 3DXPA 2XM8A 4F6SA 3RNIA 4BZNA 3GUBA 1J7IA 4OW8A 4XH6A 4ENXA 4YTCA 4JBPA 3MIAA 4H3BA 3WZKA 1SYKA 2C0OA 2VU3A 3TWJA 4AA0A 3LFFA 2NNWB 4DEIA 3GI3A 2ZAZA 3MPMA 3G33A 4RFYA 4FKJA 5AM7A 3BPRA 4QNAA 2R3MA 4XG3A 4FVRA 4E4NA 4GU6A 2UW5A 4D55A 3F82A 2WTVA 3UYSA 4FX3A 2F49A 3R63A 5CSVA 2YLFA 2R3QA 3R02A 2BTSA 5CSWA 5FM2A 5HEZA 3R7EA 5GIPE 2J5FA 4JDKA 4GU9A 4L3JA 3FI2A 3VIDA 4RC3A 1BUHA 2WTCA 3ET7A 2HZ4A 2XIYA 5JQ8A 2VGPA 4PMMA 3LW0A 4L9IA 3HP5A 2JGZA 3TNQB 4CFMA 5K3YA 4A06A 3JR1A 2O3PA 4UYNA 3W2OA 5E8TA 5KMNA 3R8UA 1I44A 5IEYA 1V0OA 4ZTHA 5FXSA 4FG9A 2YCRA 2HCKA 3LLTA 3L8PA 2CKQA 2BROA 3A99A 5EI6A 2E9OA 2YDJA 3COIA 1P5EA 1TVOA 4R5YA 3AG9A 3PTGA 3O71A 4RJ7A 1UNLA 2C6TA 3CQUA 4XV3A 3VHKA 4C7TA 4E20A 1QPCA 4LOOA 3DCVA 3HUBA 4GT4A 1X8BA 3HVCA 4P2KA 4Y5QA 3ROYA 3C5UA 4TWCA 3C4WA 4EH2A 3T9TA 5I9VA 5LOHA 2VO7A 3NNVA 4LV8A 3CQEA 2G2HA 1OPLA 3WF5A 5IMXA 4PPCA 4Z9LA 2I40A 5KZIA 4AF3A 3R71A 4IQ6A 2QQ7A 5FBNC 1PXKA 2W1IA 4BCIA 2XM9A 2JDVA 4O0XA 4F0GA 3FY2A 4WRGA 1Z5MA 2OIQA 4YBKA 3QX4A 3KCKA 2R3HA 4Y72A 1Z57A 5A9UA 2GS2A 5IH4A 2W1CA 3C0HA 3P7CA 3RINA 2ITWA 4BDIA 5IU2A 5KNJA 3UZTA 3Q9XA 5LMBA 4CMTA 5HX8A 3DDPA 3BGPA 2PVMA 2HAKA 4MNEA 4QP7A 5AP7A 5FUTA 4LUDA 3UOHA 4FEWA 1ZOHA 4E73A 3UNZA 3U4UA 2OJJA 2YM7A 4YJUA 5D1JA 3ZHPC 3TM0A 4BWPA 3ZC5A 3HGKA 4ASXA 1GIIA 4YHTA 4R3CA 3EFJA 1CSNA 3F3VA 4U6RA 3UGCA 3DXQA 2VTNA 3GC8A 5CY3A 1YXVA 4M0ZA 4MNEB 1H0WA 2XNPA 3GBZA 4G1WA 4YJSA 3VF8A 3ZDUA 5M56A 3FMJA 4J53A 5EOLA 3SXRA 4C33A 3MESA 4H58A 3TCPA 4C34A 3QYWA 2XIXA 5EDRA 5L4QA 2P3GX 5JFSA 2XK7A 5BUJA 5A46A 3QRIA 2R3NA 3QRKA 5AV2A 2VTSA 1Y6BA 2Y8OA 2ZV8A 4DLJA 3NYVA 3UQFA 1Q62A 1H8FA 3BBTB 4EH5A 2E9UA 1WBTA 3V5LA 2VTQA 3R1NA 1U54A 3DTWA 1H24A 1PMVA 3A8WA 3UZRA 3IW8A 5H3QA 2UUEA 4QP6A 2C1BA 3CS9A 3RWPA 3MV5A 4I20A 5EI2A 2OICA 3VHEA 4RC2A 5CU6A 1JKLA 1XO2B 3LQ3A 2O2UA 2PPQA 1M2QA 3OCSA 2JKKA 5H8EA 3N51A 2PTKA 3IGOA 4NIFA 2OGVA 1OIUA 1Q24A 5IQHA 5AUUA 4BCGA 4D5HA 4X3FB 5K5NA 5AUXA 5M06A 4HCTA 3VN9A 3C13A 3FY0A 5DWRA 3Q52A 4OTPA 2BRHA 3EQHA 1K9AA 4OTGA 4QTAA 4E7WA 1ERKA 4WOVA 2BDWA 4E5BA 4YZBA 3RMFA 4C35A 5M44A 5HX6A 4EH9A 3PFQA 4LYNA 5CAPA 2GHGA 3QQKA 3QX2A 4HNIA 3AMAA 3JVSA 4Q5EA 4R7HA 2XF0A 3FHRA 3V8TA 5IG1A 3E93A 5HNGA 4EEVA 5T68A 2ZMDA 3VS1A 3MW1A 5I9WA 3TUBA 4ZTMA 4WUAA 4P4CA 3QGYA 3MVJA 2UVYA 4XYFA 3UO4A 2YWPA 4ASDA 4F0FA 4M66A 3QALE 2QOOA 1KUTA 3OT3A 4TY1A 3KULA 3RPRA 4EOQA 3MFRA 4Y8DA 5ETFA 3A4OX 4O91A 5DNRA 5EK7A 2CKOA 3L9PA 3IOKA 5CWZA 1H0VA 2FH9A 3ZDIA 3S0OA 2Y4IB 4E1ZA 4DEHA 4ZSGA 4QO9A 4BDJA 3Q3BA 4RIWB 3TJDA 3I5ZA 3ENMA 5CANA 3EL8A 2WU6A 3NAYA 3MY1A 3VS3A 1DI8A 4FEXA 5CENA 4EYMA 1BYGA 2R3PA 2WB8A 4LGDA 4OAUC 3P7AA 3ZZEA 4YLKA 2UW7A 1Q8ZA 3F3UA 5IUGA 5FDXA 1P4FA 2RG5A 2ITXA 4XLIA 5FRIA 2UW4A 5G1XA 5AP5A 4CFWA 3FPQA 3TL8A 2OJFE 5AWMA 2A0CX 5BX0A 3NUYA 4M84A 5KE0A 3MFSA 1WZYA 4QRCA 1ZMWA 2W5AA 1DM2A 2HOGA 3KA0A 4JDIA 2ZJWA 4ASEA 5JGDA 2W1HA 5AADA 2GU8A 3THBA 2VTJA 2QONA 1XH9A 3EFKA 4ACHA 5HTCA 3IQ7A 3KVWA 4BDAA 4F09A 2XRUA 2FSMX 4M8TA 5CQWA 3DAJA 3FZTA 4LFIA 3WZDA 2FSLX 4I5CA 3ZS5A 4ZLZA 4NM0A 1H1QA 2JEDA 3EKNA 3CLYA 3K5VA 3NYNA 2QOIA 3I5NA 5TE0A 3UVRA 1MRYA 1SVHA 3P7BA 5K5XA 5M08A 4XRLA 5CXZA 3FL4A 5IKWA 1YRPA 4EZ3A 2PUPA 2ZMCA 4WG3A 4QP9A 3D5XA 3DK3A 3PLAE 1M17A 3TKUA 3D5WA 4FK6A 5T3QA 3OD6X 3OOMA 5HNIX 3A7JA 1SNUA 3HRCA 5DLSA 3RK7A 1Q8YA 2WQBA 2C6EA 2PL0A 4TW9A 3V6SA 2YDIA 3OZ6A 4O7YA 2XB7A 5DA3A 2JDSA 4L45A 4I0RA 4LL0A 5H8GA 4BBEA 2IW6A 1YOMA 4RC4A 2YM4A 3HA6A 4DH1A 3QFVA 3DQWA 4YJQA 3WARA 1JLUE 3TV6A 1J7LA 1ZAOA 4IZYA 3D83A 4QYGA 3F6XA 2EWAA 4I92A 3D7TB 4JNWA 4XRJA 4MVFA 3SKCA 4LM5A 2ITPA 2UW3A 3GCUA 4PTCA 5IDPA 3VQHA 4JL9A 3A7IA 2WMTA 3HMMA 4QMMA 4DTBA 3DV3A 3TIZA 3ZLYA 2VX3A 4IB1A 4R7BA 1MQBA 1OL6A 3DAEA 3FMHA 4XHKB 3R7VA 3C4EA 3KEXA 4U40A 4O0RA 3T3UA 4EYJA 4EBWA 2QR8A 3OMVA 4G2FA 3II5A 5CS6A 2Y9QA 3W55A 3UG1A 2GSFA 2W06A 3NUPA 3V5WA 3VRYA 2WMVA 4FA2A 1J91A 2ZB0A 1GY3A 2X9EA 2XZSA 3DJ7A 2WTDA 3MTFA 3ZUUA 2CGWA 3KMWA 2WIHA 2EXEA 1KV1A 1KSWA 3LXKA 3R7GA 5DT0A 1J1CA 1VJYA 3EH9A 4D0WA 4KS8A 2H9VA 4IVCA 2ZM3A 3R1QA 4KIQA 4AUAA 4C38A 5J9YA 3DBEA 5IDNA 4C3RA 2QOBA 4U3ZA 4FODA 3NLBA 4UWCA 1REKA 5AR3A 3V5TA 4FV0A 3HRBA 3HECA 2B7AA 2OH0E 2W99B 3EQPA 3RCJA 3G15A 4GSBA 3ZO3A 2R7BA 3I0OA 4ZTNA 4BDCA 1PF8A 3DKGA 4QQ5A 5AR5A 3RBWA 3S2PA 3O8PA 2CN8A 3TTJA 3ZXZA 4E3CA 4IVDA 3NVMB 1PHKA 1PKGA 2R2PA 3DBQA 3KCFA 4NH1A 5HCYA 3W2SA 3KFAA 4M3QA 4HVIA 4ZS4A 4I6HA 5EI8A 3BRBA 2QLQA 4DFNA 3NW5A 2R4BA 3ZFMA 5IQIA 1PMNA 4CT2A 3MDYA 2WMRA 4FTAA 5BNJA 1P4OA 3Q2MA 4EOLA 3GFEA 4JIKA 4YTHA 4QMXA 5JT2A 4S34A 1H1PA 4O0WA 3E64A 3GU5A 1DAWA 2QD9A 3DA6A 4CFVA 3DKOA 4YJOA 4DEGA 5IA2A 2GNLA 2JIIA 2VTRA 3S1HA 4QQJA 2GQSA 5ANJA 4DG2E 3QQHA 4G3FA 4YJPA 4IJ9A 4QQTA 4F1TA 2PVNA 3PXKA 5LVMA 4DEAA 1BL7A 2XYNA 4FIGA 4XBRA 4AZEA 2IVVA 2XNBA 4IAIA 2QKRA 4HJOA 4CV8A 3OWLA 4LQMA 5LVPA 4C3PA 2CGXA 5IQBA 4FNZA 4RJ6A 5JFXA 2QODA 1OI9A 3O17A 3PXFA 2HELA 3R30A 2XEYA 3NAXA 2PHKA 3PXZA 4LG4A 5DRBA 4IM2A 2QG7A 3BV2A 4WT6A 5JN2A 5EHOA 3W8QA 4FKUA 3HMNA 4TWOA 4N70A 3QQGA 5DBXA 4FG7A 4RZVA 3GCPA 4IB0A 3BEAA 4H3PA 5E8XA 3EQIA 1M7NA 4MKCA 5AP6A 5J5SA 5AR8A 3UG2A 1F3MC 2WTKB 4II5A 2J0LA 3TN8A 2CGUA 5BVFA 3PVGA 4FSWA 3ZM4A 2O65A 2I7QA 5HZNA 4YPSA 3V3VA 3OW4A 1PYXA 4YSMA 4BI1A 5JRQA 5CVGA 4DTAA 4O7LA 4D9UA 2WQEA 4YR8A 3C51A 5IEXA 1H28A 4L3LA 4JXFA 4FV5A 1LUFA 4P5QA 4WD5A 5C27A 4BKYA 3Q6UA 4C37A 3NSZA 4J97A 5AA8A 2JD5A 3NCGA 4FTJA 4YZNA 3TZ8A 3ZM9A 2BIKB 1W82A 1FVTA 5EKOA 3LMGA 4C4FA 3CPBA 3LQ8A 2QCSA 2W9FB 5A4LA 4BTMA 4FTUA 2DYLA 4PDYA 5AX3A 1T45A 1YVJA 4PDOA 3W32A 5HG5A 1IAJA 1Y57A 4GFGA 4JRVA 3FKNA 3U55A 5BYYA 4FSUA 4O7VA 4JIAA 2C0TA 3KXXA 4AGWA 2CCIA 5IQGA 3MYGA 3NNUA 4NFNA 2X6DA 4NTTA 2YAAA 3G2FA 3E87A 4E6CA 4O84A 4IHPA 4FK3A 5F9EA 3ROCA 3ZO2A 5JFWA 4HYUA 3KMMA 4YU2A 3HL7A 1NVSA 2OIBA 4DG0E 4EQUA 2XYUA 4OTHA 5C1QB 4M12A 4A4LA 2VD5A 4AW2A 1Q8TA 3IW4A 4EK4A 2X9FA 3P78A 5M07A 2QU6A 4TWPA 2J0MB 2PU8A 3CJFA 3M1SA 1GZNA 1YDTE 1MP8A 4QP2A 4F7JA 2CLQA 2B1PA 2WEIA 3QC9A 4ZLYA 5E8VA 4G6NA 4Y73A 2WOUA 4DGOA 3VJOA 1U59A 3H9OA 3OY1A 4RVLA 4IDVA 1PXJA 3DTCA 3LZBA 2HK5A 1IA8A 4UMQA 2Y4IC 5K0KA 5FLFA 1ZOEA 3EQGA 3RJCA 4FSRA 2OJ9A 2Z2WA 5FP5A 2OLCA 4TL0A 3HP2A 5HOAA 3OXTA 4GS6A 3Q4ZA 4YZMA 4QT1A 5EQYA 2PZYA 5HLNA 2V62A 5CSXA 5KZ0A 4BWKA 4NYEA 1KOAA 2VWBA 2J0JA 5JGBA 3HMIA 5E1SA 5A6OA 3PPZA 4ZJVA 3BWJA 4FT9A 4GG5A 3CY2A 2WHBA 3AC3A 3OROA 4K9YA 4QMUA 5LMKA 3R9RA 3LXNA 5DR6A 2PZRA 3DFCB 3FL5A 1HCKA 2VNWA 3L8SA 1CTPE 2YIXA 4CQGA 3OFMA 5J9LA 5AP2A 5EH0A 3ORIA 4XUFA 5BVOA 4IACA 4KINA 4CRLA 2F4JA 4W4XA 1ZY5A 3R83A 4C4HA 4FF8A 3ZLWA 2VWWA 2BUJA 3MPTA 4KKGA 2ZV2A 3QA8A 3P5KA 5CEQA 3O8TA 1H01A 2JKMA 4X0MA 4ALWA 3VAPA 4EH8A 5BUEA 3F2RA 4FEUA 3NRMA 3BE9A 1FQ1B 3PE1A 4V01A 4F08A 3R00A 4WNPA 4DAWA 1Q5KA 5GJFA 1U5RA 2CHLA 5CQUA 3NUAA 2VTIA 5ETCA 5L8KA 3DLZA 4HGSA 2IW9A 3VF9A 5HBHA 3HX4A 2GTMA 3ZBFA 4MD8E 4F7SA 3GU4A 3QLGA 4QPMA 3LOKA 3H9FA 4DBXA 2WMWA 4FIHA 4XEYA 5HIDA 4UBAA 4F9BA 3FXXA 5CAOA 3FKLA 4FYOA 5LCKA 4YUQA 4XV9A 2VTAA 2C6KA 4ZTSA 1YXUA 3NGAA 4CLJA 4L8MA 4F70A 4IADA 2PE0A 1ZWSA 3LCOA 4MBLA 1OMWA 2CN5A 2YERA 4FNXA 3QGWA 4QPAA 4XBUA 5DOSA 4I0TA 5ACKA 4IDTA 3F5XA 3GOPA 3KULB 3QKKA 3W18A 3W10A 3ZRKA 4CXAA 4G34A 1ZYLA 2J9MA 4O0YA 4XG9A 4WIHA 4F6WA 4G5JA 5DG5A 4YMJA 4W4WA 2JIVA 3KXNA 4OTDA 4C3FA 3FWQA 4DH5A 4C57A 4BCMA 4ZEGA 4MHAA 4FKGA 5HVJA 4EZ7A 4F1MA 4RIWA 5FGKA 5J7HA 3GQLA 2PUNA 3EMGA 3F5GA 4AZSA 1SVGA 4BIDA 4O86A 2OSCA 4RWJA 3DLSA 4FVQA 3OOGA 4C4JA 2XK6A 5DI1A 5CAQA 2CNVA 3NX8A 4GT3A 5CF5A 5BVKA 4BCOA 3OTVA 4PL5A 2WGJA 1JSTA 3VNTA 3R7UA 1F0QA 3OCGA 4HGEA 4O6EA 5IF1A 3FBVA 4WNOA 4RMZA 1KE7A 3ORKA 2P55A 2NP8A 3RNYA 2OW3A 2RFEA 4WNMA 4O7ZA 3SHEA 2C30A 3LJ1A 4NK9A 5IMEA 3N4TA 3DQXA 3UC4A 4AFEA 3GOKA 3SQQA 4EHGA 2OXXA 1A48A 4FVPA 4DGLC 3KVXA 3ZFXA 4BCFA 4GVJA 4BCPA 5CX9A 4AGCA 3ATTA 4O7WA 4OGRA 4YHJA 1NVRA 3G51A 3WYXA 5BYZA 5D7VA 5CAVA 4Y5HA 2UV2A 1LP4A 3GENA 5EW9A 5LWMA 2XUUA 1IA9A 4NJDA 5KX8A 1H4LA 5AV3A 4YJNA 3V8SA 1ZARA 2C3IB 2XEZA 5CEIA 3E62A 4CTCA 2AC3A 5HIBA 3P0MA 4MWHA 2C0IA 4HPUE 3E3BX 2PMIA 4H3QA 4JDHA 4C02A 4MEDA 2B54A 4D2VA 5IA0A 2QOHA 3NUSA 2YM5A 4QMWA 3RZBA 3IW6A 4KABA 2ITYA 3ENHA 4ITHA 3BKBA 4RFMA 4CMOA 2C1AA 3ETAA 3CGOA 4DHFA 1T46A 3CC6A 4EWHA 5AUTA 4MXXA 4A4XA 4ANBA 4W9WA 2R64A 2X2KA 4GFOA 5GHVA 3WF8A 1UA2A 4BDGA 1K3AA 3A62A 4FR4A 4YO6A 3B8RA 4GW8A 3ZBXA 4CVAA 3DAKA 4GYIA 1UU9A 2WTWA 3UO6A 5EDPA 4BCKA 4UMUA 2I0YA 2J90A 2JDRA 3V5PA 4EHEA 5KCVA 4PPAA 4O2ZA 3DJ5A 4FNWA 4FV2A 4ZJIA 1RJBA 3MA6A 3IDCA 4U44A 3VUKA 3BHTA 3ZXTA 4AE6A 4B6LA 2ITUA 4QP8A 4M0YA 3PP1A 5E8WA 4B99A 2HY0A 5ANDA 3PPKA 5BQ0A 4JX7A 4K0YA 4M69B 4NU1A 3OWKA 4IWPA 4HVDA 3ID6C 4M97A 1PXNA 5FD2A 3RAWA 3G6GA 4UY9A 5BMMA 4L43A 4FT3A 3K3IA 2PVJA 4QTEA 3DFAA 4IW0A 3E8NA 3PJ8A 3UP7A 3QRUA 3AT4A 4R77A 4QMOA 4DH8A 2BDFA 3GC7A 3RTPA 5M09A 3SW7A 1STCE 2OBJA 3ORLA 2GMXA 3E8EA 3U51A 4CQEA 2F2CB 3C9WA 4FG8A 4TPTA 5H2UA 3QQLA 4ID7A 4RJ5A 4HCUA 1ZMVA 3AC4A 3R8VA 2XJ0A 4R7IA 1JAMA 2WAJA 3QTXA 5KMJA 3OBGA 2ONLA 2W1GA 1W98A 3ZU7A 3F69A 4FL2A 3HDMA 4I41A 2BFYA 3V04A 4MD9E 3ANQA 4AP7A 2XCKA 4H39A 4L46A 2X7FA 3PA3A 2XK3A 2WD1A 4U81A 4KSPA 4YNEA 5M4CA 3RI1A 3ZCLA 1WBPA 3MTLA 3C4XA 2XKCA 5C03A 4GT5A 1Y91A 2YCQA 3EHAA 2WQNA 2WNTA 5J95A 3NPCA 4FZFB 5FG8A 1XBAA 3ACKA 4IC8A 4L68A 4Y83A 4Z55A 3BZ3A 1MUOA 5DFPA 2C47A 2H6DA 4HYSA 3TACA 4C36A 3SD0A 5EDQA 3U9CA 2UZBA 3GFWA 4Q9SA 4XOZA 1KV2A 4Q9ZA 1EH4A 3D2KA 3GVUA 1O6YA 1KE8A 5C8NA 1UU8A 3DGKA 3Q5IA 3L8XA 4E6QA 3WIKA 3BYMA 4ZSAA 2DUVA 3EQFA 3R0TA 5AUVA 4PF4A 4V0GA 4QYFA 3TI1A 4NL0A 2XK8A 5AV1A 5JMSA 2NPQA 1XKKA 2Q83A 3FMEA 4OT6A 4ZSEA 2QOKA 3QZGA 1FMOE 4FGBA 4DGMA 4D1ZA 2G1TA 3WZUA 1JBPE 4TYHA 5KMLA 3UIMA 4TTHB 4F64A 1ZZLA 4K77A 3KRXA 4AT5A 1SM2A 4FIIA 4RPVA 3GCSA 4F7NA 3WILA 4BGQA 4JBQA 4M68A 4XJ0A 2X0GA 5AR7A 3U4WA 2ITZA 3Q4TA 4MXYA 4MD7E 3UVQA 5HIEA 3A7GA 4D1XA 5H8BA 4IWQA 5CEKA 4BDHA 1XWSA 1IASA 4IC7A 4I4FA 4E6AA 2IO6A 3MWUA 2OZOA 4ZZMA 5EYMA 5GZ9A 5DGZA 4WSYA 1ZYDA 3M42A 1JKSA 4LRJA 1VYWA 3IDPA 5A4TA 4IM0A 2W4KA 3PVBA 5CXHA 2J0KA 5ANOA 3IO7A 2QR7A 4LMNA 4IB5A 2B55A 3C4ZA 3BHUA 3VS7A 4YJRA 2Y4PA 2QKWB 3EOCA 1IR3A 2VWZA 4KIKA 2F7ZE 2UZUE 5CEMA 3FHIA 4FTLA 3NMUF 5BMSA 5A3XA 3EIDA 3ERKA 3FZRA 3FLYA 1OVEA 2IWIA 4PPBA 1K2PA 3GU8A 2QNJA 2OF2A 4XS2A 4AFJA 3DU8A 1CMKE 2GDOA 3OEZA 4CKJA 2DQ7X 3R8LA 1OIYA 3O8UA 4ZJJA 3K3JA 3L1SA 3WE8A 4YC6A 4R3PA 4XMOA 4YHFA 4R3RA 2E9NA 4X2JA 3JY9A 4EK5A 5EM6A 4W8DA 3UJGA 1XH4A 4FKQA 5L8LA 3E7VA 4RVKA 2YABA 4YJTA 4AZWA 3TIYA 4D4RA 1WVYA 3O51A 4J98A 4L67A 5AUWA 1UNGA 4PDPA 2PVKA 4RIYB 4S2ZA 2VTTA 2V7OA 5FXRA 2X1NA 4GKHA 4E4MA 3FMLA 4CMUA 2ETRA 4ACDA 3HKOA 5I3RA 2YJSA 1FVVA 1MRUA 4G17A 4M15A 3PJ1A 1R39A 4DITA 4UMRA 1JWHA 4FSMA 2QOFA 5B2MA 2OFUA 3BX5A 2XNNA 3UBDA 4PNKA 3D2IA 3KY2A 2PMNX 4XP0A 4AAAA 1V0PA 2B9IA 2B9FA 4GV1A 2O8YA 3ORXA 4AT4A 2Z8CA 4NT4A 4OTWA 4O22A 3FI3A 4X3JA 5IA3A 3HUCA 3UODA 1ZZ2A 4EOIA 4GK3A 5LVOA 2VTPA 1E1VA 4O6LA 4RFZA 3KF4A 4MF1A 4TT7A 4HW7A 2RSVA 2A2AA 3BLRA 1S9IA 3H3CA 4DYMA 2FB8A 2Z7RA 4F63A 3IONA 5JK3A 5M57A 4OR5A 2BZKB 5EQEA 2BPMA 5HI2A 4GL9A 1YWVA 3U8WA 2JFLA 1YKRA 3E88A 4CZYB 1PMUA 4ZIMA 3AMYA 3ELJA 5I5ZA 3E7OA 4MQ1A 5C9CA 3PG3A 2IVUA 3GU7A 5DVRA 1QPJA 2WMXA 4LOQA 5L6OA 4TKSA 2PZ5A 5A4EA 4O83A 3LJ0A 2RFNA 5AV0A 3O7LD 3PWYA 4ZLOA 5TR6A 5IH5A 2WIPA 5J5TA 3VVHA 5IQDA 1XH5A 2BTRA 3R9OA 4DH7A 2PWLA 3M11A 4RRVA 4WHZA 3MH3A 2RL5A 3FQEA 1HCLA 3GC9A 3QL8A 3W8LA 2YCFA 4BCNA 3BIZA 4AZTA 3LCKA 5IZFA 3VS4A 4HVSA 5BVNA 3DXNA 4C8BA 5LWNA 3AMBA 4QMLA 5H9BA 5HU3A 2Q0NA 5EM8A 1GAGA 3KGAA 4O21A 4QNYA 3SC1A 3VBXA 3FMKA 5DYJA 3CEKA 3S00A 3QD4A 4R1VA 4V05A 2A19B 2X2LA 3NNWA 5DRDA 4EH7A 2C4GA 2W1ZA 5HE1A 1DS5A 2OK1A 2X81A 3JYAA 3ZO4A 2R3GA 2WMSA 4FMQA 1NXKA 1VZOA 3AD5A 4NEUA 1XHAA 4CYJA 4MH7A 2R0IA 4ZXTA 3VUDA 3N4UA 1LEZA 4EONA 2QURA 1NW1A 3AQVA 4FNYA 3LCDA 3UPXA 4EH6A 4R78A 4O38A 3ZONA 1WVWA 2YZAA 4J8MA 3QXPA 5IQAA 4CTBA 4DTKA 4KS7A 4EOJA 5BUIA 4W8EA 4TN6A 3NIEA 2C3LA 2RKUA 2VTMA 3F5PA 4QPSA 3PY0A 4RSSA 3PPJA 5B0XA 1BKXA 1PMEA 3EZRA 5E8YA 4BWXA 3LMIA 4LRKA 2G15A 4D2TA 5CSPA 1SZMA 1VYZA 3QUPA 3BQRA 3BWFA 4Q2AA 2QHNA 3PWDA 4AZFA 3C0GA 4CLIA 4MCVA 4FKOA 1ZLTA 5AR2A 2RFSA 3CP9A 2XIZA 4DFYA 5IEVA 2R0UA 2C6MA 4J1RA 4TNDA 4BDDA 3LKMA 4BTJA 3RHKA 3ZYAA 2F2UA 4HZSA 2OJIA 2IW8A 3RKBA 4A9YA 4JR7A 2XK9A 4E4XA 5L2TA 1J7UA 3TJCA 1S9JA 4AACA 5FM3A 5M55A 2YN8A 3TXOA 4DFZE 5DMZA 4YO4A 3NIZA 2OXDA 3FC1X 3R28A 2UW0A 3I79A 3PSBA 4MAOA 4S30A 4USDA 3SLSA 3WE4A 3OXZA 3ZTXA 4DFLA 3SXSA 4AQCA 5KBRA 4D28A 3R73A 5IA4A 2XNMA 5EFQA 2LAVA 1WBOA 3RPVA 2XRWA 3FUPA 4QTBA 1KWPA 2BRMA 4PDSA 5AUYA 3RGFA 2YJRA 3Q96A 4FV6A 2V22A 5L6WL 4BR3A 4F0IA 2V7AA 3WF9A 3PY3A 3KU2A 4F9YA 5DE2A 5E7RA 5HD7A 4ACGA 2WMUA 2BRGA 4QMQA 5DEWA 1G8AA 3QQJA 3POOA 1OKYA 5KMMA 3E92A 1B6CB 3R8PA 2PMLX 5LVLA 4K6ZA 2EXMA 4JQ8A 5DPVA 1MRVA 3MA3A 4IAFA 3Q2JA 5CI6A 2PY3A 3IECA 2HZ0A 2UZLA 4BGGA 5EOBA 4E26A 3BELA 4FV8A 4TZRA 4EHVA 2VO3A 2ZOQA 3BYSA 4FKPA 4QP4A 3RCDA 3VUHA 3W1FA 5I9YA 2WZJA 5IPJA 5M4IA 1PY5A 2UW8A 3SVVA 3FLQA 4IANA 4WG5A 2Z02A 4RX5A 5CVHA 4AOJA 4DBNA 3KRRA 4DT9A 4WKQA 2W7XA 3FQHA 3VBWA 3RWQA 3HEGA 3FKOA 4D9TA 4QP1A 3CD3A 4C4EA 1G5SA 2BRNA 2B0QA 4DEBA 2CPKE 3UYTA 5LVNA 4RBLA 5TO8A 2EXCX 3BHVA 4B4LA 3LE6A 2I6LA 2WTIA 3MJ2A 2GHMA 4QYYA 4KRDA 4YC8A 2KTYA 4JBOA 2VX0A 3VBQA 4AN9A 3UC3A 2BAJA 1P14A 2YM6A 4F9WA 3DY7A 3OF0A 5A4QA 4WBBB 4D58A 5ANKA 4BL1A 1MQ4A 5IUIA 3VBVA 2Q0BA 3HMPA 5D12A 4Y46A 2FUMA 3T3VA 1BI8A 4FKSA 4IE9A 2IVSA 2PVYA 1VEBA 3FI4A 3OXIA 5CF4A 4FTIA 5HORA 2BKKA 1G3NA 3BCEA 4X21A 4NW6A 4O1PA 4RVMA 4FGRA 4ZAUA 4IWOA 4IAAA 2WMQA 3HV4A 5DT4A 3IG7A 4NWMA 3UIXA 3QUEA 3MS9A 1WBSA 3JPVA 4FTCA 3PG1A 1DI9A 4CFXA 4CT1A 3TV4A 3VUTA 4NKAA 2YIRA 3KXZA 4KBAA 4QMPA 4X2FA 5AX9A 3UPZA 3MH2A 2BHHA 4KKHA 1JQHA 5CU2A 1WAKA 4RJ4A 3R9NA 1TQMA 3IDBA 3KQ7A 4FV4A 2BMCA 3VJNA 4GMYA 2ERZE 2R3IA 2ZYBA 4H1MA 3ZEPA 1QCFA 3CKWA 1A06A 3MH0A 4CCBA 4UYAA 5CLPA 4CEGA 4ZZOA 3LXLA 4YSJA 4Z16A 4LUEA 4RG0A 4MF0A 1Q99A 5AMNA 4J96A 3ODYX 5AM6A 5DH3A 4N57A 4FV1A 4OTQA 5AP4A 2PK9A 2REIA 3R21A 4QYHA 4UV0A 1YHWA 3RVGA 4ZY4A 3D5UA 5CZIA 3SV0A 2XIRA 4BCQA 4EORA 3NUXA 2ZV9A 4Y85A 4ALVA 2RF9A 4PMSA 3GEQA 4C0TA 3UDBA 3HLLA 2IZUA 4ENYA 4FTQA 4G31A 3LJ2A 5E8UA 2PUUA 3AT2A 3Q4CA 4BHNA 4A9UA 3DOGA 3U6JA 3ORPA 3UIBA 2F7XE 4F9AA 3TTIA 3O7LB 4QP3A 3Q53A 2JKQA 4QMZA 4U97A 4IFGA 3PYYA 2XMYA 3F3WA 4D5KA 4O7TA 2G01A 4I22A 3P9JA 5HHWA 4NCTA 5E92A 3P86A 3BHYA 4EJNA 1E9HA 5FTGA 4G6OA 2HZIA 1YWNA 4GUEA 1GIJA 1M2PA 4JVGA 4EKKA 2BZJA 3FSFA 4DG3E 5T6KA 5IQCA 5E91A 5K4JA 4O7SA 4BGHA 2GPHA 3TNWA 2WELA 3SX9A 3T8OA 3O2MA 2I1MA 3LPBA 4I1ZA 2GNIA 4NTSA 4XG4A 2VTOA 5L2IA 1A9UA 3Q9YA 2G2FA 1YI4A 3M2WA 4B0GA 3CSVA 2P4IA 3CTJA 4BYJA 3D7ZA 1YWRA 4MWIA 5CTPA 2QO7A 5HTBA 4DF3A 4IZ5A 3TUCA 4TYGA 4NW5A 3TUDA 2XNEA 3LLAA 3BI6A 4EQMA 3BU6A 4RIYA 5GIOE 1YHSA 3ORZA 3ZZWA 3EKKA 5LCJA 4KIKB 4EC8A 3KRWA 3VRZA 3AD4A 2OKRA 4AW0A 1LEWA 3NUNA 2V0DA 2JAMA 3BGZA 4KSQA 2RIOA 3GXLA 3ORTA 4NUSA 1M52A 4OTRA 4CSVA 1GZOA 1KOBA 2SRCA 2YLEA 1XBBA 4DFUA 4FL1A 1CKJA 1CKIA 1XJDA 3C0IA 4UB7A 5DEYA 3TKIA 4BDBA 2IZTA 1Q8UA 4CFFA 4AE9A 4UMTA 2J51A 4L6QA 4M14A 3DZOA 4FZ7A 4IX4A 4CRSA 3PLSA 4AW5A 2UW9A 4EUUA 4NCTC 1O6KA 5M53A 1GOLA 4PTGA 2GNHA 3OUKA 2WPAA 3R1SA 4MXZA 4ARKA 4FEQA 2VN9A 3LCSA 5ANEA 2ZV7A 4IM3A 4WG4A 2ZM4A 3FMNA 2XK4A 3K54A 3SOAA 3QZIA 3DKCA 4U41A 4EH3A 2JITA 4MXCA 5IA1A 3CTHA 3CTQA 3QCXA 4O0UA 3GC0A 4FIEA 1REJA 5HQ0A 3NYXA 2UZNA 2I0HA 2YCSA 4ZTLA 5IUHA 2X8EA 1W83A 3A4PA 3QZHA 4PUZA 4MYGA 1NT2A 1R3CA 3QTQA 1UNHA 5D9HA 2HIWA 2HXLA 2R9SA 4KRCA 4FICA 2G9XA 4YGAA 3MVLA 5J79A 4C58A 2BHEA 3C1XA 4RX7A 1V1KA 3FJQE 1U54B 5A4CA 3KN5A 3PRFA 3QF9A 3TV7A 1E1XA 3RPYA 4A4OA 5AP1A 5AAEA 5HBJA 4I6FA 2W5BA 3MBLA 2PZIA 4JT3A 5FTOA 3G5DA 4KA3A 5LQFA 1YXSA 2J6MA 4QMTA 4RA5A 3NZ0A 3WOWA 1SVEA 3LVPA 4YTIA 3TKHA 4J95A 3R04A 2G2IA 1GIHA 2IZSA 3LXPA 3O0GA 4C2VA 3QTRA 4DT8A 3LFDA 2A27A 4IX3A 3BLHA 4UXQA 4X6RA 4J71A 4YPDA 4IAYA 4ZMEA 3VO3A 1P2AA 3DPKA 1ZYSA 4HCVA 4ITIA 4HVHA 3F2AA 4YLJA 4Z7GA 4BIEA 2HZNA 3PVUA 3TZ7A 5M4UA 3NR9A 1W8CA 2ETMA 2V5QA 4CNHA 3SG8A 4WUNA 3NCZA 2QOCA 3I7CA 2J7TA 4PX6A 3OUNB 4WSQA 4BY9E 5F94A 1JKKA 2BZHB 2FVDA 4YZ9A 5B2KA 2IG7A 3KMUA 2ESMA 2JDTA 3P79A 4M7IA 2BCJA 4FYNA 3KXMA 4WO5A 3RAHA 4DH3A 2C5OA 2YM8A 5BVWA 2OJGA 4I6BA 5DN3A 4PMPA 3FI8A 3MB7A 4F7LA 3BE2A 4NM7A 4S32A 4L7SA 1Q3WA 4B8LA 1B38A 3KL8A 3DK6A 3FQSA 4P7EA 2GS7A 2YDKA 4G9RA 4GVAA 4KKEA 2PVLA 5FBOA 3FEGA 5IISA 4BDKA 4D2WA 4D4VA 2B4SB 1AGWA 2O64A 2W4OA 4PY1A 5GNKA 4K1BA 5HVYA 3E5AA 4U79A 3ODZX 4E93A 5JZJA 1XBCA 4FTOA 5EYKA 2GNGA 4A9RA 4BVUA 4W4VA 4O82A 4FV7A 3OVVA 3P1AA 1M7QA 4U45A 1OB3A 3ALNA 5E4HA 2F9GA 3ANRA 2ITNA 3ULZA 1OL5A 4RJ8A 3CR0A 5ICPA 1IAHA 4EH4A 2ITVA 4FT7A 1OECA 2F57A 4C4IA 3DJ6A 5AP3A 2YAKA 2VRXA 1H27A 1W7HA 1YOLA 3HV3A 3S95A 4NJ3A 5LXMA 1ZXEA 4PP9A 1OIQA 4FSNA 3N9XA 4AU8A 1UKIA 3OG7A 4O2PA 5BVEA 5AR4A 4CZUA 3I6WA 4QTCA 4GK4A 4N6YA 2ITTA 4HGTA 3G9NA 2V55A 4RQVA 3CE3A 5FEQA 4BCHA 5M4FA 2C69A 3KK8A 5IQFA 3SXFA 2XIKA 3UQCA 5KMKA 5CU4A 2B9HA 3QAME 3UOKA 4ANOA 3ZLSA 3VS2A 4R8QA 1H07A 3RM6A 4AA5A 3D9VA 3LIJA 3MI9A 1FGKA 1ZOGA 3DNDA 3RAKA 3F88A 3SOCA 3PSCA 3ZRLA 4UN0C 2W1DA 2RG6A 5EM7A 4KWPA 4G16A 1ZMUA 3F61A 4C4GA 5A14A 3V5JA 1B39A 2HW6A 5J7BA 4I5MA 1WBWA 4EUTA 2ZDUA 2GS6A 1ZYCA 2E9VA 2WO6A 3C50A 2OU7A 3R9DA 2R7IA 4QMNA 5BVDA 3MSSA 4DE4A 4PWNA 3GNIB 1YHVA 5I4NA 3KRLA 1YI6A 3EQDA 4W4YA 2YFXA 4E5AX 1CKPA 3IS5A 4JOAA 3CXWA 5F20A 4XG6A 5L2QA 4L53A 2NO3A 2YACA 2VNYA 3Q5ZA 5HESA 1PYEA 2BIYA 3A2CA 2JC6A 1L3RE 3QD3A 3NWWA 4BIBA 3TT0A 2PVFA 3I1AA 1W84A 3R2YA 1F5QA 4IX5A 4TXCA 2VUWA 1GJOA 5BPYA 3VC4A 3RK9A 4TYEA 2WMBA 4XX9A 2P2IA 3JS2A 2VV9A 1GZKA 4NKSA 3RAIA 5JEBA 3CY3A 3HMOA 5I9UA 3VS5A 2X4FA 4PRJA 3IKAA 2PMOX 3G0FA 2RGPA 4IJPA 4DEDA 2YHVA 3GU6A 3PDTA 1O9UA 2W9ZB 3FMDA 1AQ1A 2VO0A 5KBQA 4O81A 1QL6A 4UWBA 4F6UA 1IG1A 1TKIA 3UVPA 5KMIA 4A9TA 2OIDA 5L3AA 2IZRA 4ZTRA 5DHJA 4LV5A 4CYIA 4ZSLA 5HKMA 2GQGA 3C7QA 1GNGA 3GCVA 1PKDA 4YZDA 4JX3A 3TZMA 5IA5A 4UEUA 4PMTA 4E6DA 4JBVA 5ACBC 2FSOX 1JPAA 4G5PA 3KB7A 4RX8A 3PXRA 4OLIA 3HNGA 4APPA 2KULA 4CV9A 1OBGA 4H05A 4IX6A 4EWQA 4PTEA 2X7OA 4Z3VA 5EQPA 3AD6A 5M51A 5HG8A 1Q4LA 4EK3A 1URWA 4GIIA 3DB8A 3U54A 2DS1A 4G3CA 2CKPA 3MVMA 2C5VA 5JSMA 4O96A 1PW2A 1IEPA 4X2KA 3FXZA 5AEPA 5CEPA 5I9ZA 5K9IA 3MFTA 3PIXA 2XP2A 4PQNA 3B2WA 4K8AA 3EQBA 4UWYA 5HO6A 4KBKA 1YDRE 2XS0A 4B9DA 4D2PA 1OUKA 2UZTA 3ZH8A 5DIAA 4HVGA 4U80A 2JBPA 3NW7A 4R6VA 4BICA 3RP9A 4DN5A 3DS6A 4EOOA 5J1VA 3C4FA 4AS0A 3CKXA 3NUUA 3DNEA 4AN2A 4RIOA 1TQPA 2VWYA 4TWNA 4FSTA 4ZZNA 3RM7A 3HYHA 4OAVB 3HV5A 1ATPE 4NIFB 2QO9A 2XJ2A 4LMUA 4S31A 1OM1A 3TNPC 2CCHA 5AA9A 1Q3DA 3G90X 3WZJA 3FZPA 4G3GA 3UIUA 1JSVA 3D15A 3ZMMA 4JDJA 4I94A 3ZLXA 4OT5A 4QOXA 5HBEA 4DCAA 5KUPA 1Y8GA 1Y6AA 2QG5A 4I5PA 4CKRA 4IB3A 1H26A 4XNEA 3RHXA 4EKLA 4FSQA 3L9MA 2QOLA 3ORNA 3PJCA 4L01A 4U0IA 3LAUA 3PZHA 2BRBA 4G3DA 4OUCA 5D10A 4UZHA 3R6XA 4ZK5A 4WA9A 3HV7A 3NS9A 3PIZA 3UMWA 4HNFA 1KE9A 4AOIA 2QVSE 3L8VA 4HGLA 1XQZA 4UZDA 5HGIA 4BF2A 2IN6A 5A54A 4UX9A 4OTFA 3ZSGA 3LFCA 2JAVA 3IOPA 4X2GA 3BGQA 3AC8A 4FTTA 5HCXA 5HO8A 2Z7QA 3W2RA 3KREA 3D94A 3RZFA 2C3JA 2X2MA 4A9SA 1CDKA 3EN5A 4LGHA 4CD0A 2B9JA 3EFLA 2EB3A 3WF6A 3UNKA 3OTUA 2YIYA 4FIJA 4U43A 4XOYA 3EB0A 4KAOA 5CVFA 2VWIA 5HG7A 4QMSA 2ONLC 1M14A 3RPSA 3EL7A 3VUGA 2LGCA 2YIWA 3VS6A 4CFUA 4CKIA 4XV1A 2UVXA 1FOTA 3DBDA 5JFVA 3OEFX 4RIXA 3AC5A 5EM5A 5HU9A 3QCSA 4USEA 5CF6A 1OIRA 4XV2A 1OBDA 4D1SA 4BBMA 3H10A 3R7OA 4EQCA 4ZMFA 1H08A 2QI8A 2OH4A 2JBOA 3QYZA 3OHTA 3G6HA 4AN3A 4EOKA 4ERKA 4FZ6A 4FZAB 3FMMA 4OBOA 3IK3A 3Q4UA 1QPDA 2C5XA 2JKOA 5CT0A 3RALA 4JQ7A 2Y0AA 3AOXA 2BAKA 5E90A 4IZAA 4FV9A 4B8MA 3QD2B 4EOMA 5CNNA 2J0IA 4BTKA 1BX6A 4JAJA 3LM0A 2JFMA 3C5IA 1RW8A 5FQDC 2X8IA 4NM3A 2IJMA 3OS3A 3CPCA 1QMZA 5EYCA 1I09A 3QA0A 4BTFA 5HLPA 4MX9A 5FDPA 3OP5A 5AUZA 4KBCA 5CALA 2GFCA 4O0SA 3VQUA 5L2SA 2W5HA 3HV6A 3COHA 4EBVA 4X3FA 3SDJA 4CZTA 4K18A 3OBJA 5EW8A 4YURA 2CNUA 2YIQA 2HWOA 4IVBA 3F3ZA 3PA4A 4BB4A 2J2IB 4K33A 5LMKC 4JAIA 5JZNA 3SG9A 3EN7A 4LGGA 3REPA 1KE6A 2P0CA 4ACCA 5KHXA 3AC1A 3QQFA 5HE2A 1G8SA 4O7NA 3L9LA 5EHYA 3AT3A 4AW1A 4O7RA 2OF4A 2J5EA 4QTDA 3P23A 5LJJA 2JDOA 4GRBA 5C8KA 2BKZA 3EN4A 3TNIA 4RWIA 3OWJA 3PA5A 3MJ1A 4MNFA 3PY1A 2E9PA 5K0XA 1JSUA 2PE1A 2EU9A 1H1WA 3WBLA 3IW7A 2C6IA 2XH5A 2XKFA 3Q04A 3ZSHA 4AGUA 2XKEA 2YEXA 3GB2A 3R22A 3ZUVA 1H1SA 5FWKK 2WXVA 2B53A 5C26A 1OL1A 2FGIA 3UOLA 3ZEWA 3CQWA 3WI6A 3UNJA 5HLWA 4S33A 4E8AA 5HD4A 2W1FA 3KKVA 2VWXA 4CGAA 4CG8A 2UZDA 4NZWB 3R7YA 3VW6A 1VR2A 5LMAA 5AIKA 4K11A 4D4SA 5FTQA 5I9XA 3WYYA 3E8CA 2GCDA 5L8JA 4ZSJA 1Q41A 5HICA 4IWDA 4X6QC 4FSZA 4UXLA 3R01A 5CT7A 1M2RA 2BAQA 3F9NA 4QQCA 4D2SA 3POZA 4KD1A 4YZCA 4RLKA 4FE2A 4BDEA 3QHWA 3DBCA 4OBPA 4ANNA 1QPEA 5J1WA 2BZIB 4C62A 1FINA 2XBAA 4I5HA 3KXHA 3CGFA 3CJGA 2X7GA 3QTSA 4ITJA 5DT3A 5CEOA 2C5YA 3BU3A 1WCCA 4EHZA 5E8ZA 5CF8A 3TDWA 2JLDA 1BL6A 4GYGA 3H30A 1UVRA 5HE3A 2HXQA 4RQKA 3FC2A 3PXYA 3MH1A 3QLFA 5AAFA 4BZOA 3V01A 2FA2A 5HNBA 2WEVA 3U9NA 3V5QA 3NYOA 3SAYA 3KN6A 3MGYA 4FOBA 4I24A 2C6OA 2P2HA 4FEVA 3MY0A 3ZFYA 4O27B 3WF7A 3BU5A 3FZ1A 4IXPA 3ZSIA 4QD6A 3N4VA 4GG7A 4U7ZA 1WBVA 4AA4A 4L7FA 2VTLA 2CMWA 3PZEA 4LI5A 4F1OA 2ZM1A 2WQOA 4I0SA 3V8WA 4FKLA 4CFNA 1DAYA 3TEIA 5CASA 1NY3A 1GZ8A 3DBFA 3DZQA 4GK2A 4U42A 1OKVA 3ZUTA 1YQJA 1UU7A 3ULIA 2QOQA 2R3OA 2WTJA 3Q6WA 4F4PA 3LM5A 2BALA 3I81A 5TKDA 3BQCA 5CU0A 5GZAA 4JJRA 2F7EE 2WQMA 4N0SA 5TF9A 3W33A 3F7ZA 5J9ZA 2VO6A 2ACXA 2C5NA 4APCA 4YTFA 2XVDA 3A7HA 1Q97A 1YW2A 2VWUA 4FTKA 3PIYA 1BMKA 2YM3A 4HZRA 4J7BA 4JR3A 4EZ5A 4ZS0A 1OKZA 1OPJA 3ZC6A 3QRTA 2HWPA 3KXGA 5ETAA 2EVAA 3E3PA 4EL9A 3MN3A 2CSNA 3A60A 3S4QA 4L44A 3HAVA 4D2RA 3IW5A 5CU3A 4QMYA 3BEGA 3ITZA 4IH8A 4EI4A 4DINA 4MQ2A 2Y7JA 4BBFA 2IPXA 4HYIA 3W16A 3EFWA 4PP7A 3PXQA 3SA0A 2OZAB 4BC6A 1U5QA 4FUXA 3KC3A 1IRKA 2C68A 4GH2A 1XR1A 5CAUA 4C61A 4DFBA 4FL3A 4EJ7A 4FKWA 3MPAA 2B52A 4MXAA 2XCHA 2PVRA 4FKVA 4GEOA 4BRXA 4R1YA 4IIRA 3O23A 2ITQA 3QTUA 3QCYA 4GIHA 4DFXE 5KHWA 2OXYA 3W2QA 2VAGA 4TYHB 1OGUA 2DWBA 4FTNA 1OKWA 2AUHA 2A1AB 4RWKA 5B7VA 1R0EA 3RK5A 4QYEA 3UOJA 4ZP5A 4A7CA 3VBYA 1PJKA 3FLNC 3UZPA 1YXTA 4AT3A 1R1WA 3MB6A 3K5UA 4BN1A 3KRJA 3MVHA 2VTHA 1OUYA 2UW6A 4J99A 2Y6OA 4O1OA 3R7IA 2R3LA 3QUDA 3ZO1A 4DEEA 4RVTA 4JG7A 2CLXA 3BHHA 4L52A 1LR4A 3F7WA 2NRUA 3LFNA 4JI9A 1RQQA 1NVQA 1OITA 5HO7A 4LOPA 4U5JA 2J50A 3D0EA 3H4JA 4KB8A 3LCTA 3R8ZA 4CG9A 4Q5HA 4TYIA 5EKNA 5K4IA 1URCA 3BLQA 3SW4A 3R9HA 2ZDTA 3FZSA 1RE8A 4O0TA 4C59A 5EG3A 3FAAA 3PSDA 4V0GB 1OPKA 4FT0A 3FXWA 1JNKA 3BYVA 2O5KA 4AG8A 3R1YA 3CD8A 4D4YA 3JY0A 2R3KA 3NNXA 1Q61A 4GCJA 4X3FC 1PRYA 4MBIA 3LFQA 4J52A 4BCJA 4G3EA 1ZY4A 3PVWA 3I7BA 3BV3A 3TDVA 2Z60A 3Q60A 4AXAA 4OTIA 3LFBA 3S3IA 3COMA 1XH6A 2H8HA 3QD0A 4GKIA 2FO0A 5I0BA 1YXXA 5GJGA 5J87A 3W2CA 4MXOA 5DR2A 4UMPA 3CCNA 3I60A 2OI4X 3FPMA 4ONAA 1OL7A 1H1RA 1BLXA 2XA4A 1SNXA 4JS8A 5KMOA 4J8NA 3E8DA 4XLVA 4B7TA 5ANGA 4X7QA 5F95A 5GZ8A 4QMVA 2XNGA 1HOWA 2VWVA 4IAKA 3UQGA 4AWIA 5EYDA 4ANQA 4E4LA 2ERKA 4I23A 2VZ6A 5A6NA 3KF7A 3SRVB 2OZAA 2UVZA 3HDNA 2UZVA 4P5ZA 4KUJA 4LL5A 2GNJA 4ZY5A 2W4JA 4PL4A 3NVKI 3PP0A 2R3JA 3E63A 4MBJA 3ZOSA 4DC2A 4I21A 4I3ZA 4K2RA 5C01A 3OC1A 4X2NA 2A4LA 5HTIA 3U6IA 2WOTA 3D14A 2X39A 3EN9A 4BKZA 4F65A 3WIGA 1O6LA 5BYLA 4TYJA 2HY81 4FC0A 3COKA 2E2BA 5FEEA 5IH6A 5LARA 4DCEA 4TRLA 1FPUA 3IPHA 1FBNA 1YDSE 4I6QA 4F9CA 4M13A 2FSTX 4KNBA 2HYYA 1Q8WA 2PVHA 4YJVA 1UV5A 1XH7A 2EUFB 1PXLA 2QU5A 3FLWA 1WVXA 3LFSA 4PL3A 5CSHA 4IFCA 3UP2A 5FP6A 3VULA 4IVAA 2ETKA 4L42A 2XKDA 2UZOA 4G9CA 4XCUA 3D4QA 2QC6A 3ACJA 2IVTA 4FBXA 2FYSA 2O63A 3PE2A 4RX9A 3T9IA 4BI0A 3PJ2A 5DR9A 5CYIA 4N6ZA 3FZOA 2YA9A 5AP0A 2ZB1A 4WNKA 5AFVA 1RDQE 2HW7A 4I4EA 3UTOA 4IMYA 3VS0A 3FDNA 4ANLA 2W1EA 3GP0A 3L9NA 4FZDB 2PSQA 5I3OA 3V51A 5AAGA 4XP2A 1FGIA 2QHMA 2BFXA 3O96A 4TNBA 5JKGA 4OBQA 2O0UA 3WZEA 2WU7A 3F5UA 2GTNA 3QBNA 3I0QA 3NDMA 5EW3A 2BVAA 4ALUA 4HPTE 1JVPP 3TNHA 4EOPA 5L6PA 5E9EA 3BYUA 2W17A 2ZVAA 2J4ZA 3CBLA 4HOKA 4ASZA 3MFUA 3F3TA 1KE5A 3FYJX 1PXIA 4H1JA 3QHRA 5F4NA 2W0JA 2BDJA 4XP3A 4MTAA 4M69A 3HAMA 4H36A 1PXMA 1PXOA 4EK6A 3D7TA 3PRIA 3I4BA 4GUBA 3VW8A 3VUIA 4NM5A 4BDFA 1ZRZA 3DT1A 3JXWA 3PJ3A 5E1EA 1Z9XA 3EWHA 3OCTA 1UU3A 3QU0A 3OT8A 2CKEA 3H0YA 4RJ3A 4GFMA 2EB2A 3SGCA 4RIXB 3ALOA 2Y6MA 3FLSA 4ERWA 1U4DA 4M67A 1OZ1A 3UO5A 4E5WA 1UWHA 1WMKA 3LQ5A 4KIPA 4YC3A 5AIRA 2C6DA 3C4CA 4HYHA 4PNIA 4RA4A 4EK8A 4ZY6A 2P33A 4JLCA 3AXWA 2VX1A 3DB6A 3EYGA 4KIOA 5FEDA 1CM8A 4XG2A 5J8IA 4BI2A 2PUIA 1WFCA 4I93A 3KK9A 2UZEA 3G0EA 3IGGA 4FSYA 2H96A 5TOZA 2R3FA 2AYPA 4UALA 3GCQA 5C4KA 4FI1A 5HE0A 5KO1A 3ZRMA 1JOWB 4FKTA 3ORMA 4RWLA 2I0EA 4F99A 4USFA 5KKRB 3NW6A 2GHLA 5JGAA 1R78A 1BI7A 5TT7A 3P08A 4C2WA 5ITAA 2XBJA 1UKHA 1Y8YA 2QLUA 2Z7LA 3GT8A 5HCZA 2XNOA 4D0XA 1J3HA 4JG8A 5CNOA 2GFSA 5GINE 2GQRA 3A8XA 3K2LA 3PUPA 5E8SA 2QO2A 3P4KA 4ZTQA 4O0VA 4IAZA 2WKMA 4FKIA 4G6LA 4U9AA 4YP8A 3QTIA 3SRVA 4ORKA 2BR1A 3HZTA 3HA8A 3LFEA 5CZHA 2CJMA 1ND4A 3LHJA 4N4SA 3I6UA 2VGOA 2W96B 5D11A 2YISA 3FV8A 4FTRA 4V04A 3TZ9A 2X4ZA 4L00A 1YOJA 4XG8A 5JRSA 5HVKA 3QXOA 5FXQA 3QWJA 3QCQA 1SMHA 1V0BA 5AV4A 2JIUA 4PV0A 5KKRC 2WFYA 3CIKA 1JKTA 4U8ZA 2PZPA 4EC9A 5C4LA 1LPUA 4XG7A 1WBNA 3D5VA 3EZVA 1J1BA 3F2NA 4JG6A 2I0VA 4LRMA 2OG8A 3JUHA 4IEBA 3H0ZA 4JRNA 5G6VA 3A61A 4MK0A 3R8MA 2PULA 2CGVA 3QZFA 3GGFA 2GNFA 4W9XA 1XH8A 1FMKA 5ETIA 2WTKC 4DGGA 1YI3A 2NRYA 3QWKA 4GJ2A 4YBJA 4ZOGA 1AD5A 4BHZA 3LMHA 3EQRA 5D7AA 2OO8X 4RT7A 3FSKA 3QQUA 4FT5A 5F1ZA 3FYKX 3U87A 4BFMA 2WMAA 3V6RA 3JVRA 4FTMA 3AC2A 5GJDA 4IBMA 1FVRA 4Z7HA 3DK7A 4GJ3A 3MIYA 2BILB 3EN6A 3GQIA 3UE4A 3W2PA 1TQIA 3TG1A 4FOCA 2CNQA 4CCUA 4FIFA 4IZ7A 3LFAA 2CDZA 2ITOA 3NEWA
chains in the Genus database with same CATH superfamily
2X6EA 1NA7A 1UWJA 3EJ1A 3QTWA 3VWAA 3OY3A 4AOTA 5C8MA 4RGJA 4R5SA 3QRJA 2R5TA 3OCBA 3BYOA 4WRSA 5AJQA 4ANSA 3DKFA 5HG9A 3MY5A 1U46A 3OWPA 3VUMA 3FLZA 1H25A 1W0XC 3BBWA 3QC4A 4AZVA 2Z7SA 4BYIA 5JQ5A 3Q32A 1L8TA 2OWBA 4ANMA 4FUYA 3QTZA 3Q9ZA 3O50A 3R2BA 4BZDA 5B2LA 3RPOA 2C6LA 4YNOA 5JH6A 5CI7A 3QKLA 4JQEA 3ATSA 5L2WA 4P90A 5IQEA 2PYWA 2R3RA 3U6HA 5D41A 3A7FA 4WBOA 2H34A 2XJ1A 4A07A 3EYHA 5EHLA 2AQXA 4RZWA 1R0PA 5ANIA 2C3KA 3AGMA 2OFVA 3G9LX 3FE3A 2RFDA 3B8QA 3B2TA 4NFMA 4RLLA 2YZLA 3EQCA 2PE2A 1APME 4DGNA 3DDQA 4U3YA 2AC5A 2YITA 3OW3A 2YWVA 2UZWE 3F66A 4EOSA 1OL2A 3AGLA 4ACMA 1PXPA 3UMXA 3BL7A 1H00A 3H9RA 4FKRA 3PUFC 4L3PA 3HRFA 3Q9WA 3QKMA 1ZYJA 4YLLA 4AGDA 4NSTA 2HENA 3VBTA 2W05A 4DLIA 4DA5A 4BKJA 4AX8A 2X8DA 4FV3A 4Y95A 3DXPA 2XM8A 4F6SA 3RNIA 4BZNA 3GUBA 1J7IA 4OW8A 4XH6A 4ENXA 4YTCA 4JBPA 3MIAA 4H3BA 3WZKA 1SYKA 2C0OA 2VU3A 3TWJA 4AA0A 3LFFA 2NNWB 4DEIA 3GI3A 2ZAZA 3MPMA 3G33A 4RFYA 4FKJA 5AM7A 4BJJA 3BPRA 4QNAA 2R3MA 4XG3A 4FVRA 4E4NA 4GU6A 2UW5A 4D55A 3F82A 2WTVA 3UYSA 4FX3A 2F49A 3R63A 5CSVA 2YLFA 2R3QA 3R02A 2BTSA 5CSWA 5FM2A 5HEZA 3R7EA 5GIPE 2J5FA 4JDKA 4GU9A 4L3JA 3FI2A 3VIDA 4RC3A 1BUHA 2WTCA 3ET7A 2HZ4A 2XIYA 5JQ8A 2VGPA 4PMMA 3LW0A 4L9IA 3HP5A 2JGZA 3TNQB 4CFMA 5K3YA 4A06A 3JR1A 2O3PA 4UYNA 3W2OA 5E8TA 5KMNA 3R8UA 1I44A 5IEYA 1V0OA 4ZTHA 5FXSA 4FG9A 2YCRA 2HCKA 3LLTA 3L8PA 2CKQA 2BROA 3A99A 5EI6A 2E9OA 2YDJA 3COIA 1P5EA 1TVOA 4R5YA 3AG9A 3PTGA 3O71A 4RJ7A 1UNLA 2C6TA 3CQUA 4XV3A 3VHKA 4C7TA 4E20A 1QPCA 4LOOA 3DCVA 3HUBA 4GT4A 1X8BA 3HVCA 4P2KA 4Y5QA 3ROYA 3C5UA 4TWCA 3C4WA 4EH2A 3T9TA 5I9VA 5LOHA 2VO7A 3NNVA 4LV8A 4DDGA 3CQEA 2G2HA 1OPLA 3WF5A 5IMXA 4PPCA 4Z9LA 2I40A 5KZIA 4AF3A 3R71A 4IQ6A 2QQ7A 5FBNC 1PXKA 2W1IA 4BCIA 2XM9A 2JDVA 4O0XA 4F0GA 3FY2A 4WRGA 1Z5MA 2OIQA 4YBKA 3QX4A 3KCKA 2R3HA 4Y72A 1Z57A 5A9UA 2GS2A 5IH4A 2W1CA 3C0HA 3P7CA 3RINA 2ITWA 4BDIA 5IU2A 5KNJA 3UZTA 3Q9XA 4DDIA 5LMBA 4CMTA 5HX8A 3DDPA 3BGPA 2PVMA 2HAKA 4MNEA 4QP7A 5AP7A 5FUTA 4LUDA 3UOHA 4FEWA 1ZOHA 4E73A 3UNZA 3U4UA 2OJJA 2YM7A 4YJUA 5D1JA 3ZHPC 3TM0A 4BWPA 3ZC5A 3HGKA 4ASXA 1GIIA 4YHTA 4R3CA 3EFJA 1CSNA 3F3VA 4U6RA 3UGCA 3DXQA 4F78A 2VTNA 3GC8A 5CY3A 1YXVA 4M0ZA 4MNEB 1H0WA 4MUQA 2XNPA 3GBZA 4G1WA 4YJSA 3VF8A 3ZDUA 5M56A 3FMJA 4J53A 5EOLA 3SXRA 4C33A 3MESA 4H58A 3TCPA 4C34A 3QYWA 2XIXA 5EDRA 5L4QA 2P3GX 5JFSA 2XK7A 5BUJA 5A46A 3QRIA 2R3NA 3QRKA 5AV2A 2VTSA 1Y6BA 2Y8OA 2ZV8A 4DLJA 3NYVA 3UQFA 1Q62A 1H8FA 3BBTB 4EH5A 2E9UA 1WBTA 3V5LA 2VTQA 3R1NA 1U54A 3DTWA 1H24A 1PMVA 3A8WA 3UZRA 3IW8A 5H3QA 2UUEA 4QP6A 2C1BA 3CS9A 3RWPA 3MV5A 4I20A 5EI2A 2OICA 3VHEA 4RC2A 5CU6A 1JKLA 1XO2B 3LQ3A 2O2UA 2PPQA 1M2QA 3OCSA 2JKKA 5H8EA 3N51A 2PTKA 3IGOA 4NIFA 2OGVA 1OIUA 1Q24A 3W0MA 5AUUA 5IQHA 4BCGA 4D5HA 4X3FB 5K5NA 5AUXA 5M06A 4HCTA 3VN9A 3C13A 3FY0A 5DWRA 3Q52A 4OTPA 2BRHA 3EQHA 1K9AA 4OTGA 4QTAA 4E7WA 1ERKA 4WOVA 2BDWA 4E5BA 4YZBA 3RMFA 4C35A 5M44A 5HX6A 4EH9A 3PFQA 4LYNA 5CAPA 2GHGA 3QQKA 3QX2A 4HNIA 3AMAA 3AKJA 3JVSA 4Q5EA 4R7HA 2XF0A 3FHRA 3V8TA 5IG1A 3E93A 5HNGA 4EEVA 5T68A 2ZMDA 3VS1A 3MW1A 5I9WA 3TUBA 4ZTMA 4WUAA 4P4CA 3QGYA 3MVJA 2UVYA 4XYFA 3UO4A 2YWPA 4ASDA 4F0FA 4M66A 3QALE 2QOOA 1KUTA 3OT3A 4TY1A 3KULA 3RPRA 4EOQA 3MFRA 4Y8DA 5ETFA 3A4OX 4O91A 5DNRA 5EK7A 2CKOA 3L9PA 3IOKA 5CWZA 1H0VA 2FH9A 3ZDIA 3S0OA 2Y4IB 4E1ZA 4DEHA 4ZSGA 4QO9A 4BDJA 3Q3BA 4RIWB 3TJDA 3I5ZA 3ENMA 5CANA 3EL8A 1G8KA 2WU6A 3NAYA 3MY1A 3VS3A 1DI8A 4FEXA 5CENA 4EYMA 1BYGA 2R3PA 2WB8A 4LGDA 4OAUC 3P7AA 3ZZEA 4YLKA 2UW7A 1Q8ZA 3F3UA 5IUGA 5FDXA 1P4FA 2RG5A 2ITXA 4XLIA 5FRIA 2UW4A 5G1XA 5AP5A 4CFWA 3FPQA 3TL8A 2OJFE 5AWMA 2A0CX 5BX0A 3NUYA 4M84A 5KE0A 3MFSA 1WZYA 4QRCA 1ZMWA 2W5AA 1DM2A 2HOGA 3KA0A 4JDIA 2ZJWA 4ASEA 5JGDA 2W1HA 5AADA 2GU8A 3THBA 2VTJA 2QONA 1XH9A 3EFKA 4ACHA 5HTCA 3IQ7A 3KVWA 4BDAA 4F09A 2XRUA 2FSMX 4M8TA 5CQWA 3DAJA 3FZTA 4LFIA 3WZDA 2FSLX 4I5CA 3ZS5A 4ZLZA 4NM0A 1H1QA 2JEDA 3EKNA 3CLYA 3K5VA 3NYNA 2QOIA 3I5NA 5TE0A 3UVRA 1MRYA 1SVHA 3P7BA 5K5XA 5M08A 4XRLA 5CXZA 3BLAA 3FL4A 5IKWA 1YRPA 4EZ3A 2PUPA 2ZMCA 4WG3A 4QP9A 3D5XA 3DK3A 3PLAE 1M17A 3TKUA 3D5WA 4FK6A 5T3QA 3OD6X 3OOMA 5HNIX 3A7JA 1SNUA 3HRCA 5DLSA 3RK7A 1Q8YA 2WQBA 2C6EA 2PL0A 4TW9A 3V6SA 2YDIA 3OZ6A 4O7YA 2XB7A 5DA3A 2JDSA 4L45A 4I0RA 4LL0A 5H8GA 4BBEA 2IW6A 1YOMA 4RC4A 2YM4A 3HA6A 4DH1A 3QFVA 3DQWA 4YJQA 3WARA 1JLUE 3TV6A 1J7LA 1ZAOA 4IZYA 3D83A 4QYGA 3F6XA 2EWAA 4I92A 3D7TB 4JNWA 4XRJA 4MVFA 3SKCA 4LM5A 2ITPA 2UW3A 3GCUA 4PTCA 5IDPA 3VQHA 4JL9A 3A7IA 2WMTA 3HMMA 4QMMA 4DTBA 3DV3A 3TIZA 3ZLYA 2VX3A 4IB1A 4R7BA 1MQBA 1OL6A 3DAEA 3FMHA 4XHKB 3R7VA 3C4EA 3KEXA 4U40A 4O0RA 3T3UA 4EYJA 4EBWA 2QR8A 3OMVA 4G2FA 3II5A 5CS6A 2Y9QA 3W55A 3UG1A 2GSFA 2W06A 3NUPA 3V5WA 3VRYA 2WMVA 4FA2A 1J91A 2ZB0A 1GY3A 2X9EA 2XZSA 3DJ7A 2WTDA 3MTFA 3ZUUA 2CGWA 3KMWA 2WIHA 2EXEA 1KV1A 1KSWA 3LXKA 3R7GA 5DT0A 1J1CA 1VJYA 3EH9A 4D0WA 4KS8A 2H9VA 4IVCA 2ZM3A 3R1QA 4KIQA 4AUAA 4C38A 5J9YA 3UDSA 3DBEA 5IDNA 4C3RA 2QOBA 4U3ZA 4FODA 3NLBA 4UWCA 1REKA 5AR3A 3V5TA 4FV0A 3HRBA 3HECA 2B7AA 2OH0E 2W99B 3EQPA 3RCJA 3G15A 4GSBA 3ZO3A 2R7BA 3I0OA 4ZTNA 4BDCA 1PF8A 4AXDA 3DKGA 4QQ5A 5AR5A 3RBWA 3S2PA 3O8PA 2CN8A 3TTJA 3ZXZA 4E3CA 4IVDA 3NVMB 1PHKA 1PKGA 2R2PA 3DBQA 3KCFA 4NH1A 5HCYA 3W2SA 3KFAA 4M3QA 4HVIA 4ZS4A 4I6HA 5EI8A 3BRBA 2QLQA 4DFNA 3NW5A 2R4BA 3ZFMA 5IQIA 1PMNA 4CT2A 3MDYA 2WMRA 4FTAA 5BNJA 1P4OA 3Q2MA 4EOLA 3GFEA 4JIKA 4YTHA 4QMXA 5JT2A 4S34A 1H1PA 4O0WA 3E64A 3GU5A 1DAWA 2QD9A 3DA6A 4CFVA 3DKOA 4YJOA 4DEGA 5IA2A 2GNLA 2JIIA 2VTRA 3S1HA 4QQJA 2GQSA 5ANJA 4DG2E 3QQHA 4G3FA 4YJPA 4IJ9A 4QQTA 4F1TA 2PVNA 3PXKA 5LVMA 4DEAA 1BL7A 2XYNA 4FIGA 4XBRA 4AZEA 2IVVA 2XNBA 4IAIA 2QKRA 4HJOA 4CV8A 3OWLA 4LQMA 5LVPA 4C3PA 2CGXA 5IQBA 4FNZA 4RJ6A 5JFXA 2QODA 1OI9A 3O17A 3PXFA 2HELA 3R30A 2XEYA 3NAXA 2PHKA 3PXZA 4LG4A 5DRBA 4IM2A 2QG7A 3BV2A 4WT6A 5JN2A 5EHOA 3W8QA 4FKUA 3HMNA 4TWOA 4N70A 3QQGA 5DBXA 4FG7A 4RZVA 3GCPA 4IB0A 3BEAA 4H3PA 5E8XA 3EQIA 1M7NA 4MKCA 5AP6A 5J5SA 5AR8A 3UG2A 1F3MC 2WTKB 4II5A 2J0LA 3TN8A 2CGUA 5BVFA 3PVGA 4FSWA 3ZM4A 4LV7A 2O65A 2I7QA 5HZNA 4YPSA 3V3VA 3UDZA 3OW4A 1PYXA 4YSMA 4BI1A 5JRQA 5CVGA 4DTAA 4O7LA 4D9UA 2WQEA 4YR8A 3C51A 5IEXA 1H28A 4L3LA 4JXFA 4FV5A 1LUFA 4P5QA 4WD5A 5C27A 4BKYA 3Q6UA 4C37A 3NSZA 4J97A 5AA8A 2JD5A 3NCGA 4FTJA 4YZNA 3TZ8A 3ZM9A 2BIKB 1W82A 1FVTA 5EKOA 3LMGA 4C4FA 3CPBA 3LQ8A 2QCSA 2W9FB 5A4LA 4BTMA 4FTUA 2DYLA 4PDYA 5AX3A 1T45A 1YVJA 4PDOA 3W32A 5HG5A 1IAJA 1Y57A 4GFGA 4JRVA 3FKNA 3U55A 5BYYA 4FSUA 4O7VA 4JIAA 2C0TA 3KXXA 4AGWA 2CCIA 5IQGA 3MYGA 3NNUA 4NFNA 2X6DA 4NTTA 2YAAA 3G2FA 3E87A 4E6CA 4O84A 4IHPA 4FK3A 5F9EA 3ROCA 3ZO2A 5JFWA 4HYUA 3KMMA 4YU2A 3HL7A 1NVSA 2OIBA 4DG0E 4EQUA 2XYUA 4OTHA 5C1QB 4M12A 4A4LA 2VD5A 4AW2A 1Q8TA 3IW4A 4EK4A 1W2CA 3ML1A 2X9FA 3P78A 5M07A 2QU6A 4TWPA 2J0MB 2PU8A 3CJFA 3M1SA 1GZNA 1YDTE 1MP8A 4QP2A 4F7JA 2CLQA 2B1PA 2WEIA 3QC9A 4ZLYA 5E8VA 4G6NA 4Y73A 2WOUA 4DGOA 3VJOA 1U59A 3H9OA 3OY1A 4RVLA 4IDVA 1PXJA 3DTCA 3LZBA 2HK5A 1IA8A 4UMQA 2Y4IC 5K0KA 4I6LA 5FLFA 1ZOEA 3EQGA 3RJCA 4FSRA 2OJ9A 2Z2WA 5FP5A 2OLCA 4TL0A 3HP2A 5HOAA 3OXTA 4GS6A 3Q4ZA 4YZMA 4QT1A 5EQYA 2PZYA 5HLNA 2V62A 5CSXA 5KZ0A 4BWKA 4NYEA 1KOAA 2VWBA 2J0JA 5JGBA 3HMIA 5E1SA 5A6OA 3PPZA 4ZJVA 3BWJA 4FT9A 4GG5A 3CY2A 2WHBA 3AC3A 3OROA 4K9YA 4QMUA 5LMKA 3R9RA 3LXNA 5DR6A 2PZRA 3DFCB 3FL5A 1HCKA 2VNWA 3L8SA 1CTPE 2YIXA 4CQGA 3OFMA 5J9LA 5AP2A 5EH0A 3ORIA 4XUFA 5BVOA 4IACA 4KINA 4CRLA 2F4JA 4W4XA 1ZY5A 3R83A 4C4HA 4FF8A 3ZLWA 4QDEA 2VWWA 2BUJA 3MPTA 4KKGA 2ZV2A 3QA8A 3P5KA 5CEQA 3O8TA 1H01A 2JKMA 4X0MA 4ALWA 4QDVA 3VAPA 4EH8A 5BUEA 3F2RA 4FEUA 3NRMA 3BE9A 1FQ1B 3PE1A 4V01A 4F08A 3R00A 4WNPA 4DAWA 1Q5KA 5GJFA 1U5RA 2CHLA 5CQUA 3NUAA 2VTIA 5ETCA 5L8KA 3DLZA 4HGSA 2IW9A 3VF9A 5HBHA 3HX4A 2GTMA 3ZBFA 4MD8E 4F7SA 3W0PA 3GU4A 3QLGA 4QPMA 3LOKA 3H9FA 4DBXA 2WMWA 4FIHA 4XEYA 5HIDA 4UBAA 3W0SA 4F9BA 3FXXA 5CAOA 3FKLA 4FYOA 5LCKA 4YUQA 4XV9A 2VTAA 2C6KA 4ZTSA 1YXUA 3NGAA 4CLJA 4L8MA 4F70A 4IADA 2PE0A 1ZWSA 3LCOA 4MBLA 1OMWA 2CN5A 2X0PA 2YERA 3QGWA 4FNXA 4QPAA 4XBUA 4I0TA 5ACKA 4IDTA 4AXCA 3F5XA 3GOPA 3KULB 3QKKA 3W18A 3W10A 3ZRKA 4CXAA 4G34A 1ZYLA 2J9MA 4O0YA 4XG9A 4WIHA 4F6WA 4G5JA 5DG5A 4YMJA 4W4WA 2JIVA 3KXNA 4OTDA 4C3FA 3FWQA 4DH5A 4C57A 4BCMA 4ZEGA 4MHAA 4FKGA 5HVJA 4EZ7A 4F1MA 4RIWA 5FGKA 5J7HA 3GQLA 2PUNA 3EMGA 3F5GA 4AZSA 1SVGA 4BIDA 4O86A 2OSCA 4RWJA 3DLSA 4FVQA 3OOGA 4C4JA 2XK6A 5DI1A 5CAQA 2CNVA 3NX8A 4GT3A 5CF5A 5BVKA 4BCOA 3OTVA 4PL5A 2WGJA 1JSTA 3VNTA 3R7UA 1F0QA 3OCGA 4HGEA 4O6EA 5IF1A 3FBVA 4WNOA 4RMZA 1KE7A 3ORKA 2P55A 2NP8A 3RNYA 2OW3A 2RFEA 4WNMA 5DOSA 4O7ZA 3SHEA 2C30A 3LJ1A 4NK9A 5IMEA 3N4TA 3DQXA 3UC4A 4AFEA 3GOKA 3SQQA 4EHGA 2OXXA 1A48A 4FVPA 4DGLC 3KVXA 3ZFXA 4BCFA 4GVJA 4BCPA 5CX9A 4AGCA 3ATTA 4O7WA 4OGRA 4YHJA 1NVRA 3G51A 3WYXA 5BYZA 5D7VA 5CAVA 4Y5HA 2UV2A 1LP4A 3GENA 5EW9A 5LWMA 2XUUA 1IA9A 4NJDA 5KX8A 1H4LA 5AV3A 4YJNA 3V8SA 1ZARA 2C3IB 2XEZA 5CEIA 3E62A 4CTCA 2AC3A 5HIBA 3P0MA 4MWHA 2C0IA 4HPUE 3E3BX 2PMIA 4H3QA 4JDHA 4C02A 4MEDA 2B54A 4D2VA 5IA0A 2QOHA 3NUSA 2YM5A 4QMWA 3RZBA 3IW6A 4KABA 2ITYA 3ENHA 1OGYA 2XANA 4ITHA 3BKBA 4RFMA 4CMOA 2C1AA 3ETAA 3CGOA 4DHFA 1T46A 3CC6A 4EWHA 5AUTA 4MXXA 4A4XA 4ANBA 4W9WA 2R64A 2X2KA 4GFOA 5GHVA 3WF8A 2XALA 1UA2A 4BDGA 1K3AA 3A62A 4FR4A 4YO6A 3B8RA 4GW8A 3ZBXA 4CVAA 3DAKA 4GYIA 1UU9A 2WTWA 3UO6A 5EDPA 4BCKA 4UMUA 2I0YA 2J90A 2JDRA 3V5PA 4EHEA 5KCVA 4PPAA 4O2ZA 3DJ5A 4FNWA 4FV2A 4ZJIA 1RJBA 3MA6A 3IDCA 4U44A 3VUKA 3BHTA 3ZXTA 4AE6A 4B6LA 2ITUA 4QP8A 4M0YA 3PP1A 5E8WA 4B99A 2HY0A 5ANDA 3PPKA 5BQ0A 4JX7A 4K0YA 4M69B 4NU1A 3OWKA 4IWPA 4HVDA 3ID6C 4M97A 1PXNA 5FD2A 3RAWA 4O4CA 3G6GA 4UY9A 5BMMA 4L43A 4FT3A 3K3IA 2PVJA 4QTEA 3DFAA 4IW0A 3E8NA 3PJ8A 3UP7A 3QRUA 3AT4A 4R77A 4QMOA 4DH8A 2BDFA 3GC7A 3RTPA 5M09A 3SW7A 1STCE 2OBJA 4O4DA 3ORLA 2GMXA 3E8EA 3U51A 4CQEA 2F2CB 3C9WA 4FG8A 4TPTA 5H2UA 3QQLA 4ID7A 4RJ5A 4HCUA 1ZMVA 3AC4A 3R8VA 2XJ0A 4R7IA 1JAMA 2WAJA 3QTXA 5KMJA 3OBGA 2ONLA 2W1GA 1W98A 3ZU7A 3F69A 4FL2A 3HDMA 4I41A 2BFYA 3V04A 4MD9E 4BJJB 3ANQA 4AP7A 2XCKA 4H39A 4L46A 2X7FA 3PA3A 2XK3A 2WD1A 4U81A 4KSPA 4YNEA 5M4CA 3RI1A 3ZCLA 1WBPA 3MTLA 3C4XA 2XKCA 5C03A 2XARA 4GT5A 1Y91A 2YCQA 3EHAA 2WQNA 2WNTA 5J95A 3NPCA 4FZFB 5FG8A 1XBAA 3ACKA 4IC8A 4L68A 4Y83A 4Z55A 3BZ3A 1MUOA 5DFPA 2C47A 2H6DA 4HYSA 3TACA 4C36A 3SD0A 1G8JA 5EDQA 3U9CA 2UZBA 3GFWA 4Q9SA 4XOZA 1KV2A 4Q9ZA 1EH4A 3D2KA 3GVUA 1O6YA 1KE8A 5C8NA 1UU8A 3DGKA 3Q5IA 3L8XA 4E6QA 3WIKA 3BYMA 4ZSAA 2DUVA 3EQFA 3R0TA 5AUVA 4PF4A 4V0GA 4QYFA 3TI1A 4NL0A 2XK8A 5AV1A 5JMSA 2NPQA 1XKKA 2Q83A 3FMEA 4OT6A 4ZSEA 2QOKA 3QZGA 1FMOE 4FGBA 4DGMA 4D1ZA 2G1TA 3WZUA 1JBPE 4TYHA 5KMLA 3UIMA 4TTHB 4F64A 1ZZLA 4K77A 3KRXA 4AT5A 1SM2A 4FIIA 4RPVA 3GCSA 4F7NA 3WILA 4BGQA 4JBQA 4M68A 4XJ0A 2X0GA 5AR7A 3U4WA 2ITZA 3Q4TA 4MXYA 4MD7E 3UVQA 5HIEA 3A7GA 4D1XA 5H8BA 4IWQA 5CEKA 4BDHA 1XWSA 1IASA 4IC7A 4I4FA 4E6AA 2IO6A 3MWUA 2OZOA 4ZZMA 5EYMA 5GZ9A 5DGZA 4WSYA 1ZYDA 3M42A 1JKSA 4LRJA 1VYWA 3IDPA 5A4TA 4IM0A 2W4KA 3PVBA 5CXHA 2J0KA 5ANOA 3IO7A 2QR7A 4LMNA 4IB5A 2B55A 3C4ZA 3BHUA 3VS7A 4YJRA 2Y4PA 2QKWB 3EOCA 1IR3A 2VWZA 4KIKA 2F7ZE 2UZUE 5CEMA 3FHIA 4FTLA 3NMUF 5BMSA 5A3XA 3EIDA 3ERKA 3FZRA 3FLYA 1OVEA 2IWIA 4PPBA 1K2PA 3GU8A 2QNJA 2OF2A 4XS2A 4AFJA 3DU8A 1CMKE 2GDOA 3OEZA 4CKJA 2DQ7X 3R8LA 1OIYA 3O8UA 4ZJJA 3K3JA 3L1SA 3WE8A 4YC6A 4R3PA 4XMOA 4YHFA 4R3RA 2E9NA 4X2JA 3JY9A 2AEGA 2X0QA 4EK5A 5EM6A 4W8DA 3UJGA 1XH4A 4FKQA 5L8LA 3E7VA 4RVKA 2YABA 4YJTA 4AZWA 3TIYA 4D4RA 1WVYA 3O51A 4J98A 4L67A 5AUWA 1UNGA 4PDPA 2PVKA 4RIYB 4S2ZA 2VTTA 2V7OA 5FXRA 2X1NA 4GKHA 4E4MA 3FMLA 4CMUA 2ETRA 4ACDA 3HKOA 5I3RA 2YJSA 1FVVA 1MRUA 4G17A 4M15A 3UDTA 3PJ1A 1R39A 4DITA 4UMRA 1JWHA 4FSMA 2QOFA 5B2MA 2OFUA 3BX5A 2XNNA 3UBDA 4PNKA 3D2IA 3KY2A 2PMNX 4XP0A 4AAAA 1V0PA 2NYAA 2B9IA 3KIOC 2B9FA 4GV1A 2O8YA 3ORXA 4AT4A 2Z8CA 4NT4A 4OTWA 4O22A 3FI3A 4X3JA 5IA3A 3HUCA 3UODA 1ZZ2A 4EOIA 4GK3A 5LVOA 2VTPA 1E1VA 4O6LA 4RFZA 3KF4A 4MF1A 4TT7A 4HW7A 2RSVA 2A2AA 3BLRA 1S9IA 3H3CA 4DYMA 2FB8A 2Z7RA 4F63A 3IONA 5JK3A 5M57A 4OR5A 2BZKB 5EQEA 2BPMA 5HI2A 4GL9A 1YWVA 3U8WA 2JFLA 1YKRA 3E88A 3TYKA 4CZYB 1XMLA 1PMUA 4ZIMA 1W2FA 3AMYA 3ELJA 5I5ZA 3E7OA 4MQ1A 5C9CA 3PG3A 2IVUA 3GU7A 5DVRA 1QPJA 2WMXA 4LOQA 5L6OA 4TKSA 2PZ5A 5A4EA 4O83A 4DHZA 3LJ0A 2RFNA 5AV0A 3O7LD 3PWYA 4ZLOA 5TR6A 5IH5A 2WIPA 5J5TA 3VVHA 5IQDA 1XH5A 2BTRA 3R9OA 4DH7A 2PWLA 3M11A 4RRVA 4WHZA 3MH3A 2RL5A 3FQEA 1HCLA 3GC9A 3QL8A 3W8LA 2YCFA 4BCNA 3BIZA 4AZTA 3LCKA 5IZFA 3VS4A 4HVSA 5BVNA 3DXNA 4C8BA 1VLRA 5LWNA 3AMBA 4QMLA 5H9BA 5HU3A 2Q0NA 5EM8A 1GAGA 3KGAA 4O21A 4QNYA 3SC1A 3VBXA 3FMKA 5DYJA 3CEKA 3S00A 3QD4A 4R1VA 4V05A 2A19B 2X2LA 3NNWA 5DRDA 4EH7A 2C4GA 2W1ZA 5HE1A 1DS5A 2OK1A 2X81A 3JYAA 3ZO4A 2R3GA 2WMSA 4FMQA 1NXKA 1VZOA 3AD5A 4NEUA 1XHAA 4CYJA 4MH7A 2R0IA 4ZXTA 3VUDA 3N4UA 1LEZA 4EONA 2QURA 1NW1A 3AQVA 4FNYA 3LCDA 3UPXA 4EH6A 4R78A 4O38A 3ZONA 1WVWA 2YZAA 4J8MA 3QXPA 5IQAA 4CTBA 4DTKA 4KS7A 4EOJA 5BUIA 4W8EA 4TN6A 3NIEA 2C3LA 2RKUA 2VTMA 3F5PA 4QPSA 3PY0A 4RSSA 3PPJA 5B0XA 1BKXA 1PMEA 3EZRA 5E8YA 4BWXA 3LMIA 4DHIB 4LRKA 2G15A 4D2TA 5CSPA 1SZMA 1VYZA 3QUPA 3BQRA 3BWFA 4Q2AA 2QHNA 3PWDA 4AZFA 3C0GA 4CLIA 4MCVA 4FKOA 1ZLTA 5AR2A 2RFSA 3CP9A 2XIZA 4DFYA 5IEVA 2R0UA 2C6MA 4J1RA 4TNDA 4BDDA 3LKMA 4BTJA 3RHKA 3ZYAA 2F2UA 4HZSA 2OJIA 2IW8A 3RKBA 4A9YA 4JR7A 2XK9A 4E4XA 5L2TA 1J7UA 3TJCA 1S9JA 4AACA 5FM3A 5M55A 2YN8A 3TXOA 4DFZE 5DMZA 4YO4A 3NIZA 1TZDA 2OXDA 3FC1X 2UW0A 3I79A 3PSBA 3R28A 4MAOA 4S30A 4USDA 3SLSA 3OXZA 3WE4A 3ZTXA 4DFLA 3SXSA 4AQCA 5KBRA 4D28A 3R73A 5IA4A 2XNMA 5EFQA 2LAVA 1WBOA 3RPVA 2XRWA 3FUPA 4QTBA 1KWPA 2BRMA 4PDSA 5AUYA 3RGFA 2YJRA 3Q96A 4FV6A 2V22A 5L6WL 4BR3A 4F0IA 2V7AA 3WF9A 3PY3A