2PVOB

Crystal srtucture of the ternary complex between thioredoxin f, ferredoxin, and ferredoxin: thioredoxin reductase
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
74
structure length
74
Chain Sequence
MNVGDRVRVTSSVVVYHHPEHKKTAFDLQGMEGEVAAVLTEWQGRPISANLPVLVKFEQRFKAHFRPDEVTLIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural snapshots along the reaction pathway of ferredoxin-thioredoxin reductase.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Electron transport
molecule keywords Ferredoxin-thioredoxin reductase, catalytic chain
total genus 11
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02941 FeThRed_A Ferredoxin thioredoxin reductase variable alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2pvoB00
2PU9B 3X28B 3X20B 3WVEB 3WVDB 3A8MB 1QP2A 2DD5A 2WSEE 1UGSB 2QDYB 1IREB 1UGPB 2D0QB 2PVDB 2WSCE 2ZZDA 3A8OB 4FM4B 4OB1B 4KT0E 4OB3B 3VYHB 1GXIE 2DD4A 4OB2B 2PVOB 3LW5E 2CZ7B 4ZGEB 2PUKB 4XK8E 3VYGA 2PVGB 1PSFA 2CZ6B 4Y28E 2O01E 3X26B 1QP3A 1UGRB 2DXBA 4L6V5 2CZ1B 4ZGJB 2CZ0B 2ZPFB 3A8HB 3A8LB 4RKUE 2ZPEB 1UGQB 2ZPHB 4OB0B 5L8RE 2ZPIB 2DPPB 2ZPGB 2CYZB 2PUOB 2ZPBB 2DXCA 2WSFE 3QXEB 3X24B 1PSEA 1JB0E 3X25B 4ZGDB 2AHJB 3HHTB 3QYGB 3A8GB 3QZ5B 1V29B 1DJ7B 3QYHB 1AHJB 2ZCFB 3QZ9B
chains in the Genus database with same CATH superfamily
2CP7A 1FXXA 3THKA 3CCMQ 3LGFA 3CCRQ 2KYBA 2IIMA 2RF0A 4F7UG 4OB2B 3CQTA 3CCUT 4BDYA 2HQEA 2F5KA 4XTZA 3OBYA 4L6V5 4R0KA 3GNFB 4J9IA 1SSFA 4PJOA 3CMAA 3H0FA 4J7IA 5KCOA 1PCXA 1AT1B 1VQ5A 2HSEB 2X4JA 2GGRA 1Y71A 3M56A 3QWXX 2FPDA 2DF6A 4M75B 2RJDA 2DETA 2KNBB 1KG1A 4IUPA 4ME7A 4M7DA 3CCJQ 1UGRB 5GAOq 3A8HB 1I4K1 1IHVA 5L8RE 4PNOA 3Q1JA 1PRMC 2OTLQ 4RCBA 2LNVA 2CT4A 3PMIA 1QKWA 2E10A 1OU8A 2CP6A 3X28B 4FW2A 2X4XA 3JB9I 4OB3B 1OI1A 2QQAA 4LDVA 4JRQA 5CKDA 2MK5A 2BZXA 2DM1A 2GQIA 5KYWA 2K5IA 1HD3A 4O5VA 2K57A 4RTYA 2JMAA 3FC3A 3TU4K 2KR3A 3SD4A 3V8LA 2J7IA 1SG5A 2DXTA 5FU6B 1N8RC 3JRZA 3NTHA 1H641 3SB2A 3RMQA 2O9SA 4QVZA 1QCFA 1TWBA 3QG1A 4LDXA 3RESA 1HJDA 3KUFA 5I2SA 5FRMA 2AZVA 2FZGB 5HY6A 3BDUA 2LDMA 1VQPA 3OA6A 1ZA2B 1NEBA 5A0LA 2L3RA 1JBMA 4CC7A 3OYLA 4OMOA 3G4ST 5LL6S 1AVZC 5IT9E 2YLCA 3VS2A 1OV3A 1WYXA 5GAMj 2PVDB 2DTIA 1ZA1B 3RDVA 3CCEQ 2MPXC 2DYBA 1LJOA 1BI3A 3OYIA 1K73R 3DKMA 2V8KA 3URGA 5HKCA 1EZZB 3EGXB 4J6XA 4VUBA 3EFSA 3VS0A 3CCRT 3OY9A 3QHSA 4PKCC 1QVFP 5IHKA 3CCET 4JPBW 2HCKA 1I5LA 1M3CA 4LD9K 3UPUA 3I56A 2RQUA 2CP2A 3HHTB 1YITT 2EJFA 4RTTA 3T9NA 2HQXA 1IXDA 2XHCA 5I2MA 1H8KA 2DD4A 5CAIA 2RHXA 5GANg 2EGCA 2EKOA 3TSWA 2O01E 4R55A 1Q7YC 4AFQC 3JB9D 2G3RA 2ZPIB 3M53A 1T3SA 4DQ2A 1TTHB 4M7AA 2FZCB 4M7DE 1GCQC 2P0KA 4EDUA 3N5BB 3MHXA 3VV0A 1RADB 2QG9B 3CMAQ 3M4YA 4AFSC 2JT4A 4A63B 1U3OA 1OULA 3JAME 4C92D 3QDFA 4F7UB 2M0YA 4A4FA 1RLPC 3OS2A 3REBB 3CCQT 3OMCA 4L5GA 2JMCA 4PFZA 1I81A 5KYYA 1V29B 2JN0A 2KQWA 3OQ5A 3M0PA 2YHTA 4OGEA 3HTRA 3FDRA 1Q95G 4FYXB 4BUGA 2QEXA 4MZPA 4XTXA 2A37A 2PUKB 3HKSA 2VB6A 3CPFA 1WHKA 2KXCA 1VQ6A 2HSPA 1M1KU 3DB4A 4M78D 8ATCB 3LGLA 2DL7A 4M7AG 2QA4T 4M7DC 3ULRB 4ESRA 3G4SA 1IZ6A 4OMMA 2RM4A 3CBOA 3H0IA 3QSUA 1KD1R 4C8QE 1Y07A 3CCUQ 2ESWA 2MOXA 4C92C 2X3WD 3EGXA 1YHQT 1M8MA 1WX6A 3CMEA 2K6DA 4CC4B 1KQ1A 4II1A 4XTVA 3G71A 2A28A 1TUDA 3MKDA 4J9FA 4FL6A 1R0BG 3E9FA 1G2BA 2A3LA 1DJ7B 1YITQ 3E2UA 1AWJA 4QQGA 4A4HA 2YUOA 2CP0A 1AWWA 2HBPA 2L3QA 1VQPQ 2M9UA 4AMCA 3HP9A 5DLOA 4N4IA 5GANf 1D09B 2ZPFB 2GQVA 1Z9QA 2EQIA 1Q7YR 1Q86R 1NJIC 5KE3A 2JVVA 3KBGA 5GMKj 4X9CA 2BKDN 5KCHA 1VQ5Q 1WDXA 4XU0A 2O4XA 2FO0A 4J9BA 2A36A 1PRLC 1XNIA 1VYVA 2JS2A 1I5OB 1GFDA 4XTYA 1YCSB 1G3YA 1WXBA 4HT9A 2NWMA 3L2WA 2DPPB 1PD0A 1AZEA 3JB9H 3CC2Q 2LZ6B 4NL3A 3M59A 4C8QG 1S72T 3O5ZA 1VQLQ 4Y91A 1W6XA 3CBMA 1IREB 4FT4A 1D3BB 4MDXA 1PKSA 4Y28E 2L89A 4FIBA 2HL3A 1VQKT 4PLIA 2KRNA 2OI3A 2DXCA 1RL2A 1S72Q 4HT8A 2OTLT 1YJNQ 3CPWS 2E5QA 4M75C 4XU2A 4Z02A 3G71T 1WHLA 4XQ3A 2RPNA 3JCMd 1Q82R 1KSWA 4JRKA 4KGZB 2RH2A 4EMGA 3I35A 1X75C 2VGMA 3EGDB 3QXEB 2XDPA 2XD0A 2KMTA 3A98A 1M8VA 4AG1C 5DY9A 1VQLT 4KH0B 4XU1A 2GFAA 2RA2A 1BB9A 2LRQA 1WJRA 1OPLA 2DIGA 2KGTA 1K9AA 3NTKA 3VYGA 5CIUA 3C95A 4QKUA 2DE0X 1N9SA 2JUFA 3PIPA 1NJIR 5FRNA 2FRWA 5GANe 1X6OA 4DBQA 1FWZA 1RI9A 3JB9G 4F7UE 1VIEA 1VQMQ 4F7UF 3CCVA 2HD0A 4OMNA 3MEWA 5I11A 4FYYB 3RNJA 1WI7A 3P8HA 3R6NA 1BK2A 1YHQQ 2LP5A 1K4US 1XJWB 5LJ3g 1UGQB 3LLRA 3SWNA 4FCYA 3M0UA 3ZL7C 1JB0E 1SSHA 3CCST 4J7FA 2ED0A 4MZTA 4OP0A 3PGGA 2GTOA 2COWA 2RQWA 3PNWC 5A0DA 3CCVQ 1RABB 3EG2A 2L5QA 1JU5C 5LJ5h 4C0DB 2G6FX 1QCNA 2OAWA 2YT6A 3I56T 5GJVB 1FX7A 1F1BB 2DMOA 2LTOA 2VYTA 2XMFA 4F14A 3OW2P 2HDAA 1ARKA 3ZFJA 4DBFA 2CZ7B 4C0ZA 1B3QA 2PVGB 3CCEA 2CZ0B 2DERA 3I56Q 1OPKA 2MCNA 4J9DA 1VQKQ 3HRTA 1Y57A 5LJ5f 5GMKl 2L0AA 1X6GA 2NUZA 3OS5A 1VQNT 1IRXA 2PNIA 2XDBA 1ACMB 4J9EA 1YJNT 1VQ7Q 1SHGA 2MF2A 5EC7A 3PTAA 2M1HA 3E1SA 3JCMP 3D7SB 1M4ZA 2CZ1B 2PTKA 2X4YA 4J83A 2RO0A 4E7KA 4BI8B 1R0CB 1WNLA 2XK0A 2K9GA 4BI3A 5CKEA 1U5SA 3C4SA 1N6AA 2QASA 4IUUA 2EIFA 2W0ZA 3GBQA 1VQ8A 3M0TA 1KC8R 2XG8D 2R58A 4C92E 3GIBA 2YLBA 5GMKi 2YSQA 4M75A 5GAOp 3CCSA 1W1FA 4DBHA 2Y90A 5CKHA 3CCSQ 4EPCA 4PJOG 5FU7B 1D1CA 2DD5A 2M0OA 4JLGA 3CCVT 2I2LA 2D9TA 4PJOE 1VQ8Q 1BIBA 2COYA 2VKNA 4E7JA 2EGEA 2Y4XA 1VQ4T 1YJ9T 4EMHA 3NHNA 4HCCA 1SRMA 3TEEA 1EX4A 2QDLA 2JM9A 4C92G 4N4HA 3VKIA 2KE9A 1KJWA 4WCIA 4C5EA 5GANh 1AZGB 2FEIA 4GY5A 1NYFA 3O8VA 4XTUA 2GFUA 4CI0C 1JXMA 4GBQA 2EQMA 2LJ1A 1Q7YU 4BY6B 3CBPA 2BTTA 2M16A 1JQQA 2DX1A 4NL2A 3VS4A 1VOMA 1G3TA 1MNEA 1I8FA 1GCPA 5LJ3e 3CPWA 4M7DB 3CXCS 1UE9A 1OU9A 2KROA 3CPWP 1R77A 5D6XA 2D0NA 1TH7A 1HYOA 2VXEA 4DOWA 2BE9B 4PJLA 2RB6A 4AT1B 4JRIA 3OYKA 3OYNA 3EFOA 3L2ZA 2KK4A 4JRPA 4M78F 1GBQA 1M3BA 4DEXA 1YWPA 2DBMA 3VRZA 4JUVA 4M78E 4XU3A 3JCMV 2AT1B 3VS1A 2RHYA 3MP1A 1NG2A 4QQ6A 1VQ4A 3EFRA 1YJ9A 1BCMA 1QP2A 3QWYA 2ATCB 1X2KA 4OB1B 2QGGA 3HFOA 4HVUA 4C5GA 5J39A 1O9SA 4PJNA 4B6MA 1VQ7A 3SDZA 2BUDA 1UUEA 3CCQQ 1VYUA 2QQSA 2NLUA 1AWOA 3CC2A 4KUDK 3HRUA 1TSFA 1OYXA 2NUTA 3FJ5A 3JCMc 1YHQA 1GCQA 2F2XA 3JB9F 1TUCA 2DBKA 1VQOA 1UHFA 3E19A 4GLKA 4KGXB 1M2VA 1MMNA 2KRSA 4WF2A 4CRIA 1NJIU 3RIRA 2EYYA 2E5KA 3FIFA 5GAN4 1D0ZA 1IGUA 2R5AA 3EGDA 4F17A 1Q82C 2AZSA 2YUQA 3A8LB 2A0FB 3LH0A 4HKEA 3RKYA 5IXFA 5LJ5d 2QXFA 5FLXE 2LJ3A 3QIIA 1AEYA 3M0RA 2KYMA 3UATA 1G8XA 3SHWA 3REAB 1ZSZA 1YJWQ 2K5LA 3DLLA 1UGPB 3QJYA 1VQKA 2RHIA 3CCQA 1SRLA 2WACA 4IIOA 2X4WA 4PJMA 2RJCA 4M7AB 2C0TA 1W4SA 1TS9A 1ZBXA 3JSCA 3G7ZA 1QVFS 4P5NA 2ZPHB 1TOVA 4X1VA 2EPDA 1VQ6T 1XTDA 3WVEB 3BDLA 1M1GA 5GAMf 1YJWA 1YIJT 4IUQA 4RTVA 1OOTA 5KYUA 1UB4A 3MEAA 1Y96B 4ZNXA 3PMTA 1JJ2P 3UA6A 3L2UA 1ZUYA 3I9QA 1QCOA 4ORZA 4JJNK 2J6FA 2RMOA 4JS4A 3CCLT 5IN1A 4DA4A 1VQLA 5HK3A 2YRDA 5GAOn 5IH2A 1JEGA 3LWIA 2K3YA 2FG0A 2GBQA 4X9DA 4J9GA 2P4RA 2JNGA 2QTXA 4KGVB 3M0QA 2KAFA 4RG8A 4M7AC 1M90R 2YUPA 2LQ8A 2DK3A 2QQ9A 4M77A 1FMWA 4FU6A 4HVVA 3RERA 4KULA 4RMOA 2RI2A 4HXJA 3G6ET 4PL6A 1X01A 5CR2A 1EFNA 3G6EA 2E3HA 1MHNA 2I0NA 5LJ5j 5IXBA 2EJGA 1B7TA 2P4TA 2JTFA 4C0GA 4KT0E 2DILA 2LQWA 1KIKA 3CMET 4DOVA 1K0SA 4B9WA 5C6SA 2CS7A 4ZTFA 2MMPA 2A7YA 3BE3A 3J80E 3EHQA 3CCJT 2D8JA 2EFIA 2K2VA 5FU6C 4M75D 2JZ2A 5CVIA 3TSZA 4E7ZA 4E7SA 2CKKA 2EGAA 1NPRA 1VQ9A 2VC8A 3VYHB 4AFUC 2DIQA 5DM7R 1MUZA 3BFMA 1D1AA 3M55A 4QT7A 4M7AE 1R8OB 1YCYA 4M77D 2EVRA 4M7AF 2ROLA 1W2BP 1G3WA 1YNZA 5GAN2 3TCJA 4ZGDB 1C6VX 2OJ2A 4RTZA 4PFPA 3I55T 2C06A 2XICA 4LE9A 2EYQA 5CKFA 1NM7A 4C8QC 2MIOA 3AT1B 1JJ2S 1OX8A 3MEVA 1B34A 2VGNA 1WQ7A 4LDYA 3JB9J 5GANd 1NZ9A 1RAEB 1BYMA 2HKQB 2R57A 4QQDA 3QZ5B 5EG2A 1VQNA 1ZHIA 5GMKh 2K3XA 3BW1A 4IUTA 1YIJQ 1VQNQ 3OBWA 2IG0A 1QVPA 2HMAA 2F5TX 1UDLA 2ED1A 3JCMf 1KD1C 4JDSA 1XOVA 3GPLA 3MP6A 3FJPA 1E7OA 1ZSZC 2GCXA 2O4XB 2RN8A 3NTIA 4OB0B 4M78C 1MNDA 3L2VA 3HSBA 5I21A 4FT2A 4K11A 3OMGA 3QYHB 2KRMA 2PU9B 2DA9A 3H41A 2OTJT 1UFFA 1OX9A 2CGHA 2LT4A 3FEOA 1UECA 5GAOr 1MV0B 2DJZA 3KXTA 2J05A 1GXIE 3HL8A 5AT1B 3QDRB 4B9XA 1PNJA 2HL5C 3SEMA 3V7RA 4BD3A 2PQWA 4ELYC 2LVMA 2V8JA 3ZEHA 1QP3A 2AIRB 1PWTA 2H3JA 1RLQC 3BY7A 5FW9A 4PJOD 1WHGA 5GAMe 4C8QF 2K7AA 1NLOC 3QZ9B 2FRYA 3CC4A 3EG9B 1SF9A 1Z9ZA 4HCZA 5KYNA 2FYKA 4N0AC 3META 2RJFA 3RR6A 2LX7A 5D6YA 1BU1A 2PZ1A 2EQJA 1KC8U 3FLGA 2OX7A 5FWCA 4PFOA 4FW1A 1BIAA 5FROA 5HCKA 3A8GB 1I0CA 3EHRA 1M9SA 5GAN6 2M51A 3GP8A 1WIEA 3VS7A 3OYMA 1WZOA 1IGQA 2EYZA 3V8KA 1V1CA 4BI4A 4LDUA 1Q81R 2XKOC 2ABLA 2KSSA 1Q86C 4OF1A 1LCKA 3VUBA 2RNAA 2YRCA 2CP3A 4C0DC 3M58A 1M3AA 4OMPA 5D7UA 3PIOA 4JLIA 2EJ9A 4FM4B 3MEUA 1WXUA 2X9HA 1C1AA 5GMKm 5GMKe 2MWPA 2FHDA 4ZN3A 1T3LA 2J06A 2BZYA 4RTUA 1TUGB 1SPKA 1N9RA 3GLXA 4PJOB 5M9OA 3NGPA 2JTMA 2O2OA 3P8DA 3F70A 3EG0A 3KFVA 1NYGA 1BI1A 3EG1A 2E65A 2JS0A 3H8ZA 5C0MA 5KYXA 4BE1A 3UT1A 5CQXA 1KQ2A 3LW5E 1X69A 1ABOA 1K9MC 2E6ZA 1X43A 2JW4A 1M1KR 3J7AF 2O9VA 4M78B 3PE0A 1MMDA 1VQ5T 2DRMA 4V2SA 5A0GA 3SWNC 3HPWA 3EG9A 2Y4YA 4J5YA 4AFZC 3SWNB 4ATOA 3CCUA 4C5HA 3NMZC 3CEYA 1WFWA 1WA7A 1PD1A 4PLLA 4N4GA 3RUXA 5KE2A 1M5Q1 1VIFA 2QTVA 3OYEA 4D8KA 1M90U 1K9MU 3CC2T 3H9NA 3MJXA 5CK9A 4M7DG 3AHUA 2CREA 1KD1U 4ZN1A 1RAFB 4A54A 1RAAB 3OSSC 1M2VB 4E7IA 4MMLA 4J9HA 4OMFB 2KVQG 2LQKA 2L3PA 1VQOT 3JV3A 3RKXA 4EMKB 2YDLA 3EAEA 2CUDA 2QGFB 2GNCA 3OS0A 4RTXA 1VQ8T 1H3HA 5GAMg 2RQVA 2P84A 3JCMb 3QBYA 2EW3A 1M90C 2E3IA 3NPFA 3VJPA 2CH4W 3OYFA 1U06A 3JCMg 4R56A 1WJQA 1UHCA 2V8IA 2DKGA 2VUBA 3HRSA 2DVJA 1PSEA 3X25B 1PM3A 5GAN8 2O88A 2LX9A 1VQMT 2K4YA 1AHJB 1QMCA 1B07A 2M02A 5I22A 1I1JA 5KYXB 2E4HA 2BE7D 1MGQA 1NBEB 4J6WA 3P8BB 4E47A 1ZBJA 2AKKA 3CC7T 1Q81U 2QEXT 1M1KC 1TU0B 3L2QA 1KQSP 1ZX6A 3VS3A 1X27A 3CXCA 4M75G 2D6FA 1GBRA 1UJYA 2DL5A 5J3BA 1JO8A 1OZ2A 4IURA 1VQMA 1MV3A 1K8AC 1PHTA 4JJBA 4RTWA 1U1SA 4J8OA 1N5ZA 2P0PA 1YJNA 3MPUB 2VXFA 2KEAA 2H8HA 3VUZA 1SHFA 5CO7A 2DNUA 3UF4A 4QVDA 4M75E 5CCAA 4WTOB 2HNIA 5KYUB 1HK9A 2B8AA 3EGUA 1QKXA 3CCMA 4LDWA 1QLYA 5LJ3h 1Q82U 4FYVB 3S3OA 1VQ9T 1S1NA 2F2WA 4M4ZA 3VU3C 3OW2A 2CP5A 1MMGA 4Z8AA 5GAOm 1KC8C 5KYYB 1TG0A 1UGVA 3CMEQ 2K3BA 1ZSGA 2CUBA 2DXBA 1Q86U 4MDWA 3G6EQ 3OB9A 3I5RA 2E1HA 3M5AA 5GJWB 1NPPA 1OEBA 4EMKC 1XQHA 4LNPA 2KXDA 2BZ8A 4JS5A 4EIKA 2E41A 2EYXA 2DAQA 2LT1A 2HAXA 1KQSA 2L3SA 4PJJA 3ASKA 2XU8A 2LMJA 1YITA 2XI9A 1AWXA 1HXDA 4BY6C 3OSVA 1D0XA 2DYIA 2BIVA 2YXYA 1E6GA 3NFCA 3TREA 5KH6A 2QA4Q 5DLQE 2FL7A 2JOYA 3I5SA 3J81E 2AK5A 2D8HA 1LOJA 2VV5A 4M7DF 2VASA 5FU7C 4C0FA 1K8AR 1ZQ1A 2ZAEA 1VA7A 2DTHA 5GAN7 1K1ZA 2DZCA 2R5MA 2C0IA 3SFMA 3G4SQ 2LJ0A 2DJQA 3DB3A 4QVCA 2JJ9A 5KYWB 1QWFA 2MWOA 1BKBA 4M78G 4QW2A 3CC4Q 2GF7A 4BB7A 3S3MA 3INZA 3S6WA 1Q81C 2KBTA 4LN2A 1HSQA 4DBRA 3OYHA 2E12A 4JJDA 3CCLA 1VUBA 4CC3A 1QVGP 3CCLQ 3I55Q 5GANj 3WXMB 2ZCFB 3V8JA 3X20B 1YFNA 4X34A 1OZ3A 2E64A 1QVGS 5LJ3d 2RJEA 3M0SA 4M77B 4BE2A 1YJWT 2PVOB 3ER0A 5LJ3j 2EWNA 1KHIA 2LNHB 4IUVA 3EH1A 1LNXA 4RCCA 2CH4A 3QYGB 4M7DD 1S72A 3L1AA 3MO8A 1QQJA 4M77G 1FMKA 3V7SA 4ZGJB 1K0XA 5D6WA 4ELZC 4C8QD 2OAUA 2XIDA 1YWOA 3RMSA 4M78A 4ZGEB 1K9MR 2HZYA 3DLMA 4HCKA 3OYYA 1JXOA 1N27A 4C8QA 1VQ9Q 5GAOl 3H6ZA 3PT9A 1H92A 4F04B 1KQSS 3OW2S 2MYSA 3LH5A 2KT8A 2MI6A 3L42A 2SRCA 4NS5A 1WHJA 2X35A 2X51A 2L8DA 4O6JA 1YP5A 1PC0A 2OTJA 1VQ7T 3H0HA 3EH2A 1RAIB 1E6HA 1WHMA 4XTWA 3EG3A 5LJ5g 2E70A 2FPEA 2LQNA 1QWEA 1G5VA 4AG2C 1SKUB 4RG2A 2RK2A 5GAMh 1WHHA 2P0QA 1SEMA 2F69A 3ME9A 1X2QA 1A0NB 1M30A 1ZUUA 4KRTA 4C92B 3GF5A 2V1QA 1WXTA 1QVFA 1YI2A 5CKBA 2CDTA 5AYFA 5IAYA 3FB9A 4PK4A 2GTJA 1UJ0A 2CSQA 4E6RA 1U1TA 1B34B 1AOJA 2V1RA 2FVUA 1RACB 1X6BA 4TVRA 2ZPBB 5LJ3f 2XDDA 2DVEA 2ROTA 2O31A 2IPOB 3C12A 4E7HA 2V26A 3VS5A 1WJSA 4Y92A 5IHNA 3GOXA 1CKAA 2QK0A 5A2QE 2WSCE 3S3NA 3M54A 2KY9A 2J6KA 2HQHA 3CC4T 1D3BA 1ZSZB 4FYWB 4M7AD 1T0JA 3G1JA 4YTLA 1NEGA 2FZKB 2NUTB 3QPHA 1K8AU 1P92A 1RUWA 3LWHA 2KDSA 3JCMJ 4LD6A 3A5ZB 1W2BS 1VQ6Q 4M75F 2K79A 3A8OB 4C5IA 4F16A 4Z88A 5HK0A 2AKLA 2W10A 2RI3A 3U23A 1G83A 1MMAA 3ZBDA 4JZ4A 1WGSA 1TXQA 3UWNA 4C8QB 2QEXQ 3CC7Q 4KBMB 3M57A 3OS1A 2Z0WA 1JRIA 4ANJA 1V76A 2JM8A 4PJOC 2LCSA 4BACA 1YN8A 1CKBA 3A1PA 1FMVA 2QQRA 1JJ2A 1J3TA 3OYDA 5LJ5e 4OGCA 1BBZA 2HBWA 2RHUA 4RKUE 2F1LA 2KI7A 2RK1A 2CYZB 3OYJA 1LPLA 2MAMA 1YI2T 2DTOA 5ECAA 4ZTJA 2E6NA 4N0AA 4HCBA 4GLMA 1KFZA 1WPYA 1YBYA 4HA8A 1ABQA 5CQYA 2EBPA 2QAZA 7AT1B 2EQUA 3I55A 4EMKA 2EKHA 3OYBA 2YWWA 2QA4A 2DL3A 2ENMA 1BI0A 4IIMA 4OVAA 4BDZA 3CCRA 2HEQA 3V7CA 4FSXA 2IVWA 2NYSA 2AHJB 2FB7A 3CCMT 1QW1A 3IQLA 2ECZA 4BE0A 4JZ3A 3LX7A 2QDYB 3E9GA 3UDCA 2HKNA 3CC7A 1D1BA 3C0CA 1PG5B 3OYAA 2LC4A 4A4EA 1ZUKA 2ZGWA 2D1XA 1QVGA 3TVTA 1UTIA 4HVWA 2EYWA 1K73C 2WSFE 1I07A 1CSKA 4A53A 4MZMA 1RAGB 2DZ9A 1N8RU 4MMKA 2L2PA 1RAHB 4LUDA 1O75A 2C0OA 4UC4A 5FWBA 3VS6A 9ATCB 4E2FB 2RHZA 1D0YA 8AT1B 2JXBA 1K76A 1Y96A 2OTLA 3M4GA 3MCAB 3PVQA 2VVKA 2QYZA 2K5FA 1OQKA 2RI5A 4LUEA 1H3ZA 2EAYA 5GAN5 4FSSA 2QI2A 3JCMQ 4M77C 1WLPB 2B86A 2EQKA 3QJ6A 1KHCA 1YJ9Q 1PSFA 2QQBA 1VYTA 1VQ4Q 1NE8A 2RD1A 3JCMh 2ZPEB 2DRKA 3QKJA 3OYCA 4IKFA 2LCCA 4C92F 1YI2Q 3GNGA 1WQWA 2RQRA 1M2OA 4C92A 1IB8A 3QO3A 1VQPT 1UGSB 4Z89A 1C0MA 1RI0A 1GRIA 2DFUA 1YIJA 2CSIA 1NLPC 4NOYA 1IO6A 3JCMX 2K2MA 2CZ6B 3C94A 4PJOF 4RUGA 3VRYA 2DL8A 4D8DA 3TQ7P 1PKTA 1KK7A 1GL5A 4D6WA 3WVDB 3A8MB 1AD5A 2DXUA 4M77E 3OYGA 4E7LA 2D0QB 1IHWA 1BI2A 3CCJA 1W70A 4DEYA 1Y0MA 1T0HA 4M77F 1M1FA 3G71Q 2DO3A 5GAMd 3QUIA 1UG1A 1Y7XA 4CC2A 2J6OA 1G3SA 3PFSA 5J26A 2DEUA 3JCMe 3RBBB 1VQOQ 2COZA 3FRNA 3R6OA 2PUOB 2YRVA 3X24B 3CXCP 4J6YA 2F2VA 2OTJQ 1BCOA 6AT1B 2FPFA 2H3EB 2DLPA 2NUPB 1EIFA 1W2BA 2CT3A 2X3XD 3L2RA 2DL4A 3PVLA 3CD6Q 2A08A 3CD6T 4KUIA 1M27C 1GFCA 2ZPGB 3HFNA 3CD6A 4L59A 1LVKA 4OMQA 4OMLA 3CMAT 5GAN3 2ZZDA 2RQTA 4XAXB 3EFOB 3LYIA 3M9QA 4XK8E 1U8RA 3X26B 1UEBA 1K73U 3MP8A 2YUNA 2NUPA 4LXCA 2SEMA 2VWFA 4KH1B 5L23A 2WSEE 1N8RR 4Q5WA 4JJCA 3UA7A 2JTEA 4J9CA 4A4KA 5IHIA 4F7UA 2LCLA 2DEQA 1FYNA 1ZLMA 2KT1A 3RKWA 3JCMW 4A4GA
chains in the Genus database with same CATH topology
5GMKh 2K3XA 3BW1A 4IUTA 1FXXA 3X20B 4MZTA 4OP0A 3LGFA 3OBWA 3PGGA 4X34A 1OZ3A 2E64A 1QVGS 2IG0A 1QVPA 5LJ3d 2F5TX 2RJEA 3PNWC 4M77B 5A0DA 4BE2A 4F7UG 4OB2B 3JCMf 1YJWT 2PVOB 1KD1C 3ER0A 3CCUT 2L5QA 4JDSA 2HQEA 2F5KA 1XOVA 4BDYA 5LJ3j 3GPLA 4XTZA 3MP6A 2EWNA 3FJPA 3OBYA 5LJ5h 1KHIA 2GCXA 4L6V5 3GNFB 4C0DB 2O4XB 1SSFA 3NTIA 4IUVA 4OB0B 3I56T 4M78C 4PJOA 3L2VA 3HSBA 1FX7A 1LNXA 3CMAA 4RCCA 5I21A 4J7IA 4FT2A 5KCOA 3QYGB 2LTOA 3OMGA 2VYTA 3L1AA 1S72A 3QYHB 4M7DD 1VQ5A 2PU9B 3MO8A 2X4JA 2OTJT 4M77G 2CGHA 2LT4A 3FEOA 1Y71A 5GAOr 3V7SA 4ZGJB 3ZFJA 3M56A 5D6WA 4ELZC 2DJZA 4C8QD 2OAUA 3KXTA 3WXMB 1GXIE 4M75B 2RJDA 3HL8A 3QDRB 2XIDA 3RMSA 2CZ7B 4B9XA 4M78A 4C0ZA 4ZGEB 3V7RA 4BD3A 2PQWA 4IUPA 4ME7A 2PVGB 4ELYC 3CCEA 3DLMA 1KG1A 2LVMA 3OYYA 2V8JA 3ZEHA 4M7DA 1QP3A 1UGRB 1N27A 5GAOq 2CZ0B 4C8QA 3A8HB 1I4K1 5GAOl 3H6ZA 5L8RE 2H3JA 3BY7A 4PJOD 3PT9A 4PNOA 3Q1JA 5GAMe 4C8QF 3HRTA 5LJ5f 1KQSS 3OW2S 2LNVA 3PMIA 2MI6A 4RCBA 5GMKl 3L42A 3QZ9B 2E10A 3X28B 3OS5A 4NS5A 1VQNT 2X35A 2XDBA 2X4XA 3CC4A 2L8DA 3JB9I 4O6JA 4OB3B 1YJNT 2MF2A 2OTJA 1VQ7T 1OI1A 4HCZA 2QQAA 4LDVA 2FYKA 4N0AC 4JRQA 3PTAA 3META 4XTWA 5CKDA 2M1HA 3E1SA 2RJFA 3JCMP 1M4ZA 2CZ1B 5D6YA 5LJ5g 2E70A 2EQJA 1KC8U 2X4YA 2K5IA 2RO0A 3FLGA 4J83A 4E7KA 4O5VA 4BI8B 1BIAA 2K57A 1G5VA 3FC3A 1WNLA 2XK0A 4RG2A 2RK2A 5FROA 3TU4K 5GAMh 3A8GB 3SD4A 3V8LA 2P0QA 5CKEA 4BI3A 3C4SA 2F69A 3ME9A 1M9SA 5GAN6 5FU6B 1N6AA 2DXTA 3GF5A 4C92B 3GP8A 1QVFA 4IUUA 1YI2A 2EIFA 5CKBA 3JRZA 1N8RC 1VQ8A 3NTHA 5AYFA 1H641 3SB2A 2XG8D 3RMQA 3OYMA 2R58A 4QVZA 5IAYA 4C92E 3FB9A 3GIBA 2YLBA 5GMKi 4M75A 3V8KA 1U1TA 3QG1A 1B34B 3RESA 4LDUA 4BI4A 5GAOp 4LDXA 3CCSA 2XKOC 3KUFA 2KSSA 5I2SA 1Q86C 5HY6A 5FRMA 3BDUA 2Y90A 2FVUA 4OF1A 5CKHA 4TVRA 3VUBA 2LDMA 1VQPA 2ZPBB 5LJ3f 2XDDA 3OA6A 4EPCA 2DVEA 4C0DC 3M58A 5A0LA 4PJOG 2L3RA 1JBMA 5FU7B 3C12A 3OYLA 4E7HA 3G4ST 5LL6S 3PIOA 5IT9E 2YLCA 4JLIA 1WJSA 2DD5A 2M0OA 4JLGA 3GOXA 3CCVT 2I2LA 2D9TA 5A2QE 4PJOE 1BIBA 2EJ9A 2WSCE 4FM4B 5GAMj 2PVDB 3M54A 2KY9A 3S3NA 2DTIA 3CC4T 1D3BA 4E7JA 2Y4XA 3MEUA 1VQ4T 1YJ9T 4EMHA 4M7AD 5GMKm 5GMKe 4YTLA 4HCCA 2MWPA 3TEEA 1LJOA 2FHDA 4ZN3A 3QPHA 1K8AU 1P92A 4C92G 4N4HA 1BI3A 3VKIA 3OYIA 3LWHA 2KDSA 1N9RA 3GLXA 4LD6A 4C5EA 3DKMA 5M9OA 3JCMJ 3A5ZB 5GANh 4PJOB 2JTMA 2V8KA 3P8DA 4GY5A 3F70A 1W2BS 3O8VA 4XTUA 2GFUA 4CI0C 3URGA 5HKCA 2EQMA 1Q7YU 4J6XA 3CBPA 1BI1A 4VUBA 4BY6B 3EFSA 4M75F 2E65A 3A8OB 4C5IA 3H8ZA 3CCRT 5C0MA 5HK0A 4BE1A 3UT1A 2M16A 2RI3A 3OY9A 5CQXA 3QHSA 4PKCC 3LW5E 1KQ2A 3CCET 3ZBDA 4NL2A 1WGSA 1K9MC 1G3TA 1I8FA 2E6ZA 3UWNA 1I5LA 5LJ3e 3CPWA 4M7DB 4C8QB 3CXCS 4LD9K 3J7AF 4KBMB 4M78B 3UPUA 3M57A 3I56A 3OS1A 3HHTB 5D6XA 1VQ5T 1JRIA 1YITT 1TH7A 2VXEA 2EJFA 3T9NA 5A0GA 4PJOC 4V2SA 2HQXA 3SWNC 3HPWA 2XHCA 5I2MA 4BACA 2Y4YA 4J5YA 4DOWA 2RB6A 3SWNB 4ATOA 2DD4A 5CAIA 2RHXA 2QQRA 4JRIA 5GANg 3OYKA 1JJ2A 3OYNA 3L2ZA 2KK4A 4JRPA 2EKOA 4M78F 3OYDA 2O01E 5LJ5e 4C5HA 4R55A 3CCUA 3CEYA 4OGCA 1Q7YC 4RKUE 2RHUA 3JB9D 2G3RA 4JUVA 2RK1A 2ZPIB 3M53A 4M78E 4XU3A 3JCMV 4DQ2A 2CYZB 4M7AA 3OYJA 4PLLA 2MAMA 4N4GA 1YI2T 4M7DE 2DTOA 3RUXA 5KE2A 4ZTJA 2RHYA 1VIFA 1M5Q1 3MP1A 2P0KA 3OYEA 1M90U 1K9MU 2E6NA 4EDUA 3CC2T 4QQ6A 3N5BB 3EFRA 4N0AA 1VQ4A 1YJ9A 1QP2A 4HCBA 3MHXA 1WPYA 4M7DG 5CK9A 4OB1B 3VV0A 3AHUA 1YBYA 4HA8A 5CQYA 3M4YA 3HFOA 3V8JA 4ZN1A 4C5GA 5J39A 3JAME 4C92D 1KD1U 1O9SA 4A54A 2EQUA 4F7UB 3I55A 4EMKA 3OYBA 3OSSC 2QA4A 4E7IA 4A4FA 4MMLA 1VQ7A 3SDZA 2BUDA 4OMFB 3OS2A 1BI0A 2KVQG 3CCQT 2LQKA 2QQSA 3OMCA 4OVAA 4BDZA 1VQOT 3CCRA 3RKXA 3V7CA 4FSXA 2IVWA 2NLUA 4L5GA 4EMKB 1I81A 2AHJB 2FB7A 3CC2A 1V29B 4KUDK 3CCMT 3HRUA 2JN0A 2KQWA 1QW1A 3EAEA 3OQ5A 4BE0A 2YHTA 4OGEA 3OS0A 3FDRA 3LX7A 1OYXA 2QDYB 4BUGA 1VQ8T 3E9GA 2QEXA 4MZPA 4XTXA 3UDCA 5GAMg 3CC7A 3JCMb 3QBYA 2PUKB 3HKSA 3JCMc 1M90C 1YHQA 3CPFA 1VQ6A 3VJPA 3OYFA 3JCMg 4R56A 3JB9F 3OYAA 2LC4A 4A4EA 1WJQA 2ZGWA 1VQOA 1QVGA 2V8IA 2DKGA 3DB4A 1M1KU 2VUBA 4M78D 3HRSA 1K73C 3LGLA 2WSFE 4M7AG 1PSEA 3X25B 2QA4T 4M7DC 5GAN8 3E19A 2LX9A 1VQMT 4A53A 2K4YA 1AHJB 4GLKA 4MZMA 3G4SA 1IZ6A 2DZ9A 1N8RU 2RM4A 3CBOA 4MMKA 4CRIA 4WF2A 3QSUA 1NJIU 3RIRA 3FIFA 4C8QE 1O75A 1Y07A 4UC4A 5GAN4 4C92C 2R5AA 2RHZA 1YHQT 1MGQA 4J6WA 4E47A 1Y96A 3P8BB 2OTLA 3CMEA 3M4GA 1Q82C 1KQ1A 4II1A 3CC7T 3MCAB 4XTVA 3G71A 3A8LB 3LH0A 3RKYA 4HKEA 2QEXT 1Q81U 5LJ5d 1M1KC 2QXFA 5FLXE 2K5FA 3L2QA 2RI5A 4FL6A 3QIIA 1H3ZA 2EAYA 3E9FA 2A3LA 1DJ7B 5GAN5 2QI2A 4QQGA 4A4HA 3JCMQ 3CXCA 4M75G 2D6FA 2K5LA 4M77C 1UGPB 2HBPA 3QJYA 2RHIA 3DLLA 3CCQA 2M9UA 1VQKA 2WACA 5J3BA 1OZ2A 2EQKA 2X4WA 4IURA 2RJCA 3HP9A 3QJ6A 4M7AB 1KHCA 5DLOA 1VQMA 4N4IA 1PSFA 1W4SA 2QQBA 5GANf 1NE8A 1K8AC 1ZBXA 1U1SA 2RD1A 3JCMh 2ZPFB 2GQVA 3G7ZA 3JSCA 2ZPEB 4J8OA 2ZPHB 4P5NA 3QKJA 5KE3A 1NJIC 1QVFS 2P0PA 3OYCA 1YJNA 4IKFA 2JVVA 2LCCA 3KBGA 4C92F 5GMKj 2VXFA 3GNGA 1WQWA 3VUZA 4X9CA 1VQ6T 2BKDN 5KCHA 1XTDA 5CO7A 4C92A 3WVEB 4QVDA 3QO3A 1VQPT 3BDLA 1UGSB 1M1GA 4M75E 2O4XA 4XU0A 1RI0A 5GAMf 4IUQA 5CCAA 1YIJT 1YJWA 2HNIA 1UB4A 1YIJA 3MEAA 1Y96B 3PMTA 1HK9A 1XNIA 2B8AA 4NOYA 3CCMA 3JCMX 2CZ6B 3C94A 4LDWA 4XTYA 5LJ3h 3L2UA 1G3YA 4PJOF 1Q82U 3S3OA 4HT9A 1VQ9T 3L2WA 4JJNK 2DPPB 4JS4A 3CCLT 3VU3C 3OW2A 5IN1A 3JB9H 4DA4A 1VQLA 5HK3A 4NL3A 5GAOn 3M59A 4C8QG 4D6WA 1S72T 3WVDB 3A8MB 4Y91A 2DXUA 5GAOm 3LWIA 3CBMA 1IREB 4M77E 2D0QB 2K3YA 3OYGA 4E7LA 1KC8C 1BI2A 4FT4A 1D3BB 4X9DA 3CCJA 4MDXA 2JNGA 2QTXA 4M77F 1M1FA 4M7AC 2DO3A 2KAFA 4RG8A 5GAMd 3QUIA 1Y7XA 2LQ8A 2L89A 4Y28E 2DK3A 2DXBA 2QQ9A 1Q86U 4M77A 1G3SA 3PFSA 5J26A 4FIBA 3JCMe 4FU6A 1VQKT 3RERA 4PLIA 4KULA 3FRNA 3R6OA 2PUOB 4MDWA 2RI2A 2DXCA 2YRVA 3X24B 4RMOA 3OB9A 2E1HA 4PL6A 3G6ET 4J6YA 1RL2A 1X01A 3M5AA 4HT8A 5CR2A 2OTLT 3G6EA 1MHNA 1NPPA 5LJ5j 4EMKC 1XQHA 2E5QA 2EJGA 3CPWS 4M75C 4XU2A 4Z02A 2P4TA 2JTFA 4JS5A 4C0GA 2E41A 4KT0E 2DAQA 3G71T 2LT1A 2HAXA 1KQSA 4XQ3A 1EIFA 3CMET 1W2BA 4DOVA 4B9WA 3ASKA 5C6SA 2XU8A 2CS7A 3JCMd 3L2RA 2XI9A 1YITA 4ZTFA 2MMPA 4JRKA 3CD6T 2A7YA 2RH2A 4KUIA 4EMGA 3J80E 1X75C 3CCJT 2VGMA 1HXDA 2ZPGB 3HFNA 4L59A 2EFIA 4BY6C 3CD6A 3QXEB 2K2VA 3OSVA 5FU6C 2XDPA 2BIVA 3NFCA 2XD0A 3TREA 2KMTA 5KH6A 4M75D 2JZ2A 1M8VA 5CVIA 5DLQE 5DY9A 2FL7A 1VQLT 4XU1A 2JOYA 3CMAT 2GFAA 2RA2A 2CKKA 5GAN3 1NPRA 2ZZDA 3J81E 1VQ9A 2VC8A 3VYHB 2LRQA 1WJRA 1LOJA 2VV5A 2DIGA 4M7DF 2DIQA 5DM7R 3LYIA 4XAXB 3BFMA 3M55A 3M9QA 3NTKA 4XK8E 3VYGA 4M7AE 1R8OB 1U8RA 5FU7C 3X26B 1YCYA 1UEBA 5CIUA 4C0FA 1ZQ1A 4M77D 3C95A 1K73U 2DTHA 4M7AF 1N9SA 3MP8A 2JUFA 1G3WA 5GAN7 3PIPA 5FRNA 2DZCA 2R5MA 5GANe 5GAN2 3TCJA 3SFMA 4ZGDB 1X6OA 1FWZA 3JB9G 3DB3A 4QVCA 3I55T 4F7UE 1VIEA 2C06A 2WSEE 2XICA 2MWOA 2EYQA 5CKFA 4Q5WA 4F7UF 1BKBA 3CCVA 4C8QC 2HD0A 4M78G 4QW2A 4A4KA 3MEWA 1JJ2S 2GF7A 4F7UA 4BB7A 3S3MA 3INZA 2LCLA 3S6WA 3MEVA 1B34A 2VGNA 3P8HA 1Q81C 3OYHA 1WQ7A 4LDYA 2E12A 5LJ3g 3JB9J 5GANd 1UGQB 3CCLA 1NZ9A 1VUBA 3LLRA 1BYMA 2DEQA 3SWNA 2R57A 3RKWA 1JB0E 3JCMW 4A4GA 3CCST 4QQDA 3QZ5B 5EG2A 1VQNA 5GANj 4J7FA 1ZHIA 2ZCFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PU9 B;  3X28 B;  3X20 B;  3WVE B;  3WVD B;  3A8M B;  1QP2 A;  2DD5 A;  2WSE E;  1UGS B;  2QDY B;  1IRE B;  1UGP B;  2D0Q B;  2PVD B;  2WSC E;  2ZZD A;  3A8O B;  4FM4 B;  4OB1 B;  4KT0 E;  4OB3 B;  3VYH B;  1GXI E;  2DD4 A;  4OB2 B;  2PVO B;  3LW5 E;  2CZ7 B;  4ZGE B;  2PUK B;  4XK8 E;  3VYG A;  2PVG B;  1PSF A;  2CZ6 B;  4Y28 E;  2O01 E;  3X26 B;  1QP3 A;  1UGR B;  2DXB A;  4L6V 5;  2CZ1 B;  4ZGJ B;  2CZ0 B;  2ZPF B;  3A8H B;  3A8L B;  4RKU E;  2ZPE B;  1UGQ B;  2ZPH B;  4OB0 B;  5L8R E;  2ZPI B;  2DPP B;  2ZPG B;  2CYZ B;  2PUO B;  2ZPB B;  2DXC A;  2WSF E;  3QXE B;  3X24 B;  1PSE A;  1JB0 E;  3X25 B;  4ZGD B;  2AHJ B;  3HHT B;  3QYG B;  3A8G B;  3QZ5 B;  1V29 B;  1DJ7 B;  3QYH B;  1AHJ B;  2ZCF B;  3QZ9 B; 
#chains in the Genus database with same CATH topology
 2CP7 A;  1FXX A;  3THK A;  3CCM Q;  3LGF A;  3CCR Q;  2KYB A;  2IIM A;  2RF0 A;  4F7U G;  4OB2 B;  3CQT A;  3CCU T;  4BDY A;  2HQE A;  2F5K A;  4XTZ A;  3OBY A;  4L6V 5;  4R0K A;  3GNF B;  4J9I A;  1SSF A;  4PJO A;  3CMA A;  3H0F A;  4J7I A;  5KCO A;  1PCX A;  1AT1 B;  1VQ5 A;  2HSE B;  2X4J A;  2GGR A;  1Y71 A;  3M56 A;  3QWX X;  2FPD A;  2DF6 A;  4M75 B;  2RJD A;  2DET A;  2KNB B;  1KG1 A;  4IUP A;  4ME7 A;  4M7D A;  3CCJ Q;  1UGR B;  5GAO q;  3A8H B;  1I4K 1;  1IHV A;  5L8R E;  4PNO A;  3Q1J A;  1PRM C;  2OTL Q;  4RCB A;  2LNV A;  2CT4 A;  3PMI A;  1QKW A;  2E10 A;  1OU8 A;  2CP6 A;  3X28 B;  4FW2 A;  2X4X A;  3JB9 I;  4OB3 B;  1OI1 A;  2QQA A;  4LDV A;  4JRQ A;  5CKD A;  2MK5 A;  2BZX A;  2DM1 A;  2GQI A;  5KYW A;  2K5I A;  1HD3 A;  4O5V A;  2K57 A;  4RTY A;  2JMA A;  3FC3 A;  3TU4 K;  2KR3 A;  3SD4 A;  3V8L A;  2J7I A;  1SG5 A;  2DXT A;  5FU6 B;  1N8R C;  3JRZ A;  3NTH A;  1H64 1;  3SB2 A;  3RMQ A;  2O9S A;  4QVZ A;  1QCF A;  1TWB A;  3QG1 A;  4LDX A;  3RES A;  1HJD A;  3KUF A;  5I2S A;  5FRM A;  2AZV A;  2FZG B;  5HY6 A;  3BDU A;  2LDM A;  1VQP A;  3OA6 A;  1ZA2 B;  1NEB A;  5A0L A;  2L3R A;  1JBM A;  4CC7 A;  3OYL A;  4OMO A;  3G4S T;  5LL6 S;  1AVZ C;  5IT9 E;  2YLC A;  3VS2 A;  1OV3 A;  1WYX A;  5GAM j;  2PVD B;  2DTI A;  1ZA1 B;  3RDV A;  3CCE Q;  2MPX C;  2DYB A;  1LJO A;  1BI3 A;  3OYI A;  1K73 R;  3DKM A;  2V8K A;  3URG A;  5HKC A;  1EZZ B;  3EGX B;  4J6X A;  4VUB A;  3EFS A;  3VS0 A;  3CCR T;  3OY9 A;  3QHS A;  4PKC C;  1QVF P;  5IHK A;  3CCE T;  4JPB W;  2HCK A;  1I5L A;  1M3C A;  4LD9 K;  3UPU A;  3I56 A;  2RQU A;  2CP2 A;  3HHT B;  1YIT T;  2EJF A;  4RTT A;  3T9N A;  2HQX A;  1IXD A;  2XHC A;  5I2M A;  1H8K A;  2DD4 A;  5CAI A;  2RHX A;  5GAN g;  2EGC A;  2EKO A;  3TSW A;  2O01 E;  4R55 A;  1Q7Y C;  4AFQ C;  3JB9 D;  2G3R A;  2ZPI B;  3M53 A;  1T3S A;  4DQ2 A;  1TTH B;  4M7A A;  2FZC B;  4M7D E;  1GCQ C;  2P0K A;  4EDU A;  3N5B B;  3MHX A;  3VV0 A;  1RAD B;  2QG9 B;  3CMA Q;  3M4Y A;  4AFS C;  2JT4 A;  4A63 B;  1U3O A;  1OUL A;  3JAM E;  4C92 D;  3QDF A;  4F7U B;  2M0Y A;  4A4F A;  1RLP C;  3OS2 A;  3REB B;  3CCQ T;  3OMC A;  4L5G A;  2JMC A;  4PFZ A;  1I81 A;  5KYY A;  1V29 B;  2JN0 A;  2KQW A;  3OQ5 A;  3M0P A;  2YHT A;  4OGE A;  3HTR A;  3FDR A;  1Q95 G;  4FYX B;  4BUG A;  2QEX A;  4MZP A;  4XTX A;  2A37 A;  2PUK B;  3HKS A;  2VB6 A;  3CPF A;  1WHK A;  2KXC A;  1VQ6 A;  2HSP A;  1M1K U;  3DB4 A;  4M78 D;  8ATC B;  3LGL A;  2DL7 A;  4M7A G;  2QA4 T;  4M7D C;  3ULR B;  4ESR A;  3G4S A;  1IZ6 A;  4OMM A;  2RM4 A;  3CBO A;  3H0I A;  3QSU A;  1KD1 R;  4C8Q E;  1Y07 A;  3CCU Q;  2ESW A;  2MOX A;  4C92 C;  2X3W D;  3EGX A;  1YHQ T;  1M8M A;  1WX6 A;  3CME A;  2K6D A;  4CC4 B;  1KQ1 A;  4II1 A;  4XTV A;  3G71 A;  2A28 A;  1TUD A;  3MKD A;  4J9F A;  4FL6 A;  1R0B G;  3E9F A;  1G2B A;  2A3L A;  1DJ7 B;  1YIT Q;  3E2U A;  1AWJ A;  4QQG A;  4A4H A;  2YUO A;  2CP0 A;  1AWW A;  2HBP A;  2L3Q A;  1VQP Q;  2M9U A;  4AMC A;  3HP9 A;  5DLO A;  4N4I A;  5GAN f;  1D09 B;  2ZPF B;  2GQV A;  1Z9Q A;  2EQI A;  1Q7Y R;  1Q86 R;  1NJI C;  5KE3 A;  2JVV A;  3KBG A;  5GMK j;  4X9C A;  2BKD N;  5KCH A;  1VQ5 Q;  1WDX A;  4XU0 A;  2O4X A;  2FO0 A;  4J9B A;  2A36 A;  1PRL C;  1XNI A;  1VYV A;  2JS2 A;  1I5O B;  1GFD A;  4XTY A;  1YCS B;  1G3Y A;  1WXB A;  4HT9 A;  2NWM A;  3L2W A;  2DPP B;  1PD0 A;  1AZE A;  3JB9 H;  3CC2 Q;  2LZ6 B;  4NL3 A;  3M59 A;  4C8Q G;  1S72 T;  3O5Z A;  1VQL Q;  4Y91 A;  1W6X A;  3CBM A;  1IRE B;  4FT4 A;  1D3B B;  4MDX A;  1PKS A;  4Y28 E;  2L89 A;  4FIB A;  2HL3 A;  1VQK T;  4PLI A;  2KRN A;  2OI3 A;  2DXC A;  1RL2 A;  1S72 Q;  4HT8 A;  2OTL T;  1YJN Q;  3CPW S;  2E5Q A;  4M75 C;  4XU2 A;  4Z02 A;  3G71 T;  1WHL A;  4XQ3 A;  2RPN A;  3JCM d;  1Q82 R;  1KSW A;  4JRK A;  4KGZ B;  2RH2 A;  4EMG A;  3I35 A;  1X75 C;  2VGM A;  3EGD B;  3QXE B;  2XDP A;  2XD0 A;  2KMT A;  3A98 A;  1M8V A;  4AG1 C;  5DY9 A;  1VQL T;  4KH0 B;  4XU1 A;  2GFA A;  2RA2 A;  1BB9 A;  2LRQ A;  1WJR A;  1OPL A;  2DIG A;  2KGT A;  1K9A A;  3NTK A;  3VYG A;  5CIU A;  3C95 A;  4QKU A;  2DE0 X;  1N9S A;  2JUF A;  3PIP A;  1NJI R;  5FRN A;  2FRW A;  5GAN e;  1X6O A;  4DBQ A;  1FWZ A;  1RI9 A;  3JB9 G;  4F7U E;  1VIE A;  1VQM Q;  4F7U F;  3CCV A;  2HD0 A;  4OMN A;  3MEW A;  5I11 A;  4FYY B;  3RNJ A;  1WI7 A;  3P8H A;  3R6N A;  1BK2 A;  1YHQ Q;  2LP5 A;  1K4U S;  1XJW B;  5LJ3 g;  1UGQ B;  3LLR A;  3SWN A;  4FCY A;  3M0U A;  3ZL7 C;  1JB0 E;  1SSH A;  3CCS T;  4J7F A;  2ED0 A;  4MZT A;  4OP0 A;  3PGG A;  2GTO A;  2COW A;  2RQW A;  3PNW C;  5A0D A;  3CCV Q;  1RAB B;  3EG2 A;  2L5Q A;  1JU5 C;  5LJ5 h;  4C0D B;  2G6F X;  1QCN A;  2OAW A;  2YT6 A;  3I56 T;  5GJV B;  1FX7 A;  1F1B B;  2DMO A;  2LTO A;  2VYT A;  2XMF A;  4F14 A;  3OW2 P;  2HDA A;  1ARK A;  3ZFJ A;  4DBF A;  2CZ7 B;  4C0Z A;  1B3Q A;  2PVG B;  3CCE A;  2CZ0 B;  2DER A;  3I56 Q;  1OPK A;  2MCN A;  4J9D A;  1VQK Q;  3HRT A;  1Y57 A;  5LJ5 f;  5GMK l;  2L0A A;  1X6G A;  2NUZ A;  3OS5 A;  1VQN T;  1IRX A;  2PNI A;  2XDB A;  1ACM B;  4J9E A;  1YJN T;  1VQ7 Q;  1SHG A;  2MF2 A;  5EC7 A;  3PTA A;  2M1H A;  3E1S A;  3JCM P;  3D7S B;  1M4Z A;  2CZ1 B;  2PTK A;  2X4Y A;  4J83 A;  2RO0 A;  4E7K A;  4BI8 B;  1R0C B;  1WNL A;  2XK0 A;  2K9G A;  4BI3 A;  5CKE A;  1U5S A;  3C4S A;  1N6A A;  2QAS A;  4IUU A;  2EIF A;  2W0Z A;  3GBQ A;  1VQ8 A;  3M0T A;  1KC8 R;  2XG8 D;  2R58 A;  4C92 E;  3GIB A;  2YLB A;  5GMK i;  2YSQ A;  4M75 A;  5GAO p;  3CCS A;  1W1F A;  4DBH A;  2Y90 A;  5CKH A;  3CCS Q;  4EPC A;  4PJO G;  5FU7 B;  1D1C A;  2DD5 A;  2M0O A;  4JLG A;  3CCV T;  2I2L A;  2D9T A;  4PJO E;  1VQ8 Q;  1BIB A;  2COY A;  2VKN A;  4E7J A;  2EGE A;  2Y4X A;  1VQ4 T;  1YJ9 T;  4EMH A;  3NHN A;  4HCC A;  1SRM A;  3TEE A;  1EX4 A;  2QDL A;  2JM9 A;  4C92 G;  4N4H A;  3VKI A;  2KE9 A;  1KJW A;  4WCI A;  4C5E A;  5GAN h;  1AZG B;  2FEI A;  4GY5 A;  1NYF A;  3O8V A;  4XTU A;  2GFU A;  4CI0 C;  1JXM A;  4GBQ A;  2EQM A;  2LJ1 A;  1Q7Y U;  4BY6 B;  3CBP A;  2BTT A;  2M16 A;  1JQQ A;  2DX1 A;  4NL2 A;  3VS4 A;  1VOM A;  1G3T A;  1MNE A;  1I8F A;  1GCP A;  5LJ3 e;  3CPW A;  4M7D B;  3CXC S;  1UE9 A;  1OU9 A;  2KRO A;  3CPW P;  1R77 A;  5D6X A;  2D0N A;  1TH7 A;  1HYO A;  2VXE A;  4DOW A;  2BE9 B;  4PJL A;  2RB6 A;  4AT1 B;  4JRI A;  3OYK A;  3OYN A;  3EFO A;  3L2Z A;  2KK4 A;  4JRP A;  4M78 F;  1GBQ A;  1M3B A;  4DEX A;  1YWP A;  2DBM A;  3VRZ A;  4JUV A;  4M78 E;  4XU3 A;  3JCM V;  2AT1 B;  3VS1 A;  2RHY A;  3MP1 A;  1NG2 A;  4QQ6 A;  1VQ4 A;  3EFR A;  1YJ9 A;  1BCM A;  1QP2 A;  3QWY A;  2ATC B;  1X2K A;  4OB1 B;  2QGG A;  3HFO A;  4HVU A;  4C5G A;  5J39 A;  1O9S A;  4PJN A;  4B6M A;  1VQ7 A;  3SDZ A;  2BUD A;  1UUE A;  3CCQ Q;  1VYU A;  2QQS A;  2NLU A;  1AWO A;  3CC2 A;  4KUD K;  3HRU A;  1TSF A;  1OYX A;  2NUT A;  3FJ5 A;  3JCM c;  1YHQ A;  1GCQ A;  2F2X A;  3JB9 F;  1TUC A;  2DBK A;  1VQO A;  1UHF A;  3E19 A;  4GLK A;  4KGX B;  1M2V A;  1MMN A;  2KRS A;  4WF2 A;  4CRI A;  1NJI U;  3RIR A;  2EYY A;  2E5K A;  3FIF A;  5GAN 4;  1D0Z A;  1IGU A;  2R5A A;  3EGD A;  4F17 A;  1Q82 C;  2AZS A;  2YUQ A;  3A8L B;  2A0F B;  3LH0 A;  4HKE A;  3RKY A;  5IXF A;  5LJ5 d;  2QXF A;  5FLX E;  2LJ3 A;  3QII A;  1AEY A;  3M0R A;  2KYM A;  3UAT A;  1G8X A;  3SHW A;  3REA B;  1ZSZ A;  1YJW Q;  2K5L A;  3DLL A;  1UGP B;  3QJY A;  1VQK A;  2RHI A;  3CCQ A;  1SRL A;  2WAC A;  4IIO A;  2X4W A;  4PJM A;  2RJC A;  4M7A B;  2C0T A;  1W4S A;  1TS9 A;  1ZBX A;  3JSC A;  3G7Z A;  1QVF S;  4P5N A;  2ZPH B;  1TOV A;  4X1V A;  2EPD A;  1VQ6 T;  1XTD A;  3WVE B;  3BDL A;  1M1G A;  5GAM f;  1YJW A;  1YIJ T;  4IUQ A;  4RTV A;  1OOT A;  5KYU A;  1UB4 A;  3MEA A;  1Y96 B;  4ZNX A;  3PMT A;  1JJ2 P;  3UA6 A;  3L2U A;  1ZUY A;  3I9Q A;  1QCO A;  4ORZ A;  4JJN K;  2J6F A;  2RMO A;  4JS4 A;  3CCL T;  5IN1 A;  4DA4 A;  1VQL A;  5HK3 A;  2YRD A;  5GAO n;  5IH2 A;  1JEG A;  3LWI A;  2K3Y A;  2FG0 A;  2GBQ A;  4X9D A;  4J9G A;  2P4R A;  2JNG A;  2QTX A;  4KGV B;  3M0Q A;  2KAF A;  4RG8 A;  4M7A C;  1M90 R;  2YUP A;  2LQ8 A;  2DK3 A;  2QQ9 A;  4M77 A;  1FMW A;  4FU6 A;  4HVV A;  3RER A;  4KUL A;  4RMO A;  2RI2 A;  4HXJ A;  3G6E T;  4PL6 A;  1X01 A;  5CR2 A;  1EFN A;  3G6E A;  2E3H A;  1MHN A;  2I0N A;  5LJ5 j;  5IXB A;  2EJG A;  1B7T A;  2P4T A;  2JTF A;  4C0G A;  4KT0 E;  2DIL A;  2LQW A;  1KIK A;  3CME T;  4DOV A;  1K0S A;  4B9W A;  5C6S A;  2CS7 A;  4ZTF A;  2MMP A;  2A7Y A;  3BE3 A;  3J80 E;  3EHQ A;  3CCJ T;  2D8J A;  2EFI A;  2K2V A;  5FU6 C;  4M75 D;  2JZ2 A;  5CVI A;  3TSZ A;  4E7Z A;  4E7S A;  2CKK A;  2EGA A;  1NPR A;  1VQ9 A;  2VC8 A;  3VYH B;  4AFU C;  2DIQ A;  5DM7 R;  1MUZ A;  3BFM A;  1D1A A;  3M55 A;  4QT7 A;  4M7A E;  1R8O B;  1YCY A;  4M77 D;  2EVR A;  4M7A F;  2ROL A;  1W2B P;  1G3W A;  1YNZ A;  5GAN 2;  3TCJ A;  4ZGD B;  1C6V X;  2OJ2 A;  4RTZ A;  4PFP A;  3I55 T;  2C06 A;  2XIC A;  4LE9 A;  2EYQ A;  5CKF A;  1NM7 A;  4C8Q C;  2MIO A;  3AT1 B;  1JJ2 S;  1OX8 A;  3MEV A;  1B34 A;  2VGN A;  1WQ7 A;  4LDY A;  3JB9 J;  5GAN d;  1NZ9 A;  1RAE B;  1BYM A;  2HKQ B;  2R57 A;  4QQD A;  3QZ5 B;  5EG2 A;  1VQN A;  1ZHI A;  5GMK h;  2K3X A;  3BW1 A;  4IUT A;  1YIJ Q;  1VQN Q;  3OBW A;  2IG0 A;  1QVP A;  2HMA A;  2F5T X;  1UDL A;  2ED1 A;  3JCM f;  1KD1 C;  4JDS A;  1XOV A;  3GPL A;  3MP6 A;  3FJP A;  1E7O A;  1ZSZ C;  2GCX A;  2O4X B;  2RN8 A;  3NTI A;  4OB0 B;  4M78 C;  1MND A;  3L2V A;  3HSB A;  5I21 A;  4FT2 A;  4K11 A;  3OMG A;  3QYH B;  2KRM A;  2PU9 B;  2DA9 A;  3H41 A;  2OTJ T;  1UFF A;  1OX9 A;  2CGH A;  2LT4 A;  3FEO A;  1UEC A;  5GAO r;  1MV0 B;  2DJZ A;  3KXT A;  2J05 A;  1GXI E;  3HL8 A;  5AT1 B;  3QDR B;  4B9X A;  1PNJ A;  2HL5 C;  3SEM A;  3V7R A;  4BD3 A;  2PQW A;  4ELY C;  2LVM A;  2V8J A;  3ZEH A;  1QP3 A;  2AIR B;  1PWT A;  2H3J A;  1RLQ C;  3BY7 A;  5FW9 A;  4PJO D;  1WHG A;  5GAM e;  4C8Q F;  2K7A A;  1NLO C;  3QZ9 B;  2FRY A;  3CC4 A;  3EG9 B;  1SF9 A;  1Z9Z A;  4HCZ A;  5KYN A;  2FYK A;  4N0A C;  3MET A;  2RJF A;  3RR6 A;  2LX7 A;  5D6Y A;  1BU1 A;  2PZ1 A;  2EQJ A;  1KC8 U;  3FLG A;  2OX7 A;  5FWC A;  4PFO A;  4FW1 A;  1BIA A;  5FRO A;  5HCK A;  3A8G B;  1I0C A;  3EHR A;  1M9S A;  5GAN 6;  2M51 A;  3GP8 A;  1WIE A;  3VS7 A;  3OYM A;  1WZO A;  1IGQ A;  2EYZ A;  3V8K A;  1V1C A;  4BI4 A;  4LDU A;  1Q81 R;  2XKO C;  2ABL A;  2KSS A;  1Q86 C;  4OF1 A;  1LCK A;  3VUB A;  2RNA A;  2YRC A;  2CP3 A;  4C0D C;  3M58 A;  1M3A A;  4OMP A;  5D7U A;  3PIO A;  4JLI A;  2EJ9 A;  4FM4 B;  3MEU A;  1WXU A;  2X9H A;  1C1A A;  5GMK m;  5GMK e;  2MWP A;  2FHD A;  4ZN3 A;  1T3L A;  2J06 A;  2BZY A;  4RTU A;  1TUG B;  1SPK A;  1N9R A;  3GLX A;  4PJO B;  5M9O A;  3NGP A;  2JTM A;  2O2O A;  3P8D A;  3F70 A;  3EG0 A;  3KFV A;  1NYG A;  1BI1 A;  3EG1 A;  2E65 A;  2JS0 A;  3H8Z A;  5C0M A;  5KYX A;  4BE1 A;  3UT1 A;  5CQX A;  1KQ2 A;  3LW5 E;  1X69 A;  1ABO A;  1K9M C;  2E6Z A;  1X43 A;  2JW4 A;  1M1K R;  3J7A F;  2O9V A;  4M78 B;  3PE0 A;  1MMD A;  1VQ5 T;  2DRM A;  4V2S A;  5A0G A;  3SWN C;  3HPW A;  3EG9 A;  2Y4Y A;  4J5Y A;  4AFZ C;  3SWN B;  4ATO A;  3CCU A;  4C5H A;  3NMZ C;  3CEY A;  1WFW A;  1WA7 A;  1PD1 A;  4PLL A;  4N4G A;  3RUX A;  5KE2 A;  1M5Q 1;  1VIF A;  2QTV A;  3OYE A;  4D8K A;  1M90 U;  1K9M U;  3CC2 T;  3H9N A;  3MJX A;  5CK9 A;  4M7D G;  3AHU A;  2CRE A;  1KD1 U;  4ZN1 A;  1RAF B;  4A54 A;  1RAA B;  3OSS C;  1M2V B;  4E7I A;  4MML A;  4J9H A;  4OMF B;  2KVQ G;  2LQK A;  2L3P A;  1VQO T;  3JV3 A;  3RKX A;  4EMK B;  2YDL A;  3EAE A;  2CUD A;  2QGF B;  2GNC A;  3OS0 A;  4RTX A;  1VQ8 T;  1H3H A;  5GAM g;  2RQV A;  2P84 A;  3JCM b;  3QBY A;  2EW3 A;  1M90 C;  2E3I A;  3NPF A;  3VJP A;  2CH4 W;  3OYF A;  1U06 A;  3JCM g;  4R56 A;  1WJQ A;  1UHC A;  2V8I A;  2DKG A;  2VUB A;  3HRS A;  2DVJ A;  1PSE A;  3X25 B;  1PM3 A;  5GAN 8;  2O88 A;  2LX9 A;  1VQM T;  2K4Y A;  1AHJ B;  1QMC A;  1B07 A;  2M02 A;  5I22 A;  1I1J A;  5KYX B;  2E4H A;  2BE7 D;  1MGQ A;  1NBE B;  4J6W A;  3P8B B;  4E47 A;  1ZBJ A;  2AKK A;  3CC7 T;  1Q81 U;  2QEX T;  1M1K C;  1TU0 B;  3L2Q A;  1KQS P;  1ZX6 A;  3VS3 A;  1X27 A;  3CXC A;  4M75 G;  2D6F A;  1GBR A;  1UJY A;  2DL5 A;  5J3B A;  1JO8 A;  1OZ2 A;  4IUR A;  1VQM A;  1MV3 A;  1K8A C;  1PHT A;  4JJB A;  4RTW A;  1U1S A;  4J8O A;  1N5Z A;  2P0P A;  1YJN A;  3MPU B;  2VXF A;  2KEA A;  2H8H A;  3VUZ A;  1SHF A;  5CO7 A;  2DNU A;  3UF4 A;  4QVD A;  4M75 E;  5CCA A;  4WTO B;  2HNI A;  5KYU B;  1HK9 A;  2B8A A;  3EGU A;  1QKX A;  3CCM A;  4LDW A;  1QLY A;  5LJ3 h;  1Q82 U;  4FYV B;  3S3O A;  1VQ9 T;  1S1N A;  2F2W A;  4M4Z A;  3VU3 C;  3OW2 A;  2CP5 A;  1MMG A;  4Z8A A;  5GAO m;  1KC8 C;  5KYY B;  1TG0 A;  1UGV A;  3CME Q;  2K3B A;  1ZSG A;  2CUB A;  2DXB A;  1Q86 U;  4MDW A;  3G6E Q;  3OB9 A;  3I5R A;  2E1H A;  3M5A A;  5GJW B;  1NPP A;  1OEB A;  4EMK C;  1XQH A;  4LNP A;  2KXD A;  2BZ8 A;  4JS5 A;  4EIK A;  2E41 A;  2EYX A;  2DAQ A;  2LT1 A;  2HAX A;  1KQS A;  2L3S A;  4PJJ A;  3ASK A;  2XU8 A;  2LMJ A;  1YIT A;  2XI9 A;  1AWX A;  1HXD A;  4BY6 C;  3OSV A;  1D0X A;  2DYI A;  2BIV A;  2YXY A;  1E6G A;  3NFC A;  3TRE A;  5KH6 A;  2QA4 Q;  5DLQ E;  2FL7 A;  2JOY A;  3I5S A;  3J81 E;  2AK5 A;  2D8H A;  1LOJ A;  2VV5 A;  4M7D F;  2VAS A;  5FU7 C;  4C0F A;  1K8A R;  1ZQ1 A;  2ZAE A;  1VA7 A;  2DTH A;  5GAN 7;  1K1Z A;  2DZC A;  2R5M A;  2C0I A;  3SFM A;  3G4S Q;  2LJ0 A;  2DJQ A;  3DB3 A;  4QVC A;  2JJ9 A;  5KYW B;  1QWF A;  2MWO A;  1BKB A;  4M78 G;  4QW2 A;  3CC4 Q;  2GF7 A;  4BB7 A;  3S3M A;  3INZ A;  3S6W A;  1Q81 C;  2KBT A;  4LN2 A;  1HSQ A;  4DBR A;  3OYH A;  2E12 A;  4JJD A;  3CCL A;  1VUB A;  4CC3 A;  1QVG P;  3CCL Q;  3I55 Q;  5GAN j;  3WXM B;  2ZCF B;  3V8J A;  3X20 B;  1YFN A;  4X34 A;  1OZ3 A;  2E64 A;  1QVG S;  5LJ3 d;  2RJE A;  3M0S A;  4M77 B;  4BE2 A;  1YJW T;  2PVO B;  3ER0 A;  5LJ3 j;  2EWN A;  1KHI A;  2LNH B;  4IUV A;  3EH1 A;  1LNX A;  4RCC A;  2CH4 A;  3QYG B;  4M7D D;  1S72 A;  3L1A A;  3MO8 A;  1QQJ A;  4M77 G;  1FMK A;  3V7S A;  4ZGJ B;  1K0X A;  5D6W A;  4ELZ C;  4C8Q D;  2OAU A;  2XID A;  1YWO A;  3RMS A;  4M78 A;  4ZGE B;  1K9M R;  2HZY A;  3DLM A;  4HCK A;  3OYY A;  1JXO A;  1N27 A;  4C8Q A;  1VQ9 Q;  5GAO l;  3H6Z A;  3PT9 A;  1H92 A;  4F04 B;  1KQS S;  3OW2 S;  2MYS A;  3LH5 A;  2KT8 A;  2MI6 A;  3L42 A;  2SRC A;  4NS5 A;  1WHJ A;  2X35 A;  2X51 A;  2L8D A;  4O6J A;  1YP5 A;  1PC0 A;  2OTJ A;  1VQ7 T;  3H0H A;  3EH2 A;  1RAI B;  1E6H A;  1WHM A;  4XTW A;  3EG3 A;  5LJ5 g;  2E70 A;  2FPE A;  2LQN A;  1QWE A;  1G5V A;  4AG2 C;  1SKU B;  4RG2 A;  2RK2 A;  5GAM h;  1WHH A;  2P0Q A;  1SEM A;  2F69 A;  3ME9 A;  1X2Q A;  1A0N B;  1M30 A;  1ZUU A;  4KRT A;  4C92 B;  3GF5 A;  2V1Q A;  1WXT A;  1QVF A;  1YI2 A;  5CKB A;  2CDT A;  5AYF A;  5IAY A;  3FB9 A;  4PK4 A;  2GTJ A;  1UJ0 A;  2CSQ A;  4E6R A;  1U1T A;  1B34 B;  1AOJ A;  2V1R A;  2FVU A;  1RAC B;  1X6B A;  4TVR A;  2ZPB B;  5LJ3 f;  2XDD A;  2DVE A;  2ROT A;  2O31 A;  2IPO B;  3C12 A;  4E7H A;  2V26 A;  3VS5 A;  1WJS A;  4Y92 A;  5IHN A;  3GOX A;  1CKA A;  2QK0 A;  5A2Q E;  2WSC E;  3S3N A;  3M54 A;  2KY9 A;  2J6K A;  2HQH A;  3CC4 T;  1D3B A;  1ZSZ B;  4FYW B;  4M7A D;  1T0J A;  3G1J A;  4YTL A;  1NEG A;  2FZK B;  2NUT B;  3QPH A;  1K8A U;  1P92 A;  1RUW A;  3LWH A;  2KDS A;  3JCM J;  4LD6 A;  3A5Z B;  1W2B S;  1VQ6 Q;  4M75 F;  2K79 A;  3A8O B;  4C5I A;  4F16 A;  4Z88 A;  5HK0 A;  2AKL A;  2W10 A;  2RI3 A;  3U23 A;  1G83 A;  1MMA A;  3ZBD A;  4JZ4 A;  1WGS A;  1TXQ A;  3UWN A;  4C8Q B;  2QEX Q;  3CC7 Q;  4KBM B;  3M57 A;  3OS1 A;  2Z0W A;  1JRI A;  4ANJ A;  1V76 A;  2JM8 A;  4PJO C;  2LCS A;  4BAC A;  1YN8 A;  1CKB A;  3A1P A;  1FMV A;  2QQR A;  1JJ2 A;  1J3T A;  3OYD A;  5LJ5 e;  4OGC A;  1BBZ A;  2HBW A;  2RHU A;  4RKU E;  2F1L A;  2KI7 A;  2RK1 A;  2CYZ B;  3OYJ A;  1LPL A;  2MAM A;  1YI2 T;  2DTO A;  5ECA A;  4ZTJ A;  2E6N A;  4N0A A;  4HCB A;  4GLM A;  1KFZ A;  1WPY A;  1YBY A;  4HA8 A;  1ABQ A;  5CQY A;  2EBP A;  2QAZ A;  7AT1 B;  2EQU A;  3I55 A;  4EMK A;  2EKH A;  3OYB A;  2YWW A;  2QA4 A;  2DL3 A;  2ENM A;  1BI0 A;  4IIM A;  4OVA A;  4BDZ A;  3CCR A;  2HEQ A;  3V7C A;  4FSX A;  2IVW A;  2NYS A;  2AHJ B;  2FB7 A;  3CCM T;  1QW1 A;  3IQL A;  2ECZ A;  4BE0 A;  4JZ3 A;  3LX7 A;  2QDY B;  3E9G A;  3UDC A;  2HKN A;  3CC7 A;  1D1B A;  3C0C A;  1PG5 B;  3OYA A;  2LC4 A;  4A4E A;  1ZUK A;  2ZGW A;  2D1X A;  1QVG A;  3TVT A;  1UTI A;  4HVW A;  2EYW A;  1K73 C;  2WSF E;  1I07 A;  1CSK A;  4A53 A;  4MZM A;  1RAG B;  2DZ9 A;  1N8R U;  4MMK A;  2L2P A;  1RAH B;  4LUD A;  1O75 A;  2C0O A;  4UC4 A;  5FWB A;  3VS6 A;  9ATC B;  4E2F B;  2RHZ A;  1D0Y A;  8AT1 B;  2JXB A;  1K76 A;  1Y96 A;  2OTL A;  3M4G A;  3MCA B;  3PVQ A;  2VVK A;  2QYZ A;  2K5F A;  1OQK A;  2RI5 A;  4LUE A;  1H3Z A;  2EAY A;  5GAN 5;  4FSS A;  2QI2 A;  3JCM Q;  4M77 C;  1WLP B;  2B86 A;  2EQK A;  3QJ6 A;  1KHC A;  1YJ9 Q;  1PSF A;  2QQB A;  1VYT A;  1VQ4 Q;  1NE8 A;  2RD1 A;  3JCM h;  2ZPE B;  2DRK A;  3QKJ A;  3OYC A;  4IKF A;  2LCC A;  4C92 F;  1YI2 Q;  3GNG A;  1WQW A;  2RQR A;  1M2O A;  4C92 A;  1IB8 A;  3QO3 A;  1VQP T;  1UGS B;  4Z89 A;  1C0M A;  1RI0 A;  1GRI A;  2DFU A;  1YIJ A;  2CSI A;  1NLP C;  4NOY A;  1IO6 A;  3JCM X;  2K2M A;  2CZ6 B;  3C94 A;  4PJO F;  4RUG A;  3VRY A;  2DL8 A;  4D8D A;  3TQ7 P;  1PKT A;  1KK7 A;  1GL5 A;  4D6W A;  3WVD B;  3A8M B;  1AD5 A;  2DXU A;  4M77 E;  3OYG A;  4E7L A;  2D0Q B;  1IHW A;  1BI2 A;  3CCJ A;  1W70 A;  4DEY A;  1Y0M A;  1T0H A;  4M77 F;  1M1F A;  3G71 Q;  2DO3 A;  5GAM d;  3QUI A;  1UG1 A;  1Y7X A;  4CC2 A;  2J6O A;  1G3S A;  3PFS A;  5J26 A;  2DEU A;  3JCM e;  3RBB B;  1VQO Q;  2COZ A;  3FRN A;  3R6O A;  2PUO B;  2YRV A;  3X24 B;  3CXC P;  4J6Y A;  2F2V A;  2OTJ Q;  1BCO A;  6AT1 B;  2FPF A;  2H3E B;  2DLP A;  2NUP B;  1EIF A;  1W2B A;  2CT3 A;  2X3X D;  3L2R A;  2DL4 A;  3PVL A;  3CD6 Q;  2A08 A;  3CD6 T;  4KUI A;  1M27 C;  1GFC A;  2ZPG B;  3HFN A;  3CD6 A;  4L59 A;  1LVK A;  4OMQ A;  4OML A;  3CMA T;  5GAN 3;  2ZZD A;  2RQT A;  4XAX B;  3EFO B;  3LYI A;  3M9Q A;  4XK8 E;  1U8R A;  3X26 B;  1UEB A;  1K73 U;  3MP8 A;  2YUN A;  2NUP A;  4LXC A;  2SEM A;  2VWF A;  4KH1 B;  5L23 A;  2WSE E;  1N8R R;  4Q5W A;  4JJC A;  3UA7 A;  2JTE A;  4J9C A;  4A4K A;  5IHI A;  4F7U A;  2LCL A;  2DEQ A;  1FYN A;  1ZLM A;  2KT1 A;  3RKW A;  3JCM W;  4A4G A; 
#chains in the Genus database with same CATH homology
 5GMK h;  2K3X A;  3BW1 A;  4IUT A;  1FXX A;  3X20 B;  4MZT A;  4OP0 A;  3LGF A;  3OBW A;  3PGG A;  4X34 A;  1OZ3 A;  2E64 A;  1QVG S;  2IG0 A;  1QVP A;  5LJ3 d;  2F5T X;  2RJE A;  3PNW C;  4M77 B;  5A0D A;  4BE2 A;  4F7U G;  4OB2 B;  3JCM f;  1YJW T;  2PVO B;  1KD1 C;  3ER0 A;  3CCU T;  2L5Q A;  4JDS A;  2HQE A;  2F5K A;  1XOV A;  4BDY A;  5LJ3 j;  3GPL A;  4XTZ A;  3MP6 A;  2EWN A;  3FJP A;  3OBY A;  5LJ5 h;  1KHI A;  2GCX A;  4L6V 5;  3GNF B;  4C0D B;  2O4X B;  1SSF A;  3NTI A;  4IUV A;  4OB0 B;  3I56 T;  4M78 C;  4PJO A;  3L2V A;  3HSB A;  1FX7 A;  1LNX A;  3CMA A;  4RCC A;  5I21 A;  4J7I A;  4FT2 A;  5KCO A;  3QYG B;  2LTO A;  3OMG A;  2VYT A;  3L1A A;  1S72 A;  3QYH B;  4M7D D;  1VQ5 A;  2PU9 B;  3MO8 A;  2X4J A;  2OTJ T;  4M77 G;  2CGH A;  2LT4 A;  3FEO A;  1Y71 A;  5GAO r;  3V7S A;  4ZGJ B;  3ZFJ A;  3M56 A;  5D6W A;  4ELZ C;  2DJZ A;  4C8Q D;  2OAU A;  3KXT A;  3WXM B;  1GXI E;  4M75 B;  2RJD A;  3HL8 A;  3QDR B;  2XID A;  3RMS A;  2CZ7 B;  4B9X A;  4M78 A;  4C0Z A;  4ZGE B;  3V7R A;  4BD3 A;  2PQW A;  4IUP A;  4ME7 A;  2PVG B;  4ELY C;  3CCE A;  3DLM A;  1KG1 A;  2LVM A;  3OYY A;  2V8J A;  3ZEH A;  4M7D A;  1QP3 A;  1UGR B;  1N27 A;  5GAO q;  2CZ0 B;  4C8Q A;  3A8H B;  1I4K 1;  5GAO l;  3H6Z A;  5L8R E;  2H3J A;  3BY7 A;  4PJO D;  3PT9 A;  4PNO A;  3Q1J A;  5GAM e;  4C8Q F;  3HRT A;  5LJ5 f;  1KQS S;  3OW2 S;  2LNV A;  3PMI A;  2MI6 A;  4RCB A;  5GMK l;  3L42 A;  3QZ9 B;  2E10 A;  3X28 B;  3OS5 A;  4NS5 A;  1VQN T;  2X35 A;  2XDB A;  2X4X A;  3CC4 A;  2L8D A;  3JB9 I;  4O6J A;  4OB3 B;  1YJN T;  2MF2 A;  2OTJ A;  1VQ7 T;  1OI1 A;  4HCZ A;  2QQA A;  4LDV A;  2FYK A;  4N0A C;  4JRQ A;  3PTA A;  3MET A;  4XTW A;  5CKD A;  2M1H A;  3E1S A;  2RJF A;  3JCM P;  1M4Z A;  2CZ1 B;  5D6Y A;  5LJ5 g;  2E70 A;  2EQJ A;  1KC8 U;  2X4Y A;  2K5I A;  2RO0 A;  3FLG A;  4J83 A;  4E7K A;  4O5V A;  4BI8 B;  1BIA A;  2K57 A;  1G5V A;  3FC3 A;  1WNL A;  2XK0 A;  4RG2 A;  2RK2 A;  5FRO A;  3TU4 K;  5GAM h;  3A8G B;  3SD4 A;  3V8L A;  2P0Q A;  5CKE A;  4BI3 A;  3C4S A;  2F69 A;  3ME9 A;  1M9S A;  5GAN 6;  5FU6 B;  1N6A A;  2DXT A;  3GF5 A;  4C92 B;  3GP8 A;  1QVF A;  4IUU A;  1YI2 A;  2EIF A;  5CKB A;  3JRZ A;  1N8R C;  1VQ8 A;  3NTH A;  5AYF A;  1H64 1;  3SB2 A;  2XG8 D;  3RMQ A;  3OYM A;  2R58 A;  4QVZ A;  5IAY A;  4C92 E;  3FB9 A;  3GIB A;  2YLB A;  5GMK i;  4M75 A;  3V8K A;  1U1T A;  3QG1 A;  1B34 B;  3RES A;  4LDU A;  4BI4 A;  5GAO p;  4LDX A;  3CCS A;  2XKO C;  3KUF A;  2KSS A;  5I2S A;  1Q86 C;  5HY6 A;  5FRM A;  3BDU A;  2Y90 A;  2FVU A;  4OF1 A;  5CKH A;  4TVR A;  3VUB A;  2LDM A;  1VQP A;  2ZPB B;  5LJ3 f;  2XDD A;  3OA6 A;  4EPC A;  2DVE A;  4C0D C;  3M58 A;  5A0L A;  4PJO G;  2L3R A;  1JBM A;  5FU7 B;  3C12 A;  3OYL A;  4E7H A;  3G4S T;  5LL6 S;  3PIO A;  5IT9 E;  2YLC A;  4JLI A;  1WJS A;  2DD5 A;  2M0O A;  4JLG A;  3GOX A;  3CCV T;  2I2L A;  2D9T A;  5A2Q E;  4PJO E;  1BIB A;  2EJ9 A;  2WSC E;  4FM4 B;  5GAM j;  2PVD B;  3M54 A;  2KY9 A;  3S3N A;  2DTI A;  3CC4 T;  1D3B A;  4E7J A;  2Y4X A;  3MEU A;  1VQ4 T;  1YJ9 T;  4EMH A;  4M7A D;  5GMK m;  5GMK e;  4YTL A;  4HCC A;  2MWP A;  3TEE A;  1LJO A;  2FHD A;  4ZN3 A;  3QPH A;  1K8A U;  1P92 A;  4C92 G;  4N4H A;  1BI3 A;  3VKI A;  3OYI A;  3LWH A;  2KDS A;  1N9R A;  3GLX A;  4LD6 A;  4C5E A;  3DKM A;  5M9O A;  3JCM J;  3A5Z B;  5GAN h;  4PJO B;  2JTM A;  2V8K A;  3P8D A;  4GY5 A;  3F70 A;  1W2B S;  3O8V A;  4XTU A;  2GFU A;  4CI0 C;  3URG A;  5HKC A;  2EQM A;  1Q7Y U;  4J6X A;  3CBP A;  1BI1 A;  4VUB A;  4BY6 B;  3EFS A;  4M75 F;  2E65 A;  3A8O B;  4C5I A;  3H8Z A;  3CCR T;  5C0M A;  5HK0 A;  4BE1 A;  3UT1 A;  2M16 A;  2RI3 A;  3OY9 A;  5CQX A;  3QHS A;  4PKC C;  3LW5 E;  1KQ2 A;  3CCE T;  3ZBD A;  4NL2 A;  1WGS A;  1K9M C;  1G3T A;  1I8F A;  2E6Z A;  3UWN A;  1I5L A;  5LJ3 e;  3CPW A;  4M7D B;  4C8Q B;  3CXC S;  4LD9 K;  3J7A F;  4KBM B;  4M78 B;  3UPU A;  3M57 A;  3I56 A;  3OS1 A;  3HHT B;  5D6X A;  1VQ5 T;  1JRI A;  1YIT T;  1TH7 A;  2VXE A;  2EJF A;  3T9N A;  5A0G A;  4PJO C;  4V2S A;  2HQX A;  3SWN C;  3HPW A;  2XHC A;  5I2M A;  4BAC A;  2Y4Y A;  4J5Y A;  4DOW A;  2RB6 A;  3SWN B;  4ATO A;  2DD4 A;  5CAI A;  2RHX A;  2QQR A;  4JRI A;  5GAN g;  3OYK A;  1JJ2 A;  3OYN A;  3L2Z A;  2KK4 A;  4JRP A;  2EKO A;  4M78 F;  3OYD A;  2O01 E;  5LJ5 e;  4C5H A;  4R55 A;  3CCU A;  3CEY A;  4OGC A;  1Q7Y C;  4RKU E;  2RHU A;  3JB9 D;  2G3R A;  4JUV A;  2RK1 A;  2ZPI B;  3M53 A;  4M78 E;  4XU3 A;  3JCM V;  4DQ2 A;  2CYZ B;  4M7A A;  3OYJ A;  4PLL A;  2MAM A;  4N4G A;  1YI2 T;  4M7D E;  2DTO A;  3RUX A;  5KE2 A;  4ZTJ A;  2RHY A;  1VIF A;  1M5Q 1;  3MP1 A;  2P0K A;  3OYE A;  1M90 U;  1K9M U;  2E6N A;  4EDU A;  3CC2 T;  4QQ6 A;  3N5B B;  3EFR A;  4N0A A;  1VQ4 A;  1YJ9 A;  1QP2 A;  4HCB A;  3MHX A;  1WPY A;  4M7D G;  5CK9 A;  4OB1 B;  3VV0 A;  3AHU A;  1YBY A;  4HA8 A;  5CQY A;  3M4Y A;  3HFO A;  3V8J A;  4ZN1 A;  4C5G A;  5J39 A;  3JAM E;  4C92 D;  1KD1 U;  1O9S A;  4A54 A;  2EQU A;  4F7U B;  3I55 A;  4EMK A;  3OYB A;  3OSS C;  2QA4 A;  4E7I A;  4A4F A;  4MML A;  1VQ7 A;  3SDZ A;  2BUD A;  4OMF B;  3OS2 A;  1BI0 A;  2KVQ G;  3CCQ T;  2LQK A;  2QQS A;  3OMC A;  4OVA A;  4BDZ A;  1VQO T;  3CCR A;  3RKX A;  3V7C A;  4FSX A;  2IVW A;  2NLU A;  4L5G A;  4EMK B;  1I81 A;  2AHJ B;  2FB7 A;  3CC2 A;  1V29 B;  4KUD K;  3CCM T;  3HRU A;  2JN0 A;  2KQW A;  1QW1 A;  3EAE A;  3OQ5 A;  4BE0 A;  2YHT A;  4OGE A;  3OS0 A;  3FDR A;  3LX7 A;  1OYX A;  2QDY B;  4BUG A;  1VQ8 T;  3E9G A;  2QEX A;  4MZP A;  4XTX A;  3UDC A;  5GAM g;  3CC7 A;  3JCM b;  3QBY A;  2PUK B;  3HKS A;  3JCM c;  1M90 C;  1YHQ A;  3CPF A;  1VQ6 A;  3VJP A;  3OYF A;  3JCM g;  4R56 A;  3JB9 F;  3OYA A;  2LC4 A;  4A4E A;  1WJQ A;  2ZGW A;  1VQO A;  1QVG A;  2V8I A;  2DKG A;  3DB4 A;  1M1K U;  2VUB A;  4M78 D;  3HRS A;  1K73 C;  3LGL A;  2WSF E;  4M7A G;  1PSE A;  3X25 B;  2QA4 T;  4M7D C;  5GAN 8;  3E19 A;  2LX9 A;  1VQM T;  4A53 A;  2K4Y A;  1AHJ B;  4GLK A;  4MZM A;  3G4S A;  1IZ6 A;  2DZ9 A;  1N8R U;  2RM4 A;  3CBO A;  4MMK A;  4CRI A;  4WF2 A;  3QSU A;  1NJI U;  3RIR A;  3FIF A;  4C8Q E;  1O75 A;  1Y07 A;  4UC4 A;  5GAN 4;  4C92 C;  2R5A A;  2RHZ A;  1YHQ T;  1MGQ A;  4J6W A;  4E47 A;  1Y96 A;  3P8B B;  2OTL A;  3CME A;  3M4G A;  1Q82 C;  1KQ1 A;  4II1 A;  3CC7 T;  3MCA B;  4XTV A;  3G71 A;  3A8L B;  3LH0 A;  3RKY A;  4HKE A;  2QEX T;  1Q81 U;  5LJ5 d;  1M1K C;  2QXF A;  5FLX E;  2K5F A;  3L2Q A;  2RI5 A;  4FL6 A;  3QII A;  1H3Z A;  2EAY A;  3E9F A;  2A3L A;  1DJ7 B;  5GAN 5;  2QI2 A;  4QQG A;  4A4H A;  3JCM Q;  3CXC A;  4M75 G;  2D6F A;  2K5L A;  4M77 C;  1UGP B;  2HBP A;  3QJY A;  2RHI A;  3DLL A;  3CCQ A;  2M9U A;  1VQK A;  2WAC A;  5J3B A;  1OZ2 A;  2EQK A;  2X4W A;  4IUR A;  2RJC A;  3HP9 A;  3QJ6 A;  4M7A B;  1KHC A;  5DLO A;  1VQM A;  4N4I A;  1PSF A;  1W4S A;  2QQB A;  5GAN f;  1NE8 A;  1K8A C;  1ZBX A;  1U1S A;  2RD1 A;  3JCM h;  2ZPF B;  2GQV A;  3G7Z A;  3JSC A;  2ZPE B;  4J8O A;  2ZPH B;  4P5N A;  3QKJ A;  5KE3 A;  1NJI C;  1QVF S;  2P0P A;  3OYC A;  1YJN A;  4IKF A;  2JVV A;  2LCC A;  3KBG A;  4C92 F;  5GMK j;  2VXF A;  3GNG A;  1WQW A;  3VUZ A;  4X9C A;  1VQ6 T;  2BKD N;  5KCH A;  1XTD A;  5CO7 A;  4C92 A;  3WVE B;  4QVD A;  3QO3 A;  1VQP T;  3BDL A;  1UGS B;  1M1G A;  4M75 E;  2O4X A;  4XU0 A;  1RI0 A;  5GAM f;  4IUQ A;  5CCA A;  1YIJ T;  1YJW A;  2HNI A;  1UB4 A;  1YIJ A;  3MEA A;  1Y96 B;  3PMT A;  1HK9 A;  1XNI A;  2B8A A;  4NOY A;  3CCM A;  3JCM X;  2CZ6 B;  3C94 A;  4LDW A;  4XTY A;  5LJ3 h;  3L2U A;  1G3Y A;  4PJO F;  1Q82 U;  3S3O A;  4HT9 A;  1VQ9 T;  3L2W A;  4JJN K;  2DPP B;  4JS4 A;  3CCL T;  3VU3 C;  3OW2 A;  5IN1 A;  3JB9 H;  4DA4 A;  1VQL A;  5HK3 A;  4NL3 A;  5GAO n;  3M59 A;  4C8Q G;  4D6W A;  1S72 T;  3WVD B;  3A8M B;  4Y91 A;  2DXU A;  5GAO m;  3LWI A;  3CBM A;  1IRE B;  4M77 E;  2D0Q B;  2K3Y A;  3OYG A;  4E7L A;  1KC8 C;  1BI2 A;  4FT4 A;  1D3B B;  4X9D A;  3CCJ A;  4MDX A;  2JNG A;  2QTX A;  4M77 F;  1M1F A;  4M7A C;  2DO3 A;  2KAF A;  4RG8 A;  5GAM d;  3QUI A;  1Y7X A;  2LQ8 A;  2L89 A;  4Y28 E;  2DK3 A;  2DXB A;  2QQ9 A;  1Q86 U;  4M77 A;  1G3S A;  3PFS A;  5J26 A;  4FIB A;  3JCM e;  4FU6 A;  1VQK T;  3RER A;  4PLI A;  4KUL A;  3FRN A;  3R6O A;  2PUO B;  4MDW A;  2RI2 A;  2DXC A;  2YRV A;  3X24 B;  4RMO A;  3OB9 A;  2E1H A;  4PL6 A;  3G6E T;  4J6Y A;  1RL2 A;  1X01 A;  3M5A A;  4HT8 A;  5CR2 A;  2OTL T;  3G6E A;  1MHN A;  1NPP A;  5LJ5 j;  4EMK C;  1XQH A;  2E5Q A;  2EJG A;  3CPW S;  4M75 C;  4XU2 A;  4Z02 A;  2P4T A;  2JTF A;  4JS5 A;  4C0G A;  2E41 A;  4KT0 E;  2DAQ A;  3G71 T;  2LT1 A;  2HAX A;  1KQS A;  4XQ3 A;  1EIF A;  3CME T;  1W2B A;  4DOV A;  4B9W A;  3ASK A;  5C6S A;  2XU8 A;  2CS7 A;  3JCM d;  3L2R A;  2XI9 A;  1YIT A;  4ZTF A;  2MMP A;  4JRK A;  3CD6 T;  2A7Y A;  2RH2 A;  4KUI A;  4EMG A;  3J80 E;  1X75 C;  3CCJ T;  2VGM A;  1HXD A;  2ZPG B;  3HFN A;  4L59 A;  2EFI A;  4BY6 C;  3CD6 A;  3QXE B;  2K2V A;  3OSV A;  5FU6 C;  2XDP A;  2BIV A;  3NFC A;  2XD0 A;  3TRE A;  2KMT A;  5KH6 A;  4M75 D;  2JZ2 A;  1M8V A;  5CVI A;  5DLQ E;  5DY9 A;  2FL7 A;  1VQL T;  4XU1 A;  2JOY A;  3CMA T;  2GFA A;  2RA2 A;  2CKK A;  5GAN 3;  1NPR A;  2ZZD A;  3J81 E;  1VQ9 A;  2VC8 A;  3VYH B;  2LRQ A;  1WJR A;  1LOJ A;  2VV5 A;  2DIG A;  4M7D F;  2DIQ A;  5DM7 R;  3LYI A;  4XAX B;  3BFM A;  3M55 A;  3M9Q A;  3NTK A;  4XK8 E;  3VYG A;  4M7A E;  1R8O B;  1U8R A;  5FU7 C;  3X26 B;  1YCY A;  1UEB A;  5CIU A;  4C0F A;  1ZQ1 A;  4M77 D;  3C95 A;  1K73 U;  2DTH A;  4M7A F;  1N9S A;  3MP8 A;  2JUF A;  1G3W A;  5GAN 7;  3PIP A;  5FRN A;  2DZC A;  2R5M A;  5GAN e;  5GAN 2;  3TCJ A;  3SFM A;  4ZGD B;  1X6O A;  1FWZ A;  3JB9 G;  3DB3 A;  4QVC A;  3I55 T;  4F7U E;  1VIE A;  2C06 A;  2WSE E;  2XIC A;  2MWO A;  2EYQ A;  5CKF A;  4Q5W A;  4F7U F;  1BKB A;  3CCV A;  4C8Q C;  2HD0 A;  4M78 G;  4QW2 A;  4A4K A;  3MEW A;  1JJ2 S;  2GF7 A;  4F7U A;  4BB7 A;  3S3M A;  3INZ A;  2LCL A;  3S6W A;  3MEV A;  1B34 A;  2VGN A;  3P8H A;  1Q81 C;  3OYH A;  1WQ7 A;  4LDY A;  2E12 A;  5LJ3 g;  3JB9 J;  5GAN d;  1UGQ B;  3CCL A;  1NZ9 A;  1VUB A;  3LLR A;  1BYM A;  2DEQ A;  3SWN A;  2R57 A;  3RKW A;  1JB0 E;  3JCM W;  4A4G A;  3CCS T;  4QQD A;  3QZ5 B;  5EG2 A;  1VQN A;  5GAN j;  4J7F A;  1ZHI A;  2ZCF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...