2PVOB

Crystal srtucture of the ternary complex between thioredoxin f, ferredoxin, and ferredoxin: thioredoxin reductase
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
74
structure length
74
Chain Sequence
MNVGDRVRVTSSVVVYHHPEHKKTAFDLQGMEGEVAAVLTEWQGRPISANLPVLVKFEQRFKAHFRPDEVTLIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural snapshots along the reaction pathway of ferredoxin-thioredoxin reductase.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Electron transport
molecule keywords Ferredoxin-thioredoxin reductase, catalytic chain
total genus 11
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02941 FeThRed_A Ferredoxin thioredoxin reductase variable alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2pvoB00
3A8OB 2PUOB 3X24B 4XK8E 2QDYB 2ZZDA 5L8RE 3QZ9B 1DJ7B 2ZCFB 4KT0E 3A8HB 1UGQB 2CYZB 2D0QB 3WVDB 3X20B 1GXIE 3A8LB 1UGRB 2DD5A 2DXBA 4OB2B 2CZ1B 4L6V5 2ZPHB 4ZGJB 1QP2A 3X25B 2ZPIB 2ZPEB 4ZGEB 2PUKB 2PVGB 1JB0E 1UGSB 2PVDB 2PVOB 1PSFA 1QP3A 4OB3B 4Y28E 3VYHB 2DXCA 1V29B 3X28B 4FM4B 3QYHB 3QXEB 1AHJB 1PSEA 2CZ6B 2CZ7B 2ZPFB 1IREB 3LW5E 4OB1B 2WSCE 2WSFE 3HHTB 4RKUE 3VYGA 3WVEB 3X26B 4OB0B 4ZGDB 2WSEE 2O01E 2AHJB 3QZ5B 1UGPB 2DPPB 3A8MB 2ZPGB 3QYGB 2CZ0B 2ZPBB 3A8GB 2PU9B 2DD4A
chains in the Genus database with same CATH superfamily
2KI7A 2H3EB 3CCVT 2J6KA 4MZPA 1FMVA 2VB6A 1WHJA 2VWFA 4FIBA 4C92E 2HSEB 4NS5A 3CMEA 4A63B 3KFVA 1IZ6A 4M7DD 1C0MA 2C0TA 2F2WA 3CMET 1QVGS 5GAOp 4N4GA 4M7DB 3HFNA 1R8OB 1H8KA 3UWNA 1RLPC 1G3SA 2MI6A 1JJ2P 5DLOA 2QYZA 1QVGA 2VUBA 3S3OA 3M0RA 2EYQA 3EHRA 2J05A 1KJWA 2KYBA 1Q7YR 1GCPA 1OU9A 2DK3A 5KCOA 1S72T 1UB4A 3JSCA 3PFSA 1Q7YU 2XDPA 5KE3A 1OYXA 4C0FA 1VQOQ 3DB3A 2K7AA 1C1AA 1VYTA 2DBMA 4C92F 1YJNT 2BIVA 1M2OA 4KGXB 1AWWA 2EKOA 3PMIA 3L2UA 2VYTA 4E6RA 1Q95G 3OW2S 1G2BA 1PD0A 4OF1A 2P0QA 5LJ5j 3RKWA 1GBRA 4A4HA 3HHTB 3CQTA 2DE0X 1M3BA 3V7RA 1K4US 1QW1A 4M75A 1SEMA 1UGRB 4JS4A 1WHHA 2FRWA 1E7OA 1BI2A 2EIFA 3MJXA 4LD6A 5GAOq 1WJSA 1MMNA 1NM7A 2MK5A 3CPWP 3EGDA 1KG1A 2E4HA 2L3PA 1TUDA 5GMKj 3OYBA 5AYFA 2PZ1A 3OMGA 1ABQA 5L8RE 3CC4A 1GL5A 1Y96A 1G5VA 4C5HA 1U06A 4A4GA 4F7UA 4RUGA 3SFMA 1G8XA 2BZXA 1VIFA 2JXBA 4A53A 5EC7A 1ZHIA 3SD4A 5LJ5d 4JLGA 3OA6A 1N8RR 4ZTJA 1SRMA 1ZQ1A 4J9IA 2IG0A 1M2VB 1UE9A 2X4WA 3TQ7P 1YJ9A 1PKTA 4E7HA 4JJDA 2DRMA 1M2VA 2YLBA 3QHSA 4X9DA 3PNWC 4II1A 2MOXA 2COWA 1WHGA 1X01A 3VKIA 2EWNA 2JVVA 2V8JA 2GGRA 5GAN8 2E10A 3HL8A 2YLCA 3CCUQ 1B34B 2FPEA 2HZYA 4XTVA 5AT1B 1Y57A 2KDSA 3HFOA 4QQGA 5HY6A 1KQSP 1TS9A 4V2SA 3JCMf 4OB2B 1VQOA 2XG8D 2P0KA 1WJQA 4HA8A 1R0BG 4C0DC 5KYYB 3RMSA 2CP0A 3EFOA 3GPLA 5I2MA 1PHTA 2V26A 4PJJA 1M90U 4GY5A 4JZ4A 4BE2A 3A8MB 2XU8A 2DNUA 2YUNA 1S72Q 3QBYA 2K79A 4LNPA 3X24B 1T3SA 2A3LA 2JM8A 2BZYA 5GMKi 2OTJQ 4LDVA 3RERA 2FVUA 2RQTA 2JS0A 1K0SA 2FZCB 3OYFA 1ZUYA 4IUVA 1YIJA 2K6DA 1MMGA 3EGXB 1VQ9Q 3CBMA 2DEQA 1OU8A 2Z0WA 2PU9B 2OI3A 3TREA 2KVQG 4RTTA 4JJCA 1ZLMA 2LCSA 4PFOA 2ESWA 1IHVA 4XU0A 4TVRA 1U1SA 1KSWA 3QXEB 1MGQA 2LC4A 2WSCE 3CCMA 1FMWA 2VV5A 1R77A 1VQ5Q 4NL2A 4XTXA 1X75C 3VS1A 2GFUA 5CCAA 5C0MA 5GANg 1WJRA 2O9SA 3LH0A 1D0ZA 2OTLQ 2RMOA 3REAB 4RTVA 1RAGB 3ME9A 2DXCA 1WHKA 4QVZA 2IPOB 1CSKA 2KBTA 4CC2A 1T0HA 1M27C 2I0NA 4JRQA 1KFZA 1KD1C 1VA7A 3O5ZA 4RTXA 4RTWA 5I21A 3I5SA 1T0JA 1AWOA 2V1QA 1YI2A 4HCKA 1IGQA 3JB9D 4FCYA 3I5RA 1M1GA 2FYKA 4RTZA 1A0NB 1K73C 1M1KC 3CEYA 1AHJB 2O4XB 1QCOA 5GAN3 2K5IA 4C0DB 4C92A 2OTLA 3OYGA 1YITT 3VS5A 3CCSA 4K11A 1MMDA 4PJNA 2P4TA 3G71T 1M90C 4M77G 5DLQE 4XTUA 4CI0C 3EG1A 1BI0A 2GCXA 4E7ZA 1O9SA 1U5SA 2FHDA 2M02A 3EG9A 3J7AF 1AWXA 2DTHA 3H8ZA 1K8AC 2Y4XA 5CO7A 3PVQA 3TEEA 3CC7T 4OMPA 3EGUA 2D8JA 3H6ZA 2AT1B 2A0FB 3FB9A 3CC4Q 1X27A 3URGA 2R5AA 2CYZB 4OGCA 3CXCS 2K2VA 3CC4T 4PJOF 3WXMB 3I56A 4B9XA 4FM4B 3OYHA 1YJ9Q 4KH1B 5D6XA 1OPKA 2D1XA 3JCMg 4F7UE 2CP2A 1KQSS 3IQLA 5CKBA 2RPNA 3CCRQ 3L2QA 1PNJA 2QXFA 1VQ8T 3CD6A 2KGTA 3RKYA 3P8BB 2ZGWA 1KD1R 5CAIA 1UUEA 1WHMA 2EQJA 4DOVA 4C8QA 2HKNA 4LN2A 2QA4A 2E64A 2F5TX 1B7TA 3EGDB 3OBYA 2COYA 2HAXA 2ZPGB 2CZ0B 4JUVA 1K8AR 1I07A 3O8VA 4QT7A 1I0CA 2E3HA 3OSVA 3RBBB 3CCUA 3SWNB 3JB9H 2FG0A 1NYFA 4XU2A 2ZPIB 1M90R 2LNVA 3CBPA 1FYNA 3P8DA 2CZ6B 2KXDA 2AKKA 1WYXA 3M57A 4EMKA 1WFWA 4C8QF 3QZ5B 3RUXA 1T3LA 3MHXA 1RAAB 1ZUUA 2DERA 2QA4Q 4FYVB 1IXDA 1QMCA 1AZGB 3RESA 4ZTFA 2K2MA 5HK3A 5GAN7 3AT1B 3CD6Q 1PWTA 1QWFA 2VKNA 4ZNXA 5LJ5g 3CCLQ 1PC0A 1UTIA 4IURA 4M75G 2RD1A 1BU1A 4M7DF 2CP3A 5GAMg 3QJYA 4R0KA 2M1HA 2SEMA 2PVGB 1SPKA 3PIPA 5KYNA 3S3MA 5KYYA 4C8QC 3OQ5A 2DL8A 1FX7A 2E5QA 2QQSA 2RI3A 2L2PA 2RJCA 1D3BA 4J83A 2CUDA 4M7AB 3E2UA 4CRIA 2NUZA 4C5IA 4IUTA 2EYXA 4X34A 4KUIA 1D1BA 3VJPA 1Q82R 1YHQT 2ED0A 2LTOA 5GMKl 2J6FA 3PIOA 3JCMd 3M56A 4HXJA 4BI4A 1VUBA 3EH2A 3JCMP 1VQNA 2YSQA 4MMLA 4J7FA 4RTUA 3G1JA 4HCBA 4KT0E 2E6NA 1QCNA 5IXFA 2LQKA 1K9MU 1I81A 1OX8A 4MZMA 4M75F 3G4SA 4FT4A 3LX7A 3LW5E 4B9WA 1V1CA 2RQUA 5GMKe 4C8QB 4KBMB 4PJOE 4M77A 1YJWT 2CP7A 3SEMA 4WTOB 3L2WA 3NPFA 2DIQA 3M4YA 3CBOA 1HJDA 1VQMT 4QKUA 2V8IA 2RH2A 5IHNA 2JMAA 2WSEE 4JPBW 2NUTA 4JRIA 3UT1A 3G4SQ 3QO3A 1VQ5A 3ASKA 5FW9A 1CKBA 4OMNA 3INZA 4N0AC 3FJ5A 1VOMA 2LJ0A 1UJYA 3GP8A 1LCKA 5LJ5h 1JBMA 3JB9I 1N8RC 3NTKA 3BE3A 5D6WA 4BUGA 2HBPA 2DETA 2DVJA 3CCMT 4L5GA 1J3TA 1TWBA 1ZSGA 2CH4W 3OS0A 2HQEA 2D0QB 4DOWA 3VUZA 3KUFA 3MEWA 4EPCA 5FU6C 3SWNC 2G3RA 4FW1A 2KYMA 2KY9A 2PUKB 3R6OA 1RAHB 3T9NA 1UECA 2NUPA 3D7SB 2EGAA 3OMCA 5FLXE 2JN0A 2FPFA 3MEAA 1ZA1B 2DX1A 4KH0B 4PJOA 2B8AA 1Q82U 3A8LB 2DXBA 2RO0A 4OMFB 1YITQ 1U3OA 2ZPEB 4E7LA 5HK0A 2VGNA 4F14A 2JUFA 3M0QA 1VQ8Q 1U1TA 1MUZA 1NJIC 1VQNQ 4RMOA 4M7DC 1RABB 3LWIA 4JDSA 4GBQA 2PNIA 4ATOA 4BI3A 4DBRA 1I5LA 3HRTA 1VQNT 1IB8A 4HT8A 3QDFA 5IHKA 1YHQQ 5GAMh 2F2VA 4PK4A 3BDUA 3EG0A 2K57A 2EKHA 1QKXA 5KH6A 4M77B 4J5YA 2CGHA 1NLOC 1HSQA 1VQPQ 2DILA 4PNOA 2LRQA 2GBQA 2E70A 3FJPA 2RHIA 3CCEA 4PJOC 1FMKA 2JJ9A 1VQ6T 2EQIA 1GFDA 1Q7YC 3V8JA 3FEOA 4A4FA 1YJ9T 4Z02A 1NEGA 2NUTB 1QVFP 3OYIA 3M0TA 1JXMA 3QJ6A 2RM4A 1UG1A 3M53A 3HSBA 1YJWQ 3M9QA 1U8RA 1K73R 2QEXT 1KQ1A 5FU6B 1WIEA 4M7DA 2A28A 4C92G 4M77D 1BIAA 3CCVA 1ZSZB 3QIIA 4WF2A 1D0YA 1AT1B 3RKXA 2QEXA 3X26B 2JT4A 4FYXB 3VS6A 3UATA 4M7AG 3L2RA 4VUBA 5GMKh 4MZTA 5KYXB 3CCLT 4N0AA 4WCIA 2RA2A 1BB9A 1PRMC 2E1HA 1TG0A 4XTZA 1IO6A 3QWXX 1PRLC 4C92D 4IUQA 4EMKC 4A54A 1GFCA 3EAEA 4BE0A 3OYEA 4RCBA 2KR3A 2A7YA 4ME7A 2O9VA 1FXXA 2EFIA 3EG9B 2ZZDA 1KD1U 1UGQB 1ABOA 2WACA 1GXIE 2CS7A 4M78B 1KHIA 3VRYA 1Q86R 1VQKQ 1N9RA 2EVRA 4OMQA 3N5BB 2CZ7B 3H9NA 1NPPA 2KT8A 2DKGA 1VQKT 3SHWA 1YJNA 4C0GA 2MF2A 2KT1A 1KQSA 2K5FA 2EJ9A 4LUEA 4E7KA 1YIJT 1UGVA 3I55Q 1KC8C 3RNJA 1Z9QA 3CMAQ 3VS0A 1BCOA 3CCQQ 3OS2A 1WXTA 3L1AA 2GTOA 5ECAA 4F16A 4AMCA 4DEXA 1BK2A 1ZSZC 5GAN2 3VV0A 5GAN4 1I4K1 4NOYA 2K9GA 4OB1B 4AFUC 2RQRA 3GNFB 2F2XA 1RI0A 3SB2A 1EZZB 4DQ2A 5GANf 1S72A 4J9FA 2MCNA 3NMZC 2ZPHB 1YP5A 2W10A 2DRKA 2VXEA 1I5OB 5FU7B 2QGFB 1M1FA 3CCRT 2VC8A 1AD5A 2QQBA 2RHYA 4DBHA 3PT9A 3Q1JA 1Y7XA 4ANJA 2DZ9A 2JTEA 3QZ9B 4GLKA 1R0CB 1NG2A 2XDBA 3EHQA 2KE9A 1WX6A 2EQUA 3JCMe 4JJBA 3VS4A 1O75A 3FLGA 1PSEA 3V7SA 1TH7A 4DBQA 2WSFE 5KYUA 2KRNA 1C6VX 2M16A 1QLYA 1EX4A 1CKAA 1NLPC 1KIKA 3E9GA 1BI1A 1WQWA 4JRPA 2O4XA 3OYNA 3C0CA 1D1CA 1MNEA 3JCMX 1OOTA 2RJFA 1AEYA 1WXUA 4IIOA 2DL7A 4D8DA 5FRNA 1VQMA 1VQ7T 2LP5A 2HNIA 5LJ3j 4BY6B 2X51A 4FYYB 3DLMA 4R56A 4XTYA 1MHNA 2D8HA 4PLLA 2ZPBB 2MWPA 2KK4A 2L8DA 4C8QD 3C95A 5CKHA 2C06A 3ULRB 1M8MA 1SRLA 2XKOC 5GAMe 2MWOA 4LUDA 4HCCA 3BDLA 2BKDN 4M78F 5LL6S 2A08A 4PL6A 1X2KA 4OB0B 1Q81R 2GNCA 4ZN1A 1JEGA 6AT1B 2AIRB 1D3BB 5GAMf 3LWHA 2A37A 1W1FA 2YUOA 3FDRA 3QDRB 1TXQA 1M30A 2LVMA 3MKDA 2FEIA 4Y91A 3HRUA 5LJ5e 1W70A 5M9OA 3I55T 4X1VA 2DA9A 4M7DG 2AHJB 2RB6A 3NTHA 1N5ZA 1YCSB 1VQLA 3CC7Q 2COZA 2HKQB 2ZCFB 4AG1C 2BE7D 1RACB 4M77F 2J7IA 1RAIB 2RK1A 3H0IA 2CUBA 4JS5A 5CIUA 1ARKA 5GJVB 2LQ8A 2RJDA 3C12A 1MV3A 2ZPFB 7AT1B 3JRZA 3OYDA 3CXCA 4EMGA 1RADB 2LMJA 1NEBA 1Y96B 4RTYA 5GANj 2X4XA 2GFAA 4FL6A 3GOXA 2XDDA 1XTDA 1LJOA 2FZKB 3F70A 3KXTA 2SRCA 2X4JA 4E7IA 3M0UA 2FPDA 1HK9A 2CREA 3QPHA 4P5NA 2HBWA 2M51A 3UPUA 5LJ3d 1GCQA 1PKSA 3I35A 3OBWA 9ATCB 4MMKA 4ELYC 3G6EQ 4QQDA 3UA6A 4Z88A 1KC8U 3OW2P 5IH2A 5GAN5 2YWWA 1VQMQ 1H641 1WPYA 1Y0MA 3BY7A 1W2BP 1I1JA 4BI8B 1F1BB 1OX9A 2ROLA 3QKJA 2E65A 3HRSA 4J9BA 2QK0A 2YT6A 4BDZA 4M7AF 4R55A 4M75E 2JW4A 3TSZA 2F5KA 1EFNA 2DZCA 3A8OB 2DD4A 5C6SA 5KYWB 2E41A 1VQ7Q 2QGGA 4NL3A 2BTTA 4E7SA 1N27A 2QQAA 2CP6A 1VQ5T 2K3BA 1QP2A 4C8QG 3DKMA 1IRXA 1Q81U 2RJEA 1VQ8A 3GBQA 1YCYA 3TSWA 2DEUA 1IGUA 1JU5C 1UDLA 5LJ3f 2E6ZA 1UGPB 1OZ3A 3OYAA 4FYWB 4M7AA 2KROA 1X6GA 5GANh 2XIDA 2RHXA 2QQ9A 3EG3A 4Q5WA 2J6OA 1NJIU 1E6HA 5GANd 3CCRA 1K73U 1NJIR 4QVDA 2LCLA 1V29B 2GTJA 4X9CA 1QCFA 3OSSC 3ER0A 4BDYA 3I55A 1E6GA 1AOJA 3OYYA 1W2BS 2FRYA 4BB7A 4BACA 4LDUA 1X43A 2YDLA 1QQJA 4M7DE 4E7JA 4O6JA 3WVDB 1RAFB 3J81E 2RI5A 3QG1A 1QVPA 4PKCC 5D6YA 3RDVA 4XU1A 3S3NA 1VQ7A 4OGEA 4LDWA 4FSXA 3CMAA 4E47A 3CCMQ 1VQ9A 2K3YA 2EQMA 3V8LA 4J9DA 2K3XA 1AVZC 4PJOG 1WDXA 2YUPA 3CCST 2CP5A 5D7UA 2RN8A 5DY9A 2ABLA 1WZOA 4N4HA 1M1KU 2BZ8A 4B6MA 1OI1A 2KSSA 2LQNA 1PM3A 1LVKA 3X28B 4Y28E 3TCJA 3NFCA 1W6XA 3CC2T 4CC7A 1VQ6Q 4C92C 3A1PA 5LJ3g 2JTFA 3E19A 3QWYA 1S1NA 2EGEA 3JCMc 2IIMA 2L5QA 1LOJA 4M78D 3VU3C 1G3TA 3ZBDA 1WNLA 1RL2A 2HMAA 4HT9A 2JOYA 2D0NA 2DD5A 4ZGJB 3G6ET 2F1LA 3JCMQ 2RHZA 5IT9E 3THKA 3FRNA 3GLXA 3NGPA 3R6NA 3EFRA 3EFOB 4AFQC 1VQ4T 1SHFA 2X9HA 4J9HA 1PCXA 2AZVA 4JRKA 2RK2A 3I56T 2EAYA 1JXOA 4DBFA 2K4YA 4JJNK 1VQ4Q 3G4ST 3A98A 1JB0E 1N8RU 4AT1B 2HDAA 3MEUA 3OYMA 3OYCA 1TSFA 2KQWA 2XHCA 2I2LA 4J7IA 3EH1A 3L2VA 4LE9A 3EG2A 1NE8A 1VQLT 2E5KA 2RQWA 1K0XA 2VASA 3TU4K 1UGSB 2KNBB 2AKLA 4MDXA 2J06A 5LJ3e 1YN8A 5GJWB 3JB9G 4HVWA 4RG2A 3G71A 3CMAT 1XJWB 1UHCA 2CT4A 1G3WA 2DVEA 3LYIA 2HL5C 3ZFJA 1BIBA 2EW3A 2LT4A 5IN1A 2DJQA 1M9SA 3M0PA 3BW1A 5CVIA 2D9TA 3PTAA 3MEVA 5A0DA 4ZGEB 1VYUA 2PVOB 1YBYA 2L3QA 2Y90A 3VS2A 3LGFA 2P84A 2EJFA 2AK5A 1G3YA 5FWCA 2LQWA 2DXUA 3A8GB 1SSFA 1HD3A 3U23A 5L23A 5A2QE 1OULA 2LCCA 1VQ6A 1EIFA 3SDZA 3PGGA 1M5Q1 2EYZA 3JCMb 3VRZA 3OS5A 2FL7A 2RF0A 1IHWA 3CCQA 4A4EA 2JS2A 2QASA 1QWEA 2EPDA 2JM9A 2OAWA 3OW2A 5KYUB 3OB9A 1X6BA 4M7AC 1NPRA 3CCQT 1SSHA 4M77C 3OY9A 3CCET 1M3CA 3X20B 1B34A 5KCHA 1ZUKA 2CDTA 3E1SA 1QVGP 3PVLA 2DTOA 4OB3B 2ZAEA 4ORZA 1Q86U 4OMMA 1Q86C 1KQ2A 1SHGA 4AFZC 3OYJA 2OX7A 2GF7A 1MMAA 1QVFS 2P0PA 2DJZA 4M75C 1YWPA 1V76A 4DA4A 2QEXQ 1PD1A 2PQWA 1K8AU 1TUGB 1Y71A 5LJ3h 1M8VA 3BFMA 1BKBA 2H8HA 4J6YA 2DM1A 2YXYA 4KGZB 3CMEQ 4L59A 1JQQA 2JZ2A 5CKEA 1RLQC 5FRMA 1ZX6A 2CH4A 2PTKA 3QYHB 4OVAA 4C5EA 4JZ3A 3VYGA 3JCMJ 4HCZA 3GF5A 3HPWA 3DB4A 2QTXA 2M0YA 4Y92A 3MPUB 5FWBA 1BYMA 4HVVA 1VQPA 1X69A 2CSQA 4XAXB 1KK7A 3P8HA 2KXCA 3ZL7C 2QG9B 2O2OA 1TOVA 3G6EA 2KRSA 3FIFA 2KAFA 4QW2A 2P4RA 5A0LA 2ECZA 1ZBJA 1FWZA 2HQXA 2KEAA 4IIMA 5J26A 3RIRA 3CC2Q 4F7UB 3LH5A 1UJ0A 1VQ4A 3TVTA 5I11A 1SKUB 5IAYA 5HKCA 2ED1A 3L2ZA 4LDYA 1PSFA 1PG5B 1WHLA 2MYSA 1YITA 2LZ6B 4J6XA 3OYLA 3JAME 3WVEB 3A5ZB 4UC4A 3CCJT 1K9AA 2VVKA 2YRCA 4HKEA 5CKDA 4M77E 2FO0A 4D8KA 3RR6A 4J9CA 5KYXA 3VUBA 2XD0A 1UFFA 2DXTA 1YI2T 1VIEA 4EMHA 1XNIA 1BCMA 1MV0B 3META 4LXCA 3VYHB 4FU6A 2HQHA 3M59A 2ENMA 4OMOA 1GRIA 2DMOA 3V8KA 4ZN3A 2OAUA 4RKUE 3E9FA 3JB9F 4OP0A 2L3RA 5HCKA 2NUPB 1UEBA 5LJ5f 2DF6A 4KRTA 2G6FX 1ZBXA 1TUCA 2HCKA 4XU3A 4M78A 3C94A 4RG8A 2LNHB 4J9GA 2VXFA 5GMKm 3HP9A 8AT1B 4M7AD 1B3QA 1X6OA 4C8QE 2KRMA 1IREB 1D09B 1ACMB 4QVCA 1OV3A 2XI9A 2IVWA 4J8OA 1M1KR 1OEBA 1K1ZA 5GAMd 2HD0A 3EFSA 3G7ZA 1DJ7B 4A4KA 3J80E 3DLLA 2HSPA 3M5AA 3X25B 1WQ7A 3LLRA 4C5GA 5CR2A 4C0ZA 4PFPA 4PJOD 3JCMW 2QAZA 2EGCA 3H0FA 1N9SA 4KUDK 1VYVA 3CCLA 4ESRA 2F69A 5CQYA 2GQIA 1B07A 5GAOm 2LJ1A 1MNDA 1KHCA 3SWNA 1H92A 2CZ1B 4L6V5 2RNAA 5EG2A 3M4GA 2DIGA 5A0GA 1I8FA 3G71Q 3MO8A 3KBGA 3RMQA 3OS1A 1VQKA 4F7UF 1JJ2S 3MP1A 2OTJT 5GAOn 4AG2C 3HKSA 3M55A 1VQOT 1X2QA 1BI3A 2X35A 4M78C 1VQ9T 4J6WA 3CCUT 2AZSA 5DM7R 1H3ZA 2LX7A 2QQRA 2PVDB 1QP3A 1Z9ZA 2NLUA 3CXCP 2EJGA 2C0OA 2K5LA 4D6WA 2MIOA 3H0HA 3LGLA 1QKWA 2V1RA 5GAN6 1XQHA 1K9MR 3UA7A 2MPXC 3A8HB 5GAOr 2LX9A 1YJWA 2DAQA 5GAMj 2H3JA 3UDCA 3NTIA 1K76A 2JNGA 1OQKA 4MDWA 4ELZC 2QTVA 3MP6A 4F04B 2FZGB 4E2FB 2VGMA 2JMCA 1YI2Q 1YFNA 4PJMA 4AFSC 8ATCB 3M58A 1WA7A 2DL5A 1N6AA 1D0XA 3HTRA 4PJOB 1WLPB 3CPWA 3VS3A 1YJNQ 2D6FA 4Z89A 1RAEB 3MCAB 4KGVB 4PLIA 1YHQA 4BY6C 1OPLA 3VS7A 1M3AA 1TTHB 2CKKA 5CQXA 4XQ3A 3QUIA 2M0OA 2RHUA 3ZEHA 4M75B 4O5VA 4FSSA 3EGXA 1Q81C 2DO3A 1QVFA 2GQVA 5J3BA 2L0AA 4BE1A 1W2BA 2QI2A 5GANe 2RI2A 3QYGB 2DYIA 4Z8AA 3UF4A 2LT1A 1NBEB 3CD6T 4FW2A 4XK8E 4F17A 2R58A 1NZ9A 5IHIA 1Y07A 2W0ZA 4CC3A 4M4ZA 4IUPA 3CPWS 3PMTA 4OMLA 3CCVQ 2DL4A 5CKFA 1RUWA 1WI7A 4CC4B 3I56Q 4M75D 4EDUA 2HEQA 1BBZA 1AZEA 2DBKA 5FU7C 1HYOA 1YNZA 2Y4YA 1RI9A 2EYWA 1WGSA 4M78G 4IUUA 2E3IA 3CCJQ 2NWMA 4EMKB 4YTLA 1K9MC 4HVUA 4M7AE 3S6WA 2X4YA 2YHTA 3PE0A 1ZSZA 1G83A 5CK9A 3CC2A 2OJ2A 4ZGDB 3OYKA 2XK0A 1Q82C 2YUQA 4C92B 4EIKA 2EYYA 4GLMA 1JO8A 2R5MA 3JV3A 1UHFA 3I9QA 2EQKA 3NHNA 5FROA 1VQPT 2XICA 3CCSQ 3GNGA 2NYSA 3JCMh 4IKFA 2OTJA 3H41A 1GCQC 2FB7A 3CCEQ 2DLPA 3CCJA 1TU0B 3AHUA 2L3SA 2BUDA 2XMFA 2YRDA 1W4SA 3QSUA 5KYWA 3JB9J 2X3XD 2KMTA 1LPLA 2QDYB 1ZA2B 4JLIA 1D1AA 2CT3A 4J9EA 2MMPA 3REBB 2DL3A 3L42A 2E12A 3JCMV 2QA4T 2CSIA 4BD3A 4F7UG 4PFZA 1JJ2A 2QDLA 2O88A 3V7CA 1M4ZA 1SG5A 2DPPB 2ROTA 3MP8A 1XOVA 2PUOB 1GBQA 2HL3A 1SF9A 4PJLA 2X3WD 2RQVA 1KC8R 2L89A 2DYBA 2MAMA 5J39A 2B86A 1AWJA 1WXBA 2O01E 2V8KA 4FT2A 3CC7A 2JTMA 4LDXA 5IXBA 4KULA 1LNXA 3C4SA 5GAOl 5I2SA 2LJ3A 1JRIA 2DFUA 4DEYA 1YWOA 5KE2A 2DTIA 4LD9K 5I22A 4QQ6A 4N4IA 3GIBA 1HXDA 4XTWA 2M9UA 3FC3A 1YIJQ 4RCCA 2ATCB 3CPFA 1VQLQ 4M78E 2C0IA 2O31A 1H3HA 1OZ2A 2OTLT 3M0SA 1P92A 2BE9B 2LDMA 2R57A 2YRVA 2A36A 3M54A 2EBPA 1NYGA
chains in the Genus database with same CATH topology
2RD1A 1D3BB 5GAMf 3LWHA 3CCVT 4MZPA 1BYMA 4M7DF 1VQPA 5GAMg 4XAXB 3QJYA 4FIBA 3P8HA 4C92E 4NS5A 2M1HA 3CMEA 3FDRA 3QDRB 2PVGB 2LVMA 1IZ6A 3PIPA 3S3MA 4Y91A 4M7DD 3HRUA 4C8QC 3G6EA 3FIFA 3CMET 2KAFA 4QW2A 5LJ5e 3OQ5A 1QVGS 5GAOp 1FX7A 2E5QA 4N4GA 5M9OA 3I55T 5A0LA 4M7DB 2QQSA 2RI3A 3HFNA 1R8OB 1FWZA 4M7DG 2AHJB 3UWNA 2RB6A 2RJCA 1G3SA 2MI6A 3NTHA 1D3BA 2HQXA 3RIRA 5J26A 5DLOA 2VUBA 4J83A 1QVGA 4F7UB 3S3OA 1VQLA 1VQ4A 2EYQA 4M7AB 2ZCFB 5HKCA 5IAYA 4CRIA 4M77F 4C5IA 4IUTA 3L2ZA 2RK1A 2DK3A 5KCOA 1S72T 1UB4A 4JS5A 5CIUA 4X34A 4KUIA 4LDYA 3JSCA 1PSFA 2LQ8A 3PFSA 1Q7YU 2RJDA 3VJPA 1YHQT 2LTOA 1YITA 2XDPA 3C12A 2ZPFB 5GMKl 4J6XA 5KE3A 3OYLA 3JAME 3JRZA 1OYXA 4C0FA 3PIOA 3OYDA 3CXCA 3DB3A 3WVEB 3M56A 4EMGA 3JCMd 4BI4A 1VUBA 3A5ZB 4UC4A 3CCJT 1Y96B 3JCMP 1VQNA 5GANj 4HKEA 4C92F 1YJNT 4MMLA 5CKDA 2X4XA 4J7FA 4M77E 2BIVA 2GFAA 4FL6A 3GOXA 4HCBA 4KT0E 2XDDA 2EKOA 1XTDA 3PMIA 2E6NA 3VUBA 3L2UA 2VYTA 1LJOA 2LQKA 1K9MU 3OW2S 3F70A 3KXTA 2XD0A 1I81A 2DXTA 2X4JA 4E7IA 1VIEA 4EMHA 1XNIA 1YI2T 4MZMA 3META 4M75F 1HK9A 4OF1A 4P5NA 2P0QA 3QPHA 4FU6A 4FT4A 3VYHB 5LJ5j 3G4SA 3LX7A 3M59A 3UPUA 3RKWA 3LW5E 4B9WA 5LJ3d 3V8KA 4A4HA 4ZN3A 3HHTB 2OAUA 4RKUE 3E9FA 3JB9F 3OBWA 4MMKA 4ELYC 4OP0A 4QQDA 2L3RA 5GMKe 1UEBA 3V7RA 5LJ5f 4C8QB 4KBMB 1KC8U 1QW1A 1ZBXA 5GAN5 4PJOE 4M77A 1YJWT 4M75A 3L2WA 1H641 1WPYA 4XU3A 3BY7A 4M78A 2DIQA 4BI8B 1UGRB 3CBOA 3M4YA 3C94A 4RG8A 4JS4A 1BI2A 2VXFA 3QKJA 1VQOA 2E65A 2EIFA 3HP9A 4LD6A 5GMKm 5GAOq 4M7AD 3HRSA 1X6OA 4C8QE 1WJSA 1VQMT 1IREB 2V8IA 2RH2A 4QVCA 1KG1A 2XI9A 2IVWA 2WSEE 4BDZA 4J8OA 4M7AF 5GMKj 4JRIA 4M75E 3UT1A 4R55A 3OYBA 2F5KA 5AYFA 5GAMd 2DZCA 3A8OB 2DD4A 3QO3A 5C6SA 1VQ5A 2HD0A 3ASKA 2E41A 3OMGA 3EFSA 3G7ZA 5L8RE 1DJ7B 4A4KA 4NL3A 3CC4A 3J80E 3INZA 1Y96A 3DLLA 1N27A 2QQAA 1G5VA 1VQ5T 4C5HA 4N0AC 1QP2A 3M5AA 3X25B 4A4GA 4C8QG 3DKMA 4F7UA 1WQ7A 3GP8A 3LLRA 2RJEA 4C5GA 1Q81U 1VQ8A 3SFMA 5LJ5h 1YCYA 5CR2A 1JBMA 4C0ZA 3JB9I 1N8RC 1VIFA 3NTKA 4A53A 5D6WA 4BUGA 4PJOD 1ZHIA 3JCMW 3SD4A 5LJ5d 4JLGA 2HBPA 3OA6A 5LJ3f 2E6ZA 3CCMT 1UGPB 4ZTJA 1N9SA 1ZQ1A 1OZ3A 2IG0A 4L5GA 3OYAA 2X4WA 4KUDK 4M7AA 1YJ9A 3CCLA 5GANh 2XIDA 2RHXA 2F69A 5CQYA 4E7HA 2QQ9A 4Q5WA 3OS0A 2HQEA 1NJIU 2D0QB 4DOWA 3VUZA 5GAOm 1KHCA 3KUFA 3MEWA 4EPCA 2YLBA 3QHSA 4X9DA 3PNWC 3SWNA 2CZ1B 5FU6C 4L6V5 3SWNC 2G3RA 3M4GA 4II1A 5EG2A 5GANd 3CCRA 1K73U 2DIGA 2KY9A 1H3ZA 2PUKB 1I8FA 3R6OA 5A0GA 4QVDA 1X01A 3MO8A 2LCLA 3VKIA 2EWNA 1V29B 3KBGA 3T9NA 2JVVA 3RMQA 2V8JA 3OS1A 4F7UF 1VQKA 1JJ2S 4X9CA 5GAN8 2E10A 3MP1A 3HL8A 3OSSC 2YLCA 3ER0A 2OTJT 1B34B 4BDYA 5GAOn 3I55A 4XTVA 3OYYA 1W2BS 4BB7A 4BACA 3HKSA 3OMCA 5FLXE 4LDUA 2JN0A 2KDSA 3MEAA 3M55A 3HFOA 1VQOT 4QQGA 5HY6A 4PJOA 4V2SA 2B8AA 4E7JA 4M7DE 3JCMf 1Q82U 4O6JA 3WVDB 1BI3A 2X35A 3A8LB 2DXBA 4M78C 4OB2B 3J81E 2RI5A 2RO0A 1QVPA 2XG8D 3QG1A 2P0KA 1WJQA 4J6WA 4OMFB 4PKCC 4HA8A 4OGEA 2ZPEB 4XU1A 5DM7R 4LDWA 4E7LA 2QQRA 2PVDB 4FSXA 4C0DC 4E47A 1QP3A 3CMAA 3RMSA 1VQ9A 2NLUA 2EJGA 5HK0A 2VGNA 2K3YA 2EQMA 2JUFA 2K5LA 4D6WA 3V8LA 3GPLA 5I2MA 1VQ7A 1U1TA 1NJIC 1M90U 4GY5A 2K3XA 4BE2A 4RMOA 4M7DC 3LGLA 4PJOG 3A8MB 3LWIA 4JDSA 5GAN6 2XU8A 1XQHA 3CCST 4ATOA 3QBYA 5DY9A 4BI3A 3X24B 1I5LA 3HRTA 1VQNT 4N4HA 2A3LA 3A8HB 1M1KU 4HT8A 5GAOr 5GAMh 2LX9A 1YJWA 2DAQA 1OI1A 2KSSA 5GAMj 2H3JA 5GMKi 3UDCA 3NTIA 3BDUA 2K57A 4LDVA 3X28B 4Y28E 3RERA 2FVUA 3TCJA 2JNGA 3NFCA 4M77B 5KH6A 3CC2T 4MDWA 4J5YA 2CGHA 4C92C 4ELZC 3MP6A 3OYFA 5LJ3g 2JTFA 3E19A 4IUVA 1YIJA 3JCMc 4PNOA 2LRQA 2L5QA 2DEQA 1LOJA 2E70A 2VGMA 3CBMA 3FJPA 4M78D 2RHIA 2PU9B 3VU3C 3CCEA 1G3TA 3ZBDA 4PJOC 1WNLA 3TREA 1VQ6T 2KVQG 3M58A 1RL2A 1Q7YC 4HT9A 2JOYA 3V8JA 3FEOA 4A4FA 1YJ9T 2DD5A 4Z02A 4ZGJB 1N6AA 3OYIA 4XU0A 4TVRA 3G6ET 4PJOB 3QJ6A 1U1SA 3CPWA 3JCMQ 2RM4A 3QXEB 2D6FA 3S3NA 3M53A 2RHZA 1MGQA 3HSBA 2LC4A 5IT9E 2WSCE 3CCMA 3M9QA 3MCAB 1U8RA 2QEXT 4PLIA 1KQ1A 2VV5A 5FU6B 3FRNA 3GLXA 1YHQA 4C92G 4M7DA 4BY6C 4M77D 4NL2A 1BIAA 3EFRA 4XTXA 3CCVA 3QIIA 1X75C 1VQ9T 4WF2A 2GFUA 1VQ4T 5CCAA 3RKXA 2QEXA 3X26B 5C0MA 3CCUT 5GANg 4JRKA 2RK2A 1WJRA 2CKKA 5CQXA 4XQ3A 3I56T 4M7AG 2EAYA 3LH0A 4VUBA 5GMKh 3L2RA 3QUIA 4MZTA 2M0OA 4N0AA 3CCLT 2K4YA 4JJNK 2RA2A 2RHUA 3G4ST 3ZEHA 2E1HA 1JB0E 4XTZA 1N8RU 3ME9A 4M75B 2DXCA 4QVZA 4O5VA 3OYCA 3MEUA 3OYMA 2DO3A 4C92D 1Q81C 1QVFA 2GQVA 2KQWA 4IUQA 4EMKC 2XHCA 2I2LA 5J3BA 4A54A 4JRQA 3EAEA 1KD1C 4J7IA 4BE0A 4BE1A 3OYEA 4RCBA 1W2BA 2A7YA 2QI2A 4ME7A 5GANe 2RI2A 3QYGB 3L2VA 2LT1A 1FXXA 3CD6T 2EFIA 4XK8E 2R58A 1NZ9A 2ZZDA 1KD1U 5I21A 1UGQB 1Y07A 1NE8A 1VQLT 2WACA 1GXIE 1YI2A 2CS7A 4M78B 1KHIA 3JB9D 4IUPA 3CPWS 1N9RA 3TU4K 1UGSB 1M1GA 2FYKA 3PMTA 4MDXA 5CKFA 1K73C 1M1KC 3CEYA 5LJ3e 1AHJB 2O4XB 3N5BB 2CZ7B 3JB9G 4RG2A 1NPPA 2K5IA 4C0DB 4C92A 5GAN3 3G71A 2OTLA 3CMAT 3OYGA 2DKGA 1YITT 1G3WA 1VQKT 2DVEA 3LYIA 1YJNA 3CCSA 4M75D 3ZFJA 4C0GA 2MF2A 2P4TA 4EDUA 3G71T 1BIBA 1KQSA 1M90C 2K5FA 2EJ9A 4E7KA 2LT4A 1YIJT 4M77G 5IN1A 5FU7C 5DLQE 1KC8C 4XTUA 2Y4YA 1M9SA 4CI0C 1WGSA 3BW1A 1BI0A 2GCXA 4IUUA 4M78G 5CVIA 2D9TA 3PTAA 1O9SA 2FHDA 3MEVA 4EMKB 5A0DA 3J7AF 4YTLA 4ZGEB 3OS2A 2PVOB 3L1AA 2DTHA 1YBYA 3H8ZA 1K8AC 1K9MC 2Y4XA 5CO7A 4M7AE 2Y90A 3LGFA 2EJFA 3TEEA 3CC7T 3S6WA 5GAN2 2X4YA 2YHTA 3VV0A 5CK9A 3H6ZA 3CC2A 4ZGDB 5GAN4 1I4K1 1G3YA 4NOYA 3OYKA 2XK0A 3FB9A 1Q82C 2DXUA 4C92B 3A8GB 4OB1B 2R5MA 1SSFA 3GNFB 2EQKA 5A2QE 3URGA 2R5AA 1RI0A 3SB2A 5FROA 2CYZB 4IURA 5GANf 4OGCA 4DQ2A 3CXCS 1S72A 2K2VA 3CC4T 4PJOF 2LCCA 2ZPHB 1VQPT 1VQ6A 3WXMB 1EIFA 2XICA 3I56A 4B9XA 2VXEA 3SDZA 3PGGA 1M5Q1 5FU7B 3GNGA 4FM4B 1M1FA 3JCMb 3OYHA 3CCRT 3JCMh 4IKFA 2OTJA 2VC8A 5D6YA 3OS5A 5D6XA 2FB7A 2FL7A 3JCMg 4F7UE 3CCJA 2QQBA 3AHUA 3CCQA 2RHYA 1KQSS 4A4EA 2BUDA 3OW2A 1W4SA 3OB9A 3PT9A 1NPRA 3Q1JA 5CKBA 4M7AC 3QSUA 3CCQT 4M77C 3JB9J 3OY9A 1Y7XA 2DZ9A 2KMTA 2QDYB 3QZ9B 3L2QA 4GLKA 4JLIA 3CCET 3X20B 2MMPA 2XDBA 1B34A 5KCHA 2QXFA 1VQ8T 3CD6A 3E1SA 3L42A 3RKYA 2DTOA 2EQUA 2E12A 3JCMV 2QA4T 3P8BB 4OB3B 2ZGWA 4BD3A 3JCMe 1O75A 4F7UG 3FLGA 5CAIA 1PSEA 2EQJA 4DOVA 1JJ2A 4C8QA 3V7SA 2QA4A 1TH7A 2WSFE 2E64A 2F5TX 3V7CA 1Q86U 1Q86C 2M16A 1KQ2A 3OBYA 2HAXA 1M4ZA 3OYJA 2DPPB 2ZPGB 2GF7A 3E9GA 1BI1A 1WQWA 2CZ0B 3MP8A 2P0PA 2DJZA 2O4XA 4JUVA 4JRPA 3OYNA 1QVFS 1XOVA 4M75C 3O8VA 2PUOB 3OSVA 3CCUA 3JCMX 4DA4A 2RJFA 3SWNB 2PQWA 1K8AU 3JB9H 1Y71A 4XU2A 2ZPIB 2L89A 5LJ3h 5FRNA 1VQMA 1M8VA 1VQ7T 2LNVA 2MAMA 3BFMA 3CBPA 5J39A 3P8DA 2HNIA 2CZ6B 1BKBA 5LJ3j 4BY6B 3M57A 3DLMA 4J6YA 4EMKA 4R56A 4XTYA 4C8QF 2O01E 1MHNA 2V8KA 3QZ5B 4FT2A 3CC7A 2JTMA 3RUXA 3MHXA 4LDXA 4KULA 1LNXA 3C4SA 4PLLA 2ZPBB 4L59A 5GAOl 5I2SA 2JZ2A 5CKEA 2MWPA 1JRIA 2KK4A 2L8DA 4C8QD 3C95A 3RESA 5CKHA 5KE2A 2C06A 4ZTFA 2DTIA 5FRMA 4LD9K 4QQ6A 2XKOC 4N4IA 3GIBA 5GAMe 5HK3A 1HXDA 2MWOA 5GAN7 4HCCA 4XTWA 3BDLA 2M9UA 3FC3A 3QYHB 2BKDN 4OVAA 4C5EA 4M78F 4RCCA 5LL6S 3CPFA 4PL6A 4M78E 3VYGA 3JCMJ 4HCZA 3GF5A 4OB0B 1OZ2A 3HPWA 5LJ5g 2OTLT 3DB4A 4ZN1A 1P92A 2LDMA 2QTXA 2R57A 2YRVA 3M54A 4M75G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A8O B;  2PUO B;  3X24 B;  4XK8 E;  2QDY B;  2ZZD A;  5L8R E;  3QZ9 B;  1DJ7 B;  2ZCF B;  4KT0 E;  3A8H B;  1UGQ B;  2CYZ B;  2D0Q B;  3WVD B;  3X20 B;  1GXI E;  3A8L B;  1UGR B;  2DD5 A;  2DXB A;  4OB2 B;  2CZ1 B;  4L6V 5;  2ZPH B;  4ZGJ B;  1QP2 A;  3X25 B;  2ZPI B;  2ZPE B;  4ZGE B;  2PUK B;  2PVG B;  1JB0 E;  1UGS B;  2PVD B;  2PVO B;  1PSF A;  1QP3 A;  4OB3 B;  4Y28 E;  3VYH B;  2DXC A;  1V29 B;  3X28 B;  4FM4 B;  3QYH B;  3QXE B;  1AHJ B;  1PSE A;  2CZ6 B;  2CZ7 B;  2ZPF B;  1IRE B;  3LW5 E;  4OB1 B;  2WSC E;  2WSF E;  3HHT B;  4RKU E;  3VYG A;  3WVE B;  3X26 B;  4OB0 B;  4ZGD B;  2WSE E;  2O01 E;  2AHJ B;  3QZ5 B;  1UGP B;  2DPP B;  3A8M B;  2ZPG B;  3QYG B;  2CZ0 B;  2ZPB B;  3A8G B;  2PU9 B;  2DD4 A; 
#chains in the Genus database with same CATH topology
 2KI7 A;  2H3E B;  3CCV T;  2J6K A;  4MZP A;  1FMV A;  2VB6 A;  1WHJ A;  2VWF A;  4FIB A;  4C92 E;  2HSE B;  4NS5 A;  3CME A;  4A63 B;  3KFV A;  1IZ6 A;  4M7D D;  1C0M A;  2C0T A;  2F2W A;  3CME T;  1QVG S;  5GAO p;  4N4G A;  4M7D B;  3HFN A;  1R8O B;  1H8K A;  3UWN A;  1RLP C;  1G3S A;  2MI6 A;  1JJ2 P;  5DLO A;  2QYZ A;  1QVG A;  2VUB A;  3S3O A;  3M0R A;  2EYQ A;  3EHR A;  2J05 A;  1KJW A;  2KYB A;  1Q7Y R;  1GCP A;  1OU9 A;  2DK3 A;  5KCO A;  1S72 T;  1UB4 A;  3JSC A;  3PFS A;  1Q7Y U;  2XDP A;  5KE3 A;  1OYX A;  4C0F A;  1VQO Q;  3DB3 A;  2K7A A;  1C1A A;  1VYT A;  2DBM A;  4C92 F;  1YJN T;  2BIV A;  1M2O A;  4KGX B;  1AWW A;  2EKO A;  3PMI A;  3L2U A;  2VYT A;  4E6R A;  1Q95 G;  3OW2 S;  1G2B A;  1PD0 A;  4OF1 A;  2P0Q A;  5LJ5 j;  3RKW A;  1GBR A;  4A4H A;  3HHT B;  3CQT A;  2DE0 X;  1M3B A;  3V7R A;  1K4U S;  1QW1 A;  4M75 A;  1SEM A;  1UGR B;  4JS4 A;  1WHH A;  2FRW A;  1E7O A;  1BI2 A;  2EIF A;  3MJX A;  4LD6 A;  5GAO q;  1WJS A;  1MMN A;  1NM7 A;  2MK5 A;  3CPW P;  3EGD A;  1KG1 A;  2E4H A;  2L3P A;  1TUD A;  5GMK j;  3OYB A;  5AYF A;  2PZ1 A;  3OMG A;  1ABQ A;  5L8R E;  3CC4 A;  1GL5 A;  1Y96 A;  1G5V A;  4C5H A;  1U06 A;  4A4G A;  4F7U A;  4RUG A;  3SFM A;  1G8X A;  2BZX A;  1VIF A;  2JXB A;  4A53 A;  5EC7 A;  1ZHI A;  3SD4 A;  5LJ5 d;  4JLG A;  3OA6 A;  1N8R R;  4ZTJ A;  1SRM A;  1ZQ1 A;  4J9I A;  2IG0 A;  1M2V B;  1UE9 A;  2X4W A;  3TQ7 P;  1YJ9 A;  1PKT A;  4E7H A;  4JJD A;  2DRM A;  1M2V A;  2YLB A;  3QHS A;  4X9D A;  3PNW C;  4II1 A;  2MOX A;  2COW A;  1WHG A;  1X01 A;  3VKI A;  2EWN A;  2JVV A;  2V8J A;  2GGR A;  5GAN 8;  2E10 A;  3HL8 A;  2YLC A;  3CCU Q;  1B34 B;  2FPE A;  2HZY A;  4XTV A;  5AT1 B;  1Y57 A;  2KDS A;  3HFO A;  4QQG A;  5HY6 A;  1KQS P;  1TS9 A;  4V2S A;  3JCM f;  4OB2 B;  1VQO A;  2XG8 D;  2P0K A;  1WJQ A;  4HA8 A;  1R0B G;  4C0D C;  5KYY B;  3RMS A;  2CP0 A;  3EFO A;  3GPL A;  5I2M A;  1PHT A;  2V26 A;  4PJJ A;  1M90 U;  4GY5 A;  4JZ4 A;  4BE2 A;  3A8M B;  2XU8 A;  2DNU A;  2YUN A;  1S72 Q;  3QBY A;  2K79 A;  4LNP A;  3X24 B;  1T3S A;  2A3L A;  2JM8 A;  2BZY A;  5GMK i;  2OTJ Q;  4LDV A;  3RER A;  2FVU A;  2RQT A;  2JS0 A;  1K0S A;  2FZC B;  3OYF A;  1ZUY A;  4IUV A;  1YIJ A;  2K6D A;  1MMG A;  3EGX B;  1VQ9 Q;  3CBM A;  2DEQ A;  1OU8 A;  2Z0W A;  2PU9 B;  2OI3 A;  3TRE A;  2KVQ G;  4RTT A;  4JJC A;  1ZLM A;  2LCS A;  4PFO A;  2ESW A;  1IHV A;  4XU0 A;  4TVR A;  1U1S A;  1KSW A;  3QXE B;  1MGQ A;  2LC4 A;  2WSC E;  3CCM A;  1FMW A;  2VV5 A;  1R77 A;  1VQ5 Q;  4NL2 A;  4XTX A;  1X75 C;  3VS1 A;  2GFU A;  5CCA A;  5C0M A;  5GAN g;  1WJR A;  2O9S A;  3LH0 A;  1D0Z A;  2OTL Q;  2RMO A;  3REA B;  4RTV A;  1RAG B;  3ME9 A;  2DXC A;  1WHK A;  4QVZ A;  2IPO B;  1CSK A;  2KBT A;  4CC2 A;  1T0H A;  1M27 C;  2I0N A;  4JRQ A;  1KFZ A;  1KD1 C;  1VA7 A;  3O5Z A;  4RTX A;  4RTW A;  5I21 A;  3I5S A;  1T0J A;  1AWO A;  2V1Q A;  1YI2 A;  4HCK A;  1IGQ A;  3JB9 D;  4FCY A;  3I5R A;  1M1G A;  2FYK A;  4RTZ A;  1A0N B;  1K73 C;  1M1K C;  3CEY A;  1AHJ B;  2O4X B;  1QCO A;  5GAN 3;  2K5I A;  4C0D B;  4C92 A;  2OTL A;  3OYG A;  1YIT T;  3VS5 A;  3CCS A;  4K11 A;  1MMD A;  4PJN A;  2P4T A;  3G71 T;  1M90 C;  4M77 G;  5DLQ E;  4XTU A;  4CI0 C;  3EG1 A;  1BI0 A;  2GCX A;  4E7Z A;  1O9S A;  1U5S A;  2FHD A;  2M02 A;  3EG9 A;  3J7A F;  1AWX A;  2DTH A;  3H8Z A;  1K8A C;  2Y4X A;  5CO7 A;  3PVQ A;  3TEE A;  3CC7 T;  4OMP A;  3EGU A;  2D8J A;  3H6Z A;  2AT1 B;  2A0F B;  3FB9 A;  3CC4 Q;  1X27 A;  3URG A;  2R5A A;  2CYZ B;  4OGC A;  3CXC S;  2K2V A;  3CC4 T;  4PJO F;  3WXM B;  3I56 A;  4B9X A;  4FM4 B;  3OYH A;  1YJ9 Q;  4KH1 B;  5D6X A;  1OPK A;  2D1X A;  3JCM g;  4F7U E;  2CP2 A;  1KQS S;  3IQL A;  5CKB A;  2RPN A;  3CCR Q;  3L2Q A;  1PNJ A;  2QXF A;  1VQ8 T;  3CD6 A;  2KGT A;  3RKY A;  3P8B B;  2ZGW A;  1KD1 R;  5CAI A;  1UUE A;  1WHM A;  2EQJ A;  4DOV A;  4C8Q A;  2HKN A;  4LN2 A;  2QA4 A;  2E64 A;  2F5T X;  1B7T A;  3EGD B;  3OBY A;  2COY A;  2HAX A;  2ZPG B;  2CZ0 B;  4JUV A;  1K8A R;  1I07 A;  3O8V A;  4QT7 A;  1I0C A;  2E3H A;  3OSV A;  3RBB B;  3CCU A;  3SWN B;  3JB9 H;  2FG0 A;  1NYF A;  4XU2 A;  2ZPI B;  1M90 R;  2LNV A;  3CBP A;  1FYN A;  3P8D A;  2CZ6 B;  2KXD A;  2AKK A;  1WYX A;  3M57 A;  4EMK A;  1WFW A;  4C8Q F;  3QZ5 B;  3RUX A;  1T3L A;  3MHX A;  1RAA B;  1ZUU A;  2DER A;  2QA4 Q;  4FYV B;  1IXD A;  1QMC A;  1AZG B;  3RES A;  4ZTF A;  2K2M A;  5HK3 A;  5GAN 7;  3AT1 B;  3CD6 Q;  1PWT A;  1QWF A;  2VKN A;  4ZNX A;  5LJ5 g;  3CCL Q;  1PC0 A;  1UTI A;  4IUR A;  4M75 G;  2RD1 A;  1BU1 A;  4M7D F;  2CP3 A;  5GAM g;  3QJY A;  4R0K A;  2M1H A;  2SEM A;  2PVG B;  1SPK A;  3PIP A;  5KYN A;  3S3M A;  5KYY A;  4C8Q C;  3OQ5 A;  2DL8 A;  1FX7 A;  2E5Q A;  2QQS A;  2RI3 A;  2L2P A;  2RJC A;  1D3B A;  4J83 A;  2CUD A;  4M7A B;  3E2U A;  4CRI A;  2NUZ A;  4C5I A;  4IUT A;  2EYX A;  4X34 A;  4KUI A;  1D1B A;  3VJP A;  1Q82 R;  1YHQ T;  2ED0 A;  2LTO A;  5GMK l;  2J6F A;  3PIO A;  3JCM d;  3M56 A;  4HXJ A;  4BI4 A;  1VUB A;  3EH2 A;  3JCM P;  1VQN A;  2YSQ A;  4MML A;  4J7F A;  4RTU A;  3G1J A;  4HCB A;  4KT0 E;  2E6N A;  1QCN A;  5IXF A;  2LQK A;  1K9M U;  1I81 A;  1OX8 A;  4MZM A;  4M75 F;  3G4S A;  4FT4 A;  3LX7 A;  3LW5 E;  4B9W A;  1V1C A;  2RQU A;  5GMK e;  4C8Q B;  4KBM B;  4PJO E;  4M77 A;  1YJW T;  2CP7 A;  3SEM A;  4WTO B;  3L2W A;  3NPF A;  2DIQ A;  3M4Y A;  3CBO A;  1HJD A;  1VQM T;  4QKU A;  2V8I A;  2RH2 A;  5IHN A;  2JMA A;  2WSE E;  4JPB W;  2NUT A;  4JRI A;  3UT1 A;  3G4S Q;  3QO3 A;  1VQ5 A;  3ASK A;  5FW9 A;  1CKB A;  4OMN A;  3INZ A;  4N0A C;  3FJ5 A;  1VOM A;  2LJ0 A;  1UJY A;  3GP8 A;  1LCK A;  5LJ5 h;  1JBM A;  3JB9 I;  1N8R C;  3NTK A;  3BE3 A;  5D6W A;  4BUG A;  2HBP A;  2DET A;  2DVJ A;  3CCM T;  4L5G A;  1J3T A;  1TWB A;  1ZSG A;  2CH4 W;  3OS0 A;  2HQE A;  2D0Q B;  4DOW A;  3VUZ A;  3KUF A;  3MEW A;  4EPC A;  5FU6 C;  3SWN C;  2G3R A;  4FW1 A;  2KYM A;  2KY9 A;  2PUK B;  3R6O A;  1RAH B;  3T9N A;  1UEC A;  2NUP A;  3D7S B;  2EGA A;  3OMC A;  5FLX E;  2JN0 A;  2FPF A;  3MEA A;  1ZA1 B;  2DX1 A;  4KH0 B;  4PJO A;  2B8A A;  1Q82 U;  3A8L B;  2DXB A;  2RO0 A;  4OMF B;  1YIT Q;  1U3O A;  2ZPE B;  4E7L A;  5HK0 A;  2VGN A;  4F14 A;  2JUF A;  3M0Q A;  1VQ8 Q;  1U1T A;  1MUZ A;  1NJI C;  1VQN Q;  4RMO A;  4M7D C;  1RAB B;  3LWI A;  4JDS A;  4GBQ A;  2PNI A;  4ATO A;  4BI3 A;  4DBR A;  1I5L A;  3HRT A;  1VQN T;  1IB8 A;  4HT8 A;  3QDF A;  5IHK A;  1YHQ Q;  5GAM h;  2F2V A;  4PK4 A;  3BDU A;  3EG0 A;  2K57 A;  2EKH A;  1QKX A;  5KH6 A;  4M77 B;  4J5Y A;  2CGH A;  1NLO C;  1HSQ A;  1VQP Q;  2DIL A;  4PNO A;  2LRQ A;  2GBQ A;  2E70 A;  3FJP A;  2RHI A;  3CCE A;  4PJO C;  1FMK A;  2JJ9 A;  1VQ6 T;  2EQI A;  1GFD A;  1Q7Y C;  3V8J A;  3FEO A;  4A4F A;  1YJ9 T;  4Z02 A;  1NEG A;  2NUT B;  1QVF P;  3OYI A;  3M0T A;  1JXM A;  3QJ6 A;  2RM4 A;  1UG1 A;  3M53 A;  3HSB A;  1YJW Q;  3M9Q A;  1U8R A;  1K73 R;  2QEX T;  1KQ1 A;  5FU6 B;  1WIE A;  4M7D A;  2A28 A;  4C92 G;  4M77 D;  1BIA A;  3CCV A;  1ZSZ B;  3QII A;  4WF2 A;  1D0Y A;  1AT1 B;  3RKX A;  2QEX A;  3X26 B;  2JT4 A;  4FYX B;  3VS6 A;  3UAT A;  4M7A G;  3L2R A;  4VUB A;  5GMK h;  4MZT A;  5KYX B;  3CCL T;  4N0A A;  4WCI A;  2RA2 A;  1BB9 A;  1PRM C;  2E1H A;  1TG0 A;  4XTZ A;  1IO6 A;  3QWX X;  1PRL C;  4C92 D;  4IUQ A;  4EMK C;  4A54 A;  1GFC A;  3EAE A;  4BE0 A;  3OYE A;  4RCB A;  2KR3 A;  2A7Y A;  4ME7 A;  2O9V A;  1FXX A;  2EFI A;  3EG9 B;  2ZZD A;  1KD1 U;  1UGQ B;  1ABO A;  2WAC A;  1GXI E;  2CS7 A;  4M78 B;  1KHI A;  3VRY A;  1Q86 R;  1VQK Q;  1N9R A;  2EVR A;  4OMQ A;  3N5B B;  2CZ7 B;  3H9N A;  1NPP A;  2KT8 A;  2DKG A;  1VQK T;  3SHW A;  1YJN A;  4C0G A;  2MF2 A;  2KT1 A;  1KQS A;  2K5F A;  2EJ9 A;  4LUE A;  4E7K A;  1YIJ T;  1UGV A;  3I55 Q;  1KC8 C;  3RNJ A;  1Z9Q A;  3CMA Q;  3VS0 A;  1BCO A;  3CCQ Q;  3OS2 A;  1WXT A;  3L1A A;  2GTO A;  5ECA A;  4F16 A;  4AMC A;  4DEX A;  1BK2 A;  1ZSZ C;  5GAN 2;  3VV0 A;  5GAN 4;  1I4K 1;  4NOY A;  2K9G A;  4OB1 B;  4AFU C;  2RQR A;  3GNF B;  2F2X A;  1RI0 A;  3SB2 A;  1EZZ B;  4DQ2 A;  5GAN f;  1S72 A;  4J9F A;  2MCN A;  3NMZ C;  2ZPH B;  1YP5 A;  2W10 A;  2DRK A;  2VXE A;  1I5O B;  5FU7 B;  2QGF B;  1M1F A;  3CCR T;  2VC8 A;  1AD5 A;  2QQB A;  2RHY A;  4DBH A;  3PT9 A;  3Q1J A;  1Y7X A;  4ANJ A;  2DZ9 A;  2JTE A;  3QZ9 B;  4GLK A;  1R0C B;  1NG2 A;  2XDB A;  3EHQ A;  2KE9 A;  1WX6 A;  2EQU A;  3JCM e;  4JJB A;  3VS4 A;  1O75 A;  3FLG A;  1PSE A;  3V7S A;  1TH7 A;  4DBQ A;  2WSF E;  5KYU A;  2KRN A;  1C6V X;  2M16 A;  1QLY A;  1EX4 A;  1CKA A;  1NLP C;  1KIK A;  3E9G A;  1BI1 A;  1WQW A;  4JRP A;  2O4X A;  3OYN A;  3C0C A;  1D1C A;  1MNE A;  3JCM X;  1OOT A;  2RJF A;  1AEY A;  1WXU A;  4IIO A;  2DL7 A;  4D8D A;  5FRN A;  1VQM A;  1VQ7 T;  2LP5 A;  2HNI A;  5LJ3 j;  4BY6 B;  2X51 A;  4FYY B;  3DLM A;  4R56 A;  4XTY A;  1MHN A;  2D8H A;  4PLL A;  2ZPB B;  2MWP A;  2KK4 A;  2L8D A;  4C8Q D;  3C95 A;  5CKH A;  2C06 A;  3ULR B;  1M8M A;  1SRL A;  2XKO C;  5GAM e;  2MWO A;  4LUD A;  4HCC A;  3BDL A;  2BKD N;  4M78 F;  5LL6 S;  2A08 A;  4PL6 A;  1X2K A;  4OB0 B;  1Q81 R;  2GNC A;  4ZN1 A;  1JEG A;  6AT1 B;  2AIR B;  1D3B B;  5GAM f;  3LWH A;  2A37 A;  1W1F A;  2YUO A;  3FDR A;  3QDR B;  1TXQ A;  1M30 A;  2LVM A;  3MKD A;  2FEI A;  4Y91 A;  3HRU A;  5LJ5 e;  1W70 A;  5M9O A;  3I55 T;  4X1V A;  2DA9 A;  4M7D G;  2AHJ B;  2RB6 A;  3NTH A;  1N5Z A;  1YCS B;  1VQL A;  3CC7 Q;  2COZ A;  2HKQ B;  2ZCF B;  4AG1 C;  2BE7 D;  1RAC B;  4M77 F;  2J7I A;  1RAI B;  2RK1 A;  3H0I A;  2CUB A;  4JS5 A;  5CIU A;  1ARK A;  5GJV B;  2LQ8 A;  2RJD A;  3C12 A;  1MV3 A;  2ZPF B;  7AT1 B;  3JRZ A;  3OYD A;  3CXC A;  4EMG A;  1RAD B;  2LMJ A;  1NEB A;  1Y96 B;  4RTY A;  5GAN j;  2X4X A;  2GFA A;  4FL6 A;  3GOX A;  2XDD A;  1XTD A;  1LJO A;  2FZK B;  3F70 A;  3KXT A;  2SRC A;  2X4J A;  4E7I A;  3M0U A;  2FPD A;  1HK9 A;  2CRE A;  3QPH A;  4P5N A;  2HBW A;  2M51 A;  3UPU A;  5LJ3 d;  1GCQ A;  1PKS A;  3I35 A;  3OBW A;  9ATC B;  4MMK A;  4ELY C;  3G6E Q;  4QQD A;  3UA6 A;  4Z88 A;  1KC8 U;  3OW2 P;  5IH2 A;  5GAN 5;  2YWW A;  1VQM Q;  1H64 1;  1WPY A;  1Y0M A;  3BY7 A;  1W2B P;  1I1J A;  4BI8 B;  1F1B B;  1OX9 A;  2ROL A;  3QKJ A;  2E65 A;  3HRS A;  4J9B A;  2QK0 A;  2YT6 A;  4BDZ A;  4M7A F;  4R55 A;  4M75 E;  2JW4 A;  3TSZ A;  2F5K A;  1EFN A;  2DZC A;  3A8O B;  2DD4 A;  5C6S A;  5KYW B;  2E41 A;  1VQ7 Q;  2QGG A;  4NL3 A;  2BTT A;  4E7S A;  1N27 A;  2QQA A;  2CP6 A;  1VQ5 T;  2K3B A;  1QP2 A;  4C8Q G;  3DKM A;  1IRX A;  1Q81 U;  2RJE A;  1VQ8 A;  3GBQ A;  1YCY A;  3TSW A;  2DEU A;  1IGU A;  1JU5 C;  1UDL A;  5LJ3 f;  2E6Z A;  1UGP B;  1OZ3 A;  3OYA A;  4FYW B;  4M7A A;  2KRO A;  1X6G A;  5GAN h;  2XID A;  2RHX A;  2QQ9 A;  3EG3 A;  4Q5W A;  2J6O A;  1NJI U;  1E6H A;  5GAN d;  3CCR A;  1K73 U;  1NJI R;  4QVD A;  2LCL A;  1V29 B;  2GTJ A;  4X9C A;  1QCF A;  3OSS C;  3ER0 A;  4BDY A;  3I55 A;  1E6G A;  1AOJ A;  3OYY A;  1W2B S;  2FRY A;  4BB7 A;  4BAC A;  4LDU A;  1X43 A;  2YDL A;  1QQJ A;  4M7D E;  4E7J A;  4O6J A;  3WVD B;  1RAF B;  3J81 E;  2RI5 A;  3QG1 A;  1QVP A;  4PKC C;  5D6Y A;  3RDV A;  4XU1 A;  3S3N A;  1VQ7 A;  4OGE A;  4LDW A;  4FSX A;  3CMA A;  4E47 A;  3CCM Q;  1VQ9 A;  2K3Y A;  2EQM A;  3V8L A;  4J9D A;  2K3X A;  1AVZ C;  4PJO G;  1WDX A;  2YUP A;  3CCS T;  2CP5 A;  5D7U A;  2RN8 A;  5DY9 A;  2ABL A;  1WZO A;  4N4H A;  1M1K U;  2BZ8 A;  4B6M A;  1OI1 A;  2KSS A;  2LQN A;  1PM3 A;  1LVK A;  3X28 B;  4Y28 E;  3TCJ A;  3NFC A;  1W6X A;  3CC2 T;  4CC7 A;  1VQ6 Q;  4C92 C;  3A1P A;  5LJ3 g;  2JTF A;  3E19 A;  3QWY A;  1S1N A;  2EGE A;  3JCM c;  2IIM A;  2L5Q A;  1LOJ A;  4M78 D;  3VU3 C;  1G3T A;  3ZBD A;  1WNL A;  1RL2 A;  2HMA A;  4HT9 A;  2JOY A;  2D0N A;  2DD5 A;  4ZGJ B;  3G6E T;  2F1L A;  3JCM Q;  2RHZ A;  5IT9 E;  3THK A;  3FRN A;  3GLX A;  3NGP A;  3R6N A;  3EFR A;  3EFO B;  4AFQ C;  1VQ4 T;  1SHF A;  2X9H A;  4J9H A;  1PCX A;  2AZV A;  4JRK A;  2RK2 A;  3I56 T;  2EAY A;  1JXO A;  4DBF A;  2K4Y A;  4JJN K;  1VQ4 Q;  3G4S T;  3A98 A;  1JB0 E;  1N8R U;  4AT1 B;  2HDA A;  3MEU A;  3OYM A;  3OYC A;  1TSF A;  2KQW A;  2XHC A;  2I2L A;  4J7I A;  3EH1 A;  3L2V A;  4LE9 A;  3EG2 A;  1NE8 A;  1VQL T;  2E5K A;  2RQW A;  1K0X A;  2VAS A;  3TU4 K;  1UGS B;  2KNB B;  2AKL A;  4MDX A;  2J06 A;  5LJ3 e;  1YN8 A;  5GJW B;  3JB9 G;  4HVW A;  4RG2 A;  3G71 A;  3CMA T;  1XJW B;  1UHC A;  2CT4 A;  1G3W A;  2DVE A;  3LYI A;  2HL5 C;  3ZFJ A;  1BIB A;  2EW3 A;  2LT4 A;  5IN1 A;  2DJQ A;  1M9S A;  3M0P A;  3BW1 A;  5CVI A;  2D9T A;  3PTA A;  3MEV A;  5A0D A;  4ZGE B;  1VYU A;  2PVO B;  1YBY A;  2L3Q A;  2Y90 A;  3VS2 A;  3LGF A;  2P84 A;  2EJF A;  2AK5 A;  1G3Y A;  5FWC A;  2LQW A;  2DXU A;  3A8G B;  1SSF A;  1HD3 A;  3U23 A;  5L23 A;  5A2Q E;  1OUL A;  2LCC A;  1VQ6 A;  1EIF A;  3SDZ A;  3PGG A;  1M5Q 1;  2EYZ A;  3JCM b;  3VRZ A;  3OS5 A;  2FL7 A;  2RF0 A;  1IHW A;  3CCQ A;  4A4E A;  2JS2 A;  2QAS A;  1QWE A;  2EPD A;  2JM9 A;  2OAW A;  3OW2 A;  5KYU B;  3OB9 A;  1X6B A;  4M7A C;  1NPR A;  3CCQ T;  1SSH A;  4M77 C;  3OY9 A;  3CCE T;  1M3C A;  3X20 B;  1B34 A;  5KCH A;  1ZUK A;  2CDT A;  3E1S A;  1QVG P;  3PVL A;  2DTO A;  4OB3 B;  2ZAE A;  4ORZ A;  1Q86 U;  4OMM A;  1Q86 C;  1KQ2 A;  1SHG A;  4AFZ C;  3OYJ A;  2OX7 A;  2GF7 A;  1MMA A;  1QVF S;  2P0P A;  2DJZ A;  4M75 C;  1YWP A;  1V76 A;  4DA4 A;  2QEX Q;  1PD1 A;  2PQW A;  1K8A U;  1TUG B;  1Y71 A;  5LJ3 h;  1M8V A;  3BFM A;  1BKB A;  2H8H A;  4J6Y A;  2DM1 A;  2YXY A;  4KGZ B;  3CME Q;  4L59 A;  1JQQ A;  2JZ2 A;  5CKE A;  1RLQ C;  5FRM A;  1ZX6 A;  2CH4 A;  2PTK A;  3QYH B;  4OVA A;  4C5E A;  4JZ3 A;  3VYG A;  3JCM J;  4HCZ A;  3GF5 A;  3HPW A;  3DB4 A;  2QTX A;  2M0Y A;  4Y92 A;  3MPU B;  5FWB A;  1BYM A;  4HVV A;  1VQP A;  1X69 A;  2CSQ A;  4XAX B;  1KK7 A;  3P8H A;  2KXC A;  3ZL7 C;  2QG9 B;  2O2O A;  1TOV A;  3G6E A;  2KRS A;  3FIF A;  2KAF A;  4QW2 A;  2P4R A;  5A0L A;  2ECZ A;  1ZBJ A;  1FWZ A;  2HQX A;  2KEA A;  4IIM A;  5J26 A;  3RIR A;  3CC2 Q;  4F7U B;  3LH5 A;  1UJ0 A;  1VQ4 A;  3TVT A;  5I11 A;  1SKU B;  5IAY A;  5HKC A;  2ED1 A;  3L2Z A;  4LDY A;  1PSF A;  1PG5 B;  1WHL A;  2MYS A;  1YIT A;  2LZ6 B;  4J6X A;  3OYL A;  3JAM E;  3WVE B;  3A5Z B;  4UC4 A;  3CCJ T;  1K9A A;  2VVK A;  2YRC A;  4HKE A;  5CKD A;  4M77 E;  2FO0 A;  4D8K A;  3RR6 A;  4J9C A;  5KYX A;  3VUB A;  2XD0 A;  1UFF A;  2DXT A;  1YI2 T;  1VIE A;  4EMH A;  1XNI A;  1BCM A;  1MV0 B;  3MET A;  4LXC A;  3VYH B;  4FU6 A;  2HQH A;  3M59 A;  2ENM A;  4OMO A;  1GRI A;  2DMO A;  3V8K A;  4ZN3 A;  2OAU A;  4RKU E;  3E9F A;  3JB9 F;  4OP0 A;  2L3R A;  5HCK A;  2NUP B;  1UEB A;  5LJ5 f;  2DF6 A;  4KRT A;  2G6F X;  1ZBX A;  1TUC A;  2HCK A;  4XU3 A;  4M78 A;  3C94 A;  4RG8 A;  2LNH B;  4J9G A;  2VXF A;  5GMK m;  3HP9 A;  8AT1 B;  4M7A D;  1B3Q A;  1X6O A;  4C8Q E;  2KRM A;  1IRE B;  1D09 B;  1ACM B;  4QVC A;  1OV3 A;  2XI9 A;  2IVW A;  4J8O A;  1M1K R;  1OEB A;  1K1Z A;  5GAM d;  2HD0 A;  3EFS A;  3G7Z A;  1DJ7 B;  4A4K A;  3J80 E;  3DLL A;  2HSP A;  3M5A A;  3X25 B;  1WQ7 A;  3LLR A;  4C5G A;  5CR2 A;  4C0Z A;  4PFP A;  4PJO D;  3JCM W;  2QAZ A;  2EGC A;  3H0F A;  1N9S A;  4KUD K;  1VYV A;  3CCL A;  4ESR A;  2F69 A;  5CQY A;  2GQI A;  1B07 A;  5GAO m;  2LJ1 A;  1MND A;  1KHC A;  3SWN A;  1H92 A;  2CZ1 B;  4L6V 5;  2RNA A;  5EG2 A;  3M4G A;  2DIG A;  5A0G A;  1I8F A;  3G71 Q;  3MO8 A;  3KBG A;  3RMQ A;  3OS1 A;  1VQK A;  4F7U F;  1JJ2 S;  3MP1 A;  2OTJ T;  5GAO n;  4AG2 C;  3HKS A;  3M55 A;  1VQO T;  1X2Q A;  1BI3 A;  2X35 A;  4M78 C;  1VQ9 T;  4J6W A;  3CCU T;  2AZS A;  5DM7 R;  1H3Z A;  2LX7 A;  2QQR A;  2PVD B;  1QP3 A;  1Z9Z A;  2NLU A;  3CXC P;  2EJG A;  2C0O A;  2K5L A;  4D6W A;  2MIO A;  3H0H A;  3LGL A;  1QKW A;  2V1R A;  5GAN 6;  1XQH A;  1K9M R;  3UA7 A;  2MPX C;  3A8H B;  5GAO r;  2LX9 A;  1YJW A;  2DAQ A;  5GAM j;  2H3J A;  3UDC A;  3NTI A;  1K76 A;  2JNG A;  1OQK A;  4MDW A;  4ELZ C;  2QTV A;  3MP6 A;  4F04 B;  2FZG B;  4E2F B;  2VGM A;  2JMC A;  1YI2 Q;  1YFN A;  4PJM A;  4AFS C;  8ATC B;  3M58 A;  1WA7 A;  2DL5 A;  1N6A A;  1D0X A;  3HTR A;  4PJO B;  1WLP B;  3CPW A;  3VS3 A;  1YJN Q;  2D6F A;  4Z89 A;  1RAE B;  3MCA B;  4KGV B;  4PLI A;  1YHQ A;  4BY6 C;  1OPL A;  3VS7 A;  1M3A A;  1TTH B;  2CKK A;  5CQX A;  4XQ3 A;  3QUI A;  2M0O A;  2RHU A;  3ZEH A;  4M75 B;  4O5V A;  4FSS A;  3EGX A;  1Q81 C;  2DO3 A;  1QVF A;  2GQV A;  5J3B A;  2L0A A;  4BE1 A;  1W2B A;  2QI2 A;  5GAN e;  2RI2 A;  3QYG B;  2DYI A;  4Z8A A;  3UF4 A;  2LT1 A;  1NBE B;  3CD6 T;  4FW2 A;  4XK8 E;  4F17 A;  2R58 A;  1NZ9 A;  5IHI A;  1Y07 A;  2W0Z A;  4CC3 A;  4M4Z A;  4IUP A;  3CPW S;  3PMT A;  4OML A;  3CCV Q;  2DL4 A;  5CKF A;  1RUW A;  1WI7 A;  4CC4 B;  3I56 Q;  4M75 D;  4EDU A;  2HEQ A;  1BBZ A;  1AZE A;  2DBK A;  5FU7 C;  1HYO A;  1YNZ A;  2Y4Y A;  1RI9 A;  2EYW A;  1WGS A;  4M78 G;  4IUU A;  2E3I A;  3CCJ Q;  2NWM A;  4EMK B;  4YTL A;  1K9M C;  4HVU A;  4M7A E;  3S6W A;  2X4Y A;  2YHT A;  3PE0 A;  1ZSZ A;  1G83 A;  5CK9 A;  3CC2 A;  2OJ2 A;  4ZGD B;  3OYK A;  2XK0 A;  1Q82 C;  2YUQ A;  4C92 B;  4EIK A;  2EYY A;  4GLM A;  1JO8 A;  2R5M A;  3JV3 A;  1UHF A;  3I9Q A;  2EQK A;  3NHN A;  5FRO A;  1VQP T;  2XIC A;  3CCS Q;  3GNG A;  2NYS A;  3JCM h;  4IKF A;  2OTJ A;  3H41 A;  1GCQ C;  2FB7 A;  3CCE Q;  2DLP A;  3CCJ A;  1TU0 B;  3AHU A;  2L3S A;  2BUD A;  2XMF A;  2YRD A;  1W4S A;  3QSU A;  5KYW A;  3JB9 J;  2X3X D;  2KMT A;  1LPL A;  2QDY B;  1ZA2 B;  4JLI A;  1D1A A;  2CT3 A;  4J9E A;  2MMP A;  3REB B;  2DL3 A;  3L42 A;  2E12 A;  3JCM V;  2QA4 T;  2CSI A;  4BD3 A;  4F7U G;  4PFZ A;  1JJ2 A;  2QDL A;  2O88 A;  3V7C A;  1M4Z A;  1SG5 A;  2DPP B;  2ROT A;  3MP8 A;  1XOV A;  2PUO B;  1GBQ A;  2HL3 A;  1SF9 A;  4PJL A;  2X3W D;  2RQV A;  1KC8 R;  2L89 A;  2DYB A;  2MAM A;  5J39 A;  2B86 A;  1AWJ A;  1WXB A;  2O01 E;  2V8K A;  4FT2 A;  3CC7 A;  2JTM A;  4LDX A;  5IXB A;  4KUL A;  1LNX A;  3C4S A;  5GAO l;  5I2S A;  2LJ3 A;  1JRI A;  2DFU A;  4DEY A;  1YWO A;  5KE2 A;  2DTI A;  4LD9 K;  5I22 A;  4QQ6 A;  4N4I A;  3GIB A;  1HXD A;  4XTW A;  2M9U A;  3FC3 A;  1YIJ Q;  4RCC A;  2ATC B;  3CPF A;  1VQL Q;  4M78 E;  2C0I A;  2O31 A;  1H3H A;  1OZ2 A;  2OTL T;  3M0S A;  1P92 A;  2BE9 B;  2LDM A;  2R57 A;  2YRV A;  2A36 A;  3M54 A;  2EBP A;  1NYG A; 
#chains in the Genus database with same CATH homology
 2RD1 A;  1D3B B;  5GAM f;  3LWH A;  3CCV T;  4MZP A;  1BYM A;  4M7D F;  1VQP A;  5GAM g;  4XAX B;  3QJY A;  4FIB A;  3P8H A;  4C92 E;  4NS5 A;  2M1H A;  3CME A;  3FDR A;  3QDR B;  2PVG B;  2LVM A;  1IZ6 A;  3PIP A;  3S3M A;  4Y91 A;  4M7D D;  3HRU A;  4C8Q C;  3G6E A;  3FIF A;  3CME T;  2KAF A;  4QW2 A;  5LJ5 e;  3OQ5 A;  1QVG S;  5GAO p;  1FX7 A;  2E5Q A;  4N4G A;  5M9O A;  3I55 T;  5A0L A;  4M7D B;  2QQS A;  2RI3 A;  3HFN A;  1R8O B;  1FWZ A;  4M7D G;  2AHJ B;  3UWN A;  2RB6 A;  2RJC A;  1G3S A;  2MI6 A;  3NTH A;  1D3B A;  2HQX A;  3RIR A;  5J26 A;  5DLO A;  2VUB A;  4J83 A;  1QVG A;  4F7U B;  3S3O A;  1VQL A;  1VQ4 A;  2EYQ A;  4M7A B;  2ZCF B;  5HKC A;  5IAY A;  4CRI A;  4M77 F;  4C5I A;  4IUT A;  3L2Z A;  2RK1 A;  2DK3 A;  5KCO A;  1S72 T;  1UB4 A;  4JS5 A;  5CIU A;  4X34 A;  4KUI A;  4LDY A;  3JSC A;  1PSF A;  2LQ8 A;  3PFS A;  1Q7Y U;  2RJD A;  3VJP A;  1YHQ T;  2LTO A;  1YIT A;  2XDP A;  3C12 A;  2ZPF B;  5GMK l;  4J6X A;  5KE3 A;  3OYL A;  3JAM E;  3JRZ A;  1OYX A;  4C0F A;  3PIO A;  3OYD A;  3CXC A;  3DB3 A;  3WVE B;  3M56 A;  4EMG A;  3JCM d;  4BI4 A;  1VUB A;  3A5Z B;  4UC4 A;  3CCJ T;  1Y96 B;  3JCM P;  1VQN A;  5GAN j;  4HKE A;  4C92 F;  1YJN T;  4MML A;  5CKD A;  2X4X A;  4J7F A;  4M77 E;  2BIV A;  2GFA A;  4FL6 A;  3GOX A;  4HCB A;  4KT0 E;  2XDD A;  2EKO A;  1XTD A;  3PMI A;  2E6N A;  3VUB A;  3L2U A;  2VYT A;  1LJO A;  2LQK A;  1K9M U;  3OW2 S;  3F70 A;  3KXT A;  2XD0 A;  1I81 A;  2DXT A;  2X4J A;  4E7I A;  1VIE A;  4EMH A;  1XNI A;  1YI2 T;  4MZM A;  3MET A;  4M75 F;  1HK9 A;  4OF1 A;  4P5N A;  2P0Q A;  3QPH A;  4FU6 A;  4FT4 A;  3VYH B;  5LJ5 j;  3G4S A;  3LX7 A;  3M59 A;  3UPU A;  3RKW A;  3LW5 E;  4B9W A;  5LJ3 d;  3V8K A;  4A4H A;  4ZN3 A;  3HHT B;  2OAU A;  4RKU E;  3E9F A;  3JB9 F;  3OBW A;  4MMK A;  4ELY C;  4OP0 A;  4QQD A;  2L3R A;  5GMK e;  1UEB A;  3V7R A;  5LJ5 f;  4C8Q B;  4KBM B;  1KC8 U;  1QW1 A;  1ZBX A;  5GAN 5;  4PJO E;  4M77 A;  1YJW T;  4M75 A;  3L2W A;  1H64 1;  1WPY A;  4XU3 A;  3BY7 A;  4M78 A;  2DIQ A;  4BI8 B;  1UGR B;  3CBO A;  3M4Y A;  3C94 A;  4RG8 A;  4JS4 A;  1BI2 A;  2VXF A;  3QKJ A;  1VQO A;  2E65 A;  2EIF A;  3HP9 A;  4LD6 A;  5GMK m;  5GAO q;  4M7A D;  3HRS A;  1X6O A;  4C8Q E;  1WJS A;  1VQM T;  1IRE B;  2V8I A;  2RH2 A;  4QVC A;  1KG1 A;  2XI9 A;  2IVW A;  2WSE E;  4BDZ A;  4J8O A;  4M7A F;  5GMK j;  4JRI A;  4M75 E;  3UT1 A;  4R55 A;  3OYB A;  2F5K A;  5AYF A;  5GAM d;  2DZC A;  3A8O B;  2DD4 A;  3QO3 A;  5C6S A;  1VQ5 A;  2HD0 A;  3ASK A;  2E41 A;  3OMG A;  3EFS A;  3G7Z A;  5L8R E;  1DJ7 B;  4A4K A;  4NL3 A;  3CC4 A;  3J80 E;  3INZ A;  1Y96 A;  3DLL A;  1N27 A;  2QQA A;  1G5V A;  1VQ5 T;  4C5H A;  4N0A C;  1QP2 A;  3M5A A;  3X25 B;  4A4G A;  4C8Q G;  3DKM A;  4F7U A;  1WQ7 A;  3GP8 A;  3LLR A;  2RJE A;  4C5G A;  1Q81 U;  1VQ8 A;  3SFM A;  5LJ5 h;  1YCY A;  5CR2 A;  1JBM A;  4C0Z A;  3JB9 I;  1N8R C;  1VIF A;  3NTK A;  4A53 A;  5D6W A;  4BUG A;  4PJO D;  1ZHI A;  3JCM W;  3SD4 A;  5LJ5 d;  4JLG A;  2HBP A;  3OA6 A;  5LJ3 f;  2E6Z A;  3CCM T;  1UGP B;  4ZTJ A;  1N9S A;  1ZQ1 A;  1OZ3 A;  2IG0 A;  4L5G A;  3OYA A;  2X4W A;  4KUD K;  4M7A A;  1YJ9 A;  3CCL A;  5GAN h;  2XID A;  2RHX A;  2F69 A;  5CQY A;  4E7H A;  2QQ9 A;  4Q5W A;  3OS0 A;  2HQE A;  1NJI U;  2D0Q B;  4DOW A;  3VUZ A;  5GAO m;  1KHC A;  3KUF A;  3MEW A;  4EPC A;  2YLB A;  3QHS A;  4X9D A;  3PNW C;  3SWN A;  2CZ1 B;  5FU6 C;  4L6V 5;  3SWN C;  2G3R A;  3M4G A;  4II1 A;  5EG2 A;  5GAN d;  3CCR A;  1K73 U;  2DIG A;  2KY9 A;  1H3Z A;  2PUK B;  1I8F A;  3R6O A;  5A0G A;  4QVD A;  1X01 A;  3MO8 A;  2LCL A;  3VKI A;  2EWN A;  1V29 B;  3KBG A;  3T9N A;  2JVV A;  3RMQ A;  2V8J A;  3OS1 A;  4F7U F;  1VQK A;  1JJ2 S;  4X9C A;  5GAN 8;  2E10 A;  3MP1 A;  3HL8 A;  3OSS C;  2YLC A;  3ER0 A;  2OTJ T;  1B34 B;  4BDY A;  5GAO n;  3I55 A;  4XTV A;  3OYY A;  1W2B S;  4BB7 A;  4BAC A;  3HKS A;  3OMC A;  5FLX E;  4LDU A;  2JN0 A;  2KDS A;  3MEA A;  3M55 A;  3HFO A;  1VQO T;  4QQG A;  5HY6 A;  4PJO A;  4V2S A;  2B8A A;  4E7J A;  4M7D E;  3JCM f;  1Q82 U;  4O6J A;  3WVD B;  1BI3 A;  2X35 A;  3A8L B;  2DXB A;  4M78 C;  4OB2 B;  3J81 E;  2RI5 A;  2RO0 A;  1QVP A;  2XG8 D;  3QG1 A;  2P0K A;  1WJQ A;  4J6W A;  4OMF B;  4PKC C;  4HA8 A;  4OGE A;  2ZPE B;  4XU1 A;  5DM7 R;  4LDW A;  4E7L A;  2QQR A;  2PVD B;  4FSX A;  4C0D C;  4E47 A;  1QP3 A;  3CMA A;  3RMS A;  1VQ9 A;  2NLU A;  2EJG A;  5HK0 A;  2VGN A;  2K3Y A;  2EQM A;  2JUF A;  2K5L A;  4D6W A;  3V8L A;  3GPL A;  5I2M A;  1VQ7 A;  1U1T A;  1NJI C;  1M90 U;  4GY5 A;  2K3X A;  4BE2 A;  4RMO A;  4M7D C;  3LGL A;  4PJO G;  3A8M B;  3LWI A;  4JDS A;  5GAN 6;  2XU8 A;  1XQH A;  3CCS T;  4ATO A;  3QBY A;  5DY9 A;  4BI3 A;  3X24 B;  1I5L A;  3HRT A;  1VQN T;  4N4H A;  2A3L A;  3A8H B;  1M1K U;  4HT8 A;  5GAO r;  5GAM h;  2LX9 A;  1YJW A;  2DAQ A;  1OI1 A;  2KSS A;  5GAM j;  2H3J A;  5GMK i;  3UDC A;  3NTI A;  3BDU A;  2K57 A;  4LDV A;  3X28 B;  4Y28 E;  3RER A;  2FVU A;  3TCJ A;  2JNG A;  3NFC A;  4M77 B;  5KH6 A;  3CC2 T;  4MDW A;  4J5Y A;  2CGH A;  4C92 C;  4ELZ C;  3MP6 A;  3OYF A;  5LJ3 g;  2JTF A;  3E19 A;  4IUV A;  1YIJ A;  3JCM c;  4PNO A;  2LRQ A;  2L5Q A;  2DEQ A;  1LOJ A;  2E70 A;  2VGM A;  3CBM A;  3FJP A;  4M78 D;  2RHI A;  2PU9 B;  3VU3 C;  3CCE A;  1G3T A;  3ZBD A;  4PJO C;  1WNL A;  3TRE A;  1VQ6 T;  2KVQ G;  3M58 A;  1RL2 A;  1Q7Y C;  4HT9 A;  2JOY A;  3V8J A;  3FEO A;  4A4F A;  1YJ9 T;  2DD5 A;  4Z02 A;  4ZGJ B;  1N6A A;  3OYI A;  4XU0 A;  4TVR A;  3G6E T;  4PJO B;  3QJ6 A;  1U1S A;  3CPW A;  3JCM Q;  2RM4 A;  3QXE B;  2D6F A;  3S3N A;  3M53 A;  2RHZ A;  1MGQ A;  3HSB A;  2LC4 A;  5IT9 E;  2WSC E;  3CCM A;  3M9Q A;  3MCA B;  1U8R A;  2QEX T;  4PLI A;  1KQ1 A;  2VV5 A;  5FU6 B;  3FRN A;  3GLX A;  1YHQ A;  4C92 G;  4M7D A;  4BY6 C;  4M77 D;  4NL2 A;  1BIA A;  3EFR A;  4XTX A;  3CCV A;  3QII A;  1X75 C;  1VQ9 T;  4WF2 A;  2GFU A;  1VQ4 T;  5CCA A;  3RKX A;  2QEX A;  3X26 B;  5C0M A;  3CCU T;  5GAN g;  4JRK A;  2RK2 A;  1WJR A;  2CKK A;  5CQX A;  4XQ3 A;  3I56 T;  4M7A G;  2EAY A;  3LH0 A;  4VUB A;  5GMK h;  3L2R A;  3QUI A;  4MZT A;  2M0O A;  4N0A A;  3CCL T;  2K4Y A;  4JJN K;  2RA2 A;  2RHU A;  3G4S T;  3ZEH A;  2E1H A;  1JB0 E;  4XTZ A;  1N8R U;  3ME9 A;  4M75 B;  2DXC A;  4QVZ A;  4O5V A;  3OYC A;  3MEU A;  3OYM A;  2DO3 A;  4C92 D;  1Q81 C;  1QVF A;  2GQV A;  2KQW A;  4IUQ A;  4EMK C;  2XHC A;  2I2L A;  5J3B A;  4A54 A;  4JRQ A;  3EAE A;  1KD1 C;  4J7I A;  4BE0 A;  4BE1 A;  3OYE A;  4RCB A;  1W2B A;  2A7Y A;  2QI2 A;  4ME7 A;  5GAN e;  2RI2 A;  3QYG B;  3L2V A;  2LT1 A;  1FXX A;  3CD6 T;  2EFI A;  4XK8 E;  2R58 A;  1NZ9 A;  2ZZD A;  1KD1 U;  5I21 A;  1UGQ B;  1Y07 A;  1NE8 A;  1VQL T;  2WAC A;  1GXI E;  1YI2 A;  2CS7 A;  4M78 B;  1KHI A;  3JB9 D;  4IUP A;  3CPW S;  1N9R A;  3TU4 K;  1UGS B;  1M1G A;  2FYK A;  3PMT A;  4MDX A;  5CKF A;  1K73 C;  1M1K C;  3CEY A;  5LJ3 e;  1AHJ B;  2O4X B;  3N5B B;  2CZ7 B;  3JB9 G;  4RG2 A;  1NPP A;  2K5I A;  4C0D B;  4C92 A;  5GAN 3;  3G71 A;  2OTL A;  3CMA T;  3OYG A;  2DKG A;  1YIT T;  1G3W A;  1VQK T;  2DVE A;  3LYI A;  1YJN A;  3CCS A;  4M75 D;  3ZFJ A;  4C0G A;  2MF2 A;  2P4T A;  4EDU A;  3G71 T;  1BIB A;  1KQS A;  1M90 C;  2K5F A;  2EJ9 A;  4E7K A;  2LT4 A;  1YIJ T;  4M77 G;  5IN1 A;  5FU7 C;  5DLQ E;  1KC8 C;  4XTU A;  2Y4Y A;  1M9S A;  4CI0 C;  1WGS A;  3BW1 A;  1BI0 A;  2GCX A;  4IUU A;  4M78 G;  5CVI A;  2D9T A;  3PTA A;  1O9S A;  2FHD A;  3MEV A;  4EMK B;  5A0D A;  3J7A F;  4YTL A;  4ZGE B;  3OS2 A;  2PVO B;  3L1A A;  2DTH A;  1YBY A;  3H8Z A;  1K8A C;  1K9M C;  2Y4X A;  5CO7 A;  4M7A E;  2Y90 A;  3LGF A;  2EJF A;  3TEE A;  3CC7 T;  3S6W A;  5GAN 2;  2X4Y A;  2YHT A;  3VV0 A;  5CK9 A;  3H6Z A;  3CC2 A;  4ZGD B;  5GAN 4;  1I4K 1;  1G3Y A;  4NOY A;  3OYK A;  2XK0 A;  3FB9 A;  1Q82 C;  2DXU A;  4C92 B;  3A8G B;  4OB1 B;  2R5M A;  1SSF A;  3GNF B;  2EQK A;  5A2Q E;  3URG A;  2R5A A;  1RI0 A;  3SB2 A;  5FRO A;  2CYZ B;  4IUR A;  5GAN f;  4OGC A;  4DQ2 A;  3CXC S;  1S72 A;  2K2V A;  3CC4 T;  4PJO F;  2LCC A;  2ZPH B;  1VQP T;  1VQ6 A;  3WXM B;  1EIF A;  2XIC A;  3I56 A;  4B9X A;  2VXE A;  3SDZ A;  3PGG A;  1M5Q 1;  5FU7 B;  3GNG A;  4FM4 B;  1M1F A;  3JCM b;  3OYH A;  3CCR T;  3JCM h;  4IKF A;  2OTJ A;  2VC8 A;  5D6Y A;  3OS5 A;  5D6X A;  2FB7 A;  2FL7 A;  3JCM g;  4F7U E;  3CCJ A;  2QQB A;  3AHU A;  3CCQ A;  2RHY A;  1KQS S;  4A4E A;  2BUD A;  3OW2 A;  1W4S A;  3OB9 A;  3PT9 A;  1NPR A;  3Q1J A;  5CKB A;  4M7A C;  3QSU A;  3CCQ T;  4M77 C;  3JB9 J;  3OY9 A;  1Y7X A;  2DZ9 A;  2KMT A;  2QDY B;  3QZ9 B;  3L2Q A;  4GLK A;  4JLI A;  3CCE T;  3X20 B;  2MMP A;  2XDB A;  1B34 A;  5KCH A;  2QXF A;  1VQ8 T;  3CD6 A;  3E1S A;  3L42 A;  3RKY A;  2DTO A;  2EQU A;  2E12 A;  3JCM V;  2QA4 T;  3P8B B;  4OB3 B;  2ZGW A;  4BD3 A;  3JCM e;  1O75 A;  4F7U G;  3FLG A;  5CAI A;  1PSE A;  2EQJ A;  4DOV A;  1JJ2 A;  4C8Q A;  3V7S A;  2QA4 A;  1TH7 A;  2WSF E;  2E64 A;  2F5T X;  3V7C A;  1Q86 U;  1Q86 C;  2M16 A;  1KQ2 A;  3OBY A;  2HAX A;  1M4Z A;  3OYJ A;  2DPP B;  2ZPG B;  2GF7 A;  3E9G A;  1BI1 A;  1WQW A;  2CZ0 B;  3MP8 A;  2P0P A;  2DJZ A;  2O4X A;  4JUV A;  4JRP A;  3OYN A;  1QVF S;  1XOV A;  4M75 C;  3O8V A;  2PUO B;  3OSV A;  3CCU A;  3JCM X;  4DA4 A;  2RJF A;  3SWN B;  2PQW A;  1K8A U;  3JB9 H;  1Y71 A;  4XU2 A;  2ZPI B;  2L89 A;  5LJ3 h;  5FRN A;  1VQM A;  1M8V A;  1VQ7 T;  2LNV A;  2MAM A;  3BFM A;  3CBP A;  5J39 A;  3P8D A;  2HNI A;  2CZ6 B;  1BKB A;  5LJ3 j;  4BY6 B;  3M57 A;  3DLM A;  4J6Y A;  4EMK A;  4R56 A;  4XTY A;  4C8Q F;  2O01 E;  1MHN A;  2V8K A;  3QZ5 B;  4FT2 A;  3CC7 A;  2JTM A;  3RUX A;  3MHX A;  4LDX A;  4KUL A;  1LNX A;  3C4S A;  4PLL A;  2ZPB B;  4L59 A;  5GAO l;  5I2S A;  2JZ2 A;  5CKE A;  2MWP A;  1JRI A;  2KK4 A;  2L8D A;  4C8Q D;  3C95 A;  3RES A;  5CKH A;  5KE2 A;  2C06 A;  4ZTF A;  2DTI A;  5FRM A;  4LD9 K;  4QQ6 A;  2XKO C;  4N4I A;  3GIB A;  5GAM e;  5HK3 A;  1HXD A;  2MWO A;  5GAN 7;  4HCC A;  4XTW A;  3BDL A;  2M9U A;  3FC3 A;  3QYH B;  2BKD N;  4OVA A;  4C5E A;  4M78 F;  4RCC A;  5LL6 S;  3CPF A;  4PL6 A;  4M78 E;  3VYG A;  3JCM J;  4HCZ A;  3GF5 A;  4OB0 B;  1OZ2 A;  3HPW A;  5LJ5 g;  2OTL T;  3DB4 A;  4ZN1 A;  1P92 A;  2LDM A;  2QTX A;  2R57 A;  2YRV A;  3M54 A;  4M75 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...