2PVOB

Crystal srtucture of the ternary complex between thioredoxin f, ferredoxin, and ferredoxin: thioredoxin reductase
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
74
structure length
74
Chain Sequence
b'MNVGDRVRVTSSVVVYHHPEHKKTAFDLQGMEGEVAAVLTEWQGRPISANLPVLVKFEQRFKAHFRPDEVTLIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-thioredoxin reductase, catalytic chain
publication title Structural snapshots along the reaction pathway of ferredoxin-thioredoxin reductase.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Electron transport
total genus 11
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02941 FeThRed_A Ferredoxin thioredoxin reductase variable alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2pvoB00
3WVDB 4Y28E 2CZ6B 3X28B 1DJ7B 2DD5A 3QZ5B 3VYGA 4L6V5 2ZPHB 4KT0E 2PVDB 2DXBA 1UGSB 1PSEA 3X20B 4ZGDB 4ZGJB 1JB0E 2ZPBB 2AHJB 1UGQB 1QP3A 2CZ1B 2ZPEB 2PU9B 1IREB 3A8MB 2PUOB 4OB3B 4OB2B 3X25B 3A8HB 2PUKB 3QYGB 2WSEE 3QXEB 1V29B 3X26B 3WVEB 1UGRB 2PVOB 4ZGEB 4FM4B 2WSFE 2O01E 4OB0B 3LW5E 2ZPGB 3A8GB 2DXCA 2WSCE 2QDYB 3QYHB 2CYZB 2ZPFB 2DD4A 3HHTB 3VYHB 2CZ0B 5L8RE 4OB1B 1QP2A 2DPPB 3A8LB 4XK8E 1UGPB 1PSFA 2ZCFB 3A8OB 1GXIE 2D0QB 2ZPIB 1AHJB 4RKUE 2CZ7B 3X24B 3QZ9B 2PVGB 2ZZDA
chains in the Genus database with same CATH superfamily
1WHHA 2DL5A 2ED0A 1MV3A 1AZEA 1I5LA 2FEIA 4LN2A 4R56A 4ZTJA 1NJIU 2H8HA 5GAMd 4PFPA 2KQWA 1YNZA 3QIIA 1K9MU 2AK5A 4L6V5 3SB2A 1VQPQ 2DL7A 5GAN4 3SEMA 2DXUA 5J39A 4PFOA 1ABOA 2X3WD 3GPLA 3MEVA 1U06A 3UT1A 1G3WA 1TOVA 4AT1B 3L2QA 3RIRA 1QP3A 2O9SA 5CK9A 1ZBJA 2CH4A 2L3QA 2K5LA 2DIQA 3M58A 1RADB 3CCJT 5KYNA 3JCMW 3OBYA 1UGRB 3PMIA 4DEYA 2QEXQ 3OYEA 1RAHB 1KC8U 1OZ2A 5AT1B 3RNJA 1VOMA 1S1NA 2AT1B 2DVJA 1T0JA 4A4EA 2LNHB 5GAN3 2DERA 1MHNA 3OYGA 3OS2A 5L23A 4KUDK 2LCSA 4EPCA 1FMWA 3EG9B 4M7DE 2QTXA 5J3BA 1V76A 1G83A 1RI0A 2PNIA 3L1AA 1GCQC 3EHQA 3DKMA 4KRTA 3CPWS 1AT1B 1PG5B 1U1TA 3GNFB 2YRDA 4LUEA 2ECZA 1TXQA 1JEGA 1SHGA 2FZGB 1VQ8Q 1B3QA 5GAOq 3OSVA 3CPWP 1T0HA 1I8FA 1BK2A 2A37A 1JJ2A 2PTKA 1VQLT 2DAQA 4RTTA 2XHCA 2CP6A 4Z89A 4DBQA 4FW2A 2DD5A 1G3YA 4NL2A 1WJSA 1U1SA 4A63B 3QDFA 2COYA 4XTUA 3G4SA 4E7LA 2ZAEA 4J9CA 1X43A 4IUPA 3VS0A 3FJPA 2RO0A 4A53A 3WXMB 1XQHA 1BCOA 4D8DA 5LJ5d 2KRSA 1G8XA 1N6AA 2RF0A 4TVRA 4M7DG 2JTEA 1OX8A 2J6KA 2CKKA 1XJWB 1E6GA 1M90C 2DBKA 3A8HB 2IIMA 3QYGB 4YTLA 4GLMA 4OGCA 2KI7A 2DNUA 2E5QA 1W1FA 4LNPA 2K5IA 4LXCA 2VXEA 2YXYA 1YJNT 3CC7T 3CCSA 4IUQA 4F7UE 2V8IA 2RK2A 3QO3A 3LW5E 1KQSP 1Q86C 3QKJA 4A4GA 1KFZA 1X6BA 1ZSZA 4J9DA 4C92A 1PWTA 1R0CB 1VQ7Q 1NJIR 3OW2A 2GQIA 1ZSGA 1F1BB 4OB1B 1K9MR 1VQ5T 1UJ0A 2LVMA 3M5AA 1D0YA 2KROA 4KUIA 2XKOC 1LPLA 3CCLT 1IB8A 3MKDA 1K0SA 1N5ZA 2P0PA 3INZA 3EG3A 3QJYA 3R6OA 1K1ZA 4J9GA 2KGTA 5FW9A 4CRIA 3SWNB 2OTJT 1X2KA 1BI1A 3CQTA 2FZKB 1R8OB 3TSZA 2RI5A 1DJ7B 3QZ5B 1H92A 5IXFA 1SPKA 3BY7A 2EGAA 5LJ3j 1M3AA 3OSSC 4ZGDB 2V8JA 2MCNA 1SKUB 3AT1B 1VQMQ 2A36A 3S6WA 4M77E 3I5SA 1Q95G 2Y90A 1KC8R 1N9SA 4OMPA 3G6EA 1SHFA 2KR3A 2RJFA 4LD9K 1YJNQ 2JJ9A 5CCAA 4BB7A 2ESWA 1S72A 3FRNA 1VQOT 3QHSA 5CKDA 3JRZA 1BIAA 3HSBA 2M0YA 3OYCA 3A1PA 1JBMA 3E9FA 2M9UA 4Y92A 3OYIA 3I35A 2PVOB 1M9SA 2NWMA 1GFDA 3RR6A 4OVAA 1T3SA 5CQXA 4CC4B 3PNWC 5GANj 3JCMV 3CCUQ 2K7AA 4M75E 1PM3A 2QGGA 2GF7A 2RQUA 2X35A 1W2BP 5FRMA 1M3BA 4M7AD 4L59A 1VQPA 1QVFP 5GAN2 1OYXA 5LJ3d 2OTJQ 5GMKl 2F69A 3LH0A 3ULRB 1SRLA 4IUVA 2K3XA 2ROLA 4WCIA 3CD6T 4M77G 4LDXA 4BI4A 1PCXA 4LUDA 1SEMA 2KT8A 3M0RA 2VXFA 3OY9A 1AWJA 3PIOA 5FWCA 2ABLA 4M7AB 1W70A 5KYUA 2MAMA 4M7AF 4E7KA 3I55A 2LX7A 1IGQA 1VIFA 3CMET 4LE9A 1NLOC 3KBGA 4JLIA 3V8LA 1HXDA 3DLMA 4ME7A 4ZGJB 1I4K1 4JJDA 5IHKA 1RAFB 2BKDN 3OS1A 4J9IA 1JB0E 3TQ7P 1YJ9A 3THKA 4ELYC 1MMAA 2FPFA 4DOWA 2MOXA 2FZCB 4PJOC 2ENMA 2IVWA 4FT2A 2QYZA 5GMKh 2JM9A 2KVQG 1NZ9A 2RM4A 4HCCA 2KT1A 2GBQA 1YFNA 2RJCA 2NUTA 2FG0A 1A0NB 1Z9ZA 1D1BA 1ZSZC 2SEMA 2I2LA 4C92C 1OZ3A 4LDUA 4Q5WA 4O6JA 1VQ8A 3ER0A 4XU1A 4C8QD 4MMKA 2GTOA 2JT4A 2EQMA 2DRMA 2MF2A 4MDWA 3CPWA 3OYYA 2XD0A 3D7SB 1N8RU 1B34B 3HFNA 4FW1A 1AOJA 3U23A 2H3EB 1K73U 2XICA 3VRZA 2C0OA 3QYHB 5LJ3h 4MZMA 3JCMb 2KE9A 5CKEA 1U5SA 3FEOA 1OPLA 2XIDA 1VQ6T 5L8RE 1TTHB 2EBPA 3BE3A 5FU7C 4BI8B 3QSUA 3M53A 1AD5A 1HK9A 3HTRA 4C8QB 5A0GA 2GTJA 4XTWA 3G4SQ 5I2SA 4C8QF 1T3LA 4OGEA 1PKTA 2E1HA 2A28A 4E7JA 2FPEA 4OMNA 2ZPIB 4M7DA 1R0BG 4PJNA 1LOJA 1JO8A 2KYBA 1H8KA 2J6OA 2BE9B 5D6YA 1OI1A 4C0FA 5GMKe 3O5ZA 1YITT 1I0CA 2HQHA 5EC7A 3V7CA 2B8AA 2JM8A 2M1HA 1AWOA 1LNXA 1OPKA 1M2OA 5GANh 2EWNA 1K9MC 2YDLA 4OMQA 1WX6A 3FB9A 1KQSA 2HDAA 3OW2S 3CCSQ 1BCMA 1YIJQ 1CSKA 4RTXA 1UFFA 1FX7A 2X9HA 3C95A 2BTTA 3MCAB 2A3LA 3RBBB 2LZ6B 2HBWA 3EG2A 4OB3B 4XU2A 1D0ZA 2QG9B 2E12A 4BY6C 4HA8A 1QKXA 3OQ5A 3QXEB 4XTVA 5CKFA 2JTMA 1PRLC 3OMGA 1I81A 2K6DA 1U3OA 2VASA 2JN0A 2BZXA 1M2VA 4BI3A 2FVUA 4PL6A 4C0GA 1QWFA 1ABQA 2GGRA 4Z88A 4N4GA 4JRKA 2DD4A 3VYHB 2K2MA 1I1JA 1ZUKA 5GAMj 3EG0A 5GANf 1AWWA 3S3MA 2E70A 1WA7A 3PE0A 2DYBA 3A98A 4RCBA 3JB9H 5IXBA 2RHXA 1ARKA 4M78D 3HFOA 4F7UA 4RTZA 1YHQQ 4RCCA 4A4HA 2ZCFB 1W6XA 2DMOA 1YJNA 3EGDB 4NL3A 2JXBA 4E6RA 3EG1A 3MJXA 4PJJA 3X24B 2OTLT 2JTFA 1UDLA 2OI3A 3CCRQ 4JUVA 1PRMC 3QG1A 3VS3A 4PFZA 4PJOD 3NPFA 2CP2A 3CMAQ 3CBOA 3CXCS 4O5VA 5LJ3g 3KUFA 1VQ5A 2O2OA 2PVDB 3HRTA 4M78B 1NBEB 2E5KA 1TH7A 4M78F 3JCMd 2L0AA 3CCLA 4AFQC 3I56T 2OAUA 3OB9A 1KJWA 1ZLMA 2G3RA 1N8RR 1WDXA 4FYXB 1W2BA 3CXCP 1QCNA 2XDDA 3CC4T 2NUPA 4E7SA 1K73R 2CZ1B 3IQLA 2LMJA 4F14A 5CKHA 4GBQA 1LCKA 3JCMJ 2X4XA 1AZGB 1QVFA 1RAAB 2K2VA 2OTJA 5GAOm 3H41A 2MI6A 4BACA 2EGCA 2LNVA 1KQ2A 4PJOB 3GP8A 3HP9A 2ATCB 4N0AA 4PJOF 4OP0A 4M77A 2HZYA 3WVEB 1M1KC 1Y0MA 2RQVA 2IPOB 3VS6A 2JMAA 5GANg 1X2QA 1QVGS 1GCPA 3PMTA 1BYMA 3H6ZA 2BZ8A 1XTDA 2QDLA 1WLPB 2ZGWA 1MGQA 5KYWB 2RQTA 1VQKT 2XDPA 1I5OB 1QVGP 4M7DC 2A08A 1VYVA 3I55Q 1WGSA 5KYXA 3A8LB 4HT9A 4DEXA 3J80E 4HVVA 1X75C 4EMHA 2DL8A 2R58A 1UE9A 4OF1A 1WQWA 1EZZB 4Z02A 4M75A 2QI2A 1M8MA 5KE2A 2LJ3A 4IIMA 4BDZA 1QW1A 3A5ZB 1YJ9Q 2GCXA 5FLXE 1AHJB 5LJ5j 3GIBA 3OYAA 3I56Q 2K57A 4JJBA 2L8DA 5IHNA 2VYTA 3QWYA 4FSSA 1C1AA 2KEAA 1BU1A 5J26A 1YI2T 2EYZA 3UA6A 3EGXB 3OYFA 4KT0E 2QQ9A 3PTAA 2DXBA 1ZBXA 2RHUA 4RUGA 4K11A 5KE3A 3RMSA 2NUZA 2R57A 1EIFA 3T9NA 5GAMh 1KHCA 1OEBA 1UGQB 3G71T 4XTYA 2HSEB 3P8BB 1JXMA 1RLQC 2LQKA 2EW3A 5KYYA 2DL4A 3L2WA 1XOVA 1WHJA 3CMEA 3CCJQ 2YLCA 2L3SA 5FROA 1QCFA 2X4YA 1D1CA 1D0XA 2WSFE 4F04B 3TREA 3CCVT 4C0DB 1C0MA 1HSQA 2D6FA 1RUWA 4X34A 1IZ6A 4M7AE 2WSCE 2CP0A 3MPUB 2XG8D 4FL6A 4BE1A 2GQVA 5GAOp 2DX1A 2RH2A 3NMZC 4J9EA 5KH6A 1M1KU 2DEUA 1KQSS 2O9VA 2CDTA 1MNDA 1PNJA 2RD1A 3NTKA 4QW2A 2F2VA 3C0CA 3HKSA 4XK8E 3JSCA 4EMKA 2CH4W 1YIJA 2E3IA 4XAXB 1UHCA 4CI0C 3KFVA 2DK3A 4LD6A 5GAMf 5GAN6 2QTVA 3E19A 4ZTFA 2YUNA 2CP3A 1GRIA 3QPHA 2DTHA 2RN8A 4QVZA 4WF2A 1LVKA 2EYXA 2M16A 3URGA 4RKUE 4FIBA 3VUZA 4MZTA 1YWOA 1VQ4T 2J05A 1ACMB 2RMOA 1VQLQ 3V8KA 1ZUUA 2LQNA 4F17A 2RQRA 3LX7A 1ZA1B 1VQNT 4JZ3A 3J81E 4J9FA 4A4FA 2QA4T 4HVWA 3M4GA 1PSEA 3CCMT 2E41A 5CIUA 3OYDA 4J5YA 4AMCA 4N0AC 1B7TA 3FLGA 3PIPA 2OJ2A 1WHGA 4M77C 2D9TA 4M7AG 2GFUA 2KK4A 3EH1A 3QUIA 1UJYA 5AYFA 1D3BB 2C0TA 2QGFB 4R55A 1MMNA 1WQ7A 3JCMP 2O88A 2L2PA 1YITA 4ATOA 1YHQA 1WJRA 4FU6A 4C8QE 3VS7A 4BUGA 2RA2A 5LJ5h 2HNIA 7AT1B 3LYIA 4ZGEB 3JCMg 3EG9A 3EFOB 4Y91A 3LLRA 4XQ3A 4UC4A 3CC7Q 4OB0B 1RL2A 1X01A 2KRNA 3A8GB 3CBMA 1YJWT 1HYOA 1N8RC 3ZBDA 1MMDA 3CCRA 1WNLA 4E7HA 4M75C 1JU5C 3ME9A 3CMAA 1K73C 1VYTA 5GAMg 4QKUA 1FWZA 1G2BA 3R6NA 3JB9I 4N4IA 3H0IA 1W2BS 1YWPA 1VQ5Q 1Q81C 3OMCA 3MEWA 4KBMB 3V8JA 1QVFS 1UUEA 3CXCA 3CCLQ 1VQNQ 1K0XA 2SRCA 4JS4A 2QA4Q 4QQGA 2HEQA 3EGUA 3BDUA 3HRUA 3PFSA 2O4XB 1YBYA 3UWNA 1WZOA 5FU6C 3QWXX 4IKFA 1WHLA 4ZN3A 2D1XA 4HVUA 4C8QG 2J06A 3X28B 5LJ5f 3M0SA 3GOXA 3ZFJA 2V8KA 3FJ5A 2F5TX 1UGSB 1ZA2B 2HKQB 2RB6A 2RHYA 3M4YA 2LRQA 2ZPBB 2L5QA 2P4RA 4DQ2A 2ZPEB 2VGNA 1ZUYA 1QVGA 2YUOA 1M1KR 1HD3A 2PUOB 2OTLA 1VQOQ 4C0ZA 4PLLA 2E6NA 1FXXA 2COZA 2J6FA 1VUBA 1WXUA 4WTOB 2M02A 1ZQ1A 3V7RA 3CCET 3I56A 2BUDA 2L3RA 2AIRB 2O01E 2E3HA 3HRSA 1BKBA 2K9GA 4EMKC 2DXCA 4AFUC 1VQ9T 3CC4A 5FWBA 5D6XA 1FMKA 1G5VA 5GAN5 2DA9A 4JLGA 1KD1C 1QP2A 2X4JA 4M78E 5M9OA 2CSQA 2CT4A 4OMMA 3SWNA 2P0QA 3OA6A 1Y96A 2FRYA 4XTXA 3CD6Q 1TUDA 3PVLA 3EAEA 2IG0A 3JAME 2VGMA 5LJ5g 2RK1A 1GXIE 5A2QE 1K9AA 2RQWA 4A4KA 4QQDA 3E2UA 1Q81U 1M8VA 3QZ9B 1O9SA 2L89A 3VS1A 2RPNA 4PJOE 1JQQA 1VYUA 1TSFA 5CAIA 2JZ2A 3OBWA 4FYYB 1KG1A 3CCJA 1VQKA 4PKCC 1SRMA 2CS7A 3VYGA 1Z9QA 5A0DA 1OV3A 3CMEQ 1JRIA 2LC4A 2NUPB 2CUDA 3QBYA 2GFAA 1IHVA 1KK7A 1QWEA 4E2FB 1PC0A 5IHIA 1NEGA 3CBPA 1EFNA 3NHNA 4E7IA 3L42A 2EJ9A 1OOTA 4IIOA 4LDWA 2QAZA 2F1LA 2MMPA 5CVIA 4ZNXA 2VUBA 2DZ9A 3GLXA 2RI2A 4AG1C 4M78G 2DETA 3CC2T 3X25B 2DYIA 1UEBA 2PUKB 4IUTA 1YI2A 5GAOr 2RHZA 3MEAA 3J7AF 5CKBA 3L2VA 4PK4A 2OAWA 2EQUA 2LP5A 3LGFA 4E47A 4D6WA 5EG2A 2HL3A 5LJ3f 1M1GA 4BD3A 1VQLA 2HD0A 4PJOG 5LJ3e 2O31A 1MNEA 2ZPFB 2AKKA 1PKSA 2P4TA 1SF9A 1GCQA 3PGGA 1VQ6Q 4JRQA 3F70A 4PJLA 2QQAA 1B07A 4HKEA 4C92G 2EQKA 1K8AC 1V1CA 1Y7XA 1YP5A 4X9DA 4M7AA 3M56A 1OU9A 3VJPA 3SD4A 3CCVA 1KD1U 4KH0B 2DE0X 3JB9D 2CZ7B 3OYNA 1GL5A 4C5IA 1EX4A 4JJNK 2X4WA 1OU8A 3M0UA 4B9XA 3PVQA 4CC3A 1YITQ 4QVCA 1NG2A 1R77A 1VQPT 5GANe 4XU3A 1QMCA 2PQWA 3CC7A 1TU0B 2HAXA 1UG1A 3DB4A 2F5KA 2DJZA 3M57A 2NLUA 2AHJB 4X9CA 3H9NA 2DO3A 4LDVA 5GJWB 3MP8A 3JB9F 1M5Q1 3RKWA 1VIEA 1VQ4A 2LCCA 1N9RA 4HCKA 1AEYA 2H3JA 1B34A 1VQNA 1D09B 1V29B 3N5BB 3MHXA 3EH2A 3L2ZA 2QA4A 4C92D 2K3BA 2QEXT 3CCMA 4DA4A 2HKNA 3SWNC 2EJFA 2EIFA 2BZYA 1Q81R 3C4SA 2DTIA 3HPWA 2DEQA 1QQJA 1RLPC 4Z8AA 4C8QA 3OYKA 2HSPA 5GMKi 2CZ0B 3JV3A 4B9WA 5D6WA 2DPPB 5A0LA 1X6GA 4GLKA 2M51A 4GY5A 1TS9A 1WXTA 1E6HA 1NE8A 2LJ1A 1ZSZB 4C92B 1RAEB 4DBHA 5IAYA 4C92F 1VQ8T 5D7UA 2KMTA 2EKOA 4EDUA 3AHUA 4FYVB 1GBQA 3OYMA 2YHTA 2MWPA 1J3TA 1NLPC 2DTOA 2E6ZA 4QVDA 1VQOA 3BW1A 1YJWA 2YSQA 4KGZB 1PHTA 2DZCA 2HQEA 2PVGB 2K79A 4OMFB 1Y07A 4DOVA 4R0KA 1K8AU 2OTLQ 4QT7A 2YUPA 2K4YA 2RNAA 1NPPA 3MEUA 3NTIA 2L3PA 4RG2A 5FU7B 2FO0A 3I5RA 2DFUA 1H3HA 3CC4Q 3BFMA 4JPBW 2HQXA 5GAN7 3M59A 3JCMh 1PD0A 1RAIB 2COWA 2JOYA 2K5FA 2EQIA 1G3TA 3JCMc 2JMCA 3SDZA 1TWBA 3CD6A 1KSWA 1C6VX 2LJ0A 1X27A 4J7FA 4BDYA 2C06A 1IO6A 2HBPA 1KD1R 5IH2A 2QK0A 1KIKA 2Y4YA 5KCOA 3ZEHA 1KHIA 4HT8A 4M7AC 1AWXA 2QDYB 2CYZB 2DRKA 3VS4A 2A0FB 1SSFA 1VQ7T 4JJCA 4JRIA 1JXOA 3UPUA 3REAB 4ESRA 1VQKQ 2JS0A 3EGDA 3I9QA 4NS5A 4BY6B 4FCYA 2FL7A 3G7ZA 3TSWA 2KY9A 4ANJA 1TUGB 5GAOn 1WFWA 4J9BA 5DY9A 4AG2C 1Q82R 5CQYA 3CCEA 2XI9A 2VVKA 3RESA 4A54A 1Q7YU 1PD1A 2D0QB 1WYXA 2HCKA 2YRVA 1VQ9A 2ROTA 1RI9A 3JCMf 4M78A 2G6FX 5HKCA 2QQBA 5GAOl 3JCMe 5GMKm 3EFRA 3CEYA 1HJDA 1IGUA 3RKYA 4JRPA 1YI2Q 3CCQT 1RAGB 3MP6A 2Z0WA 1VQMT 2VKNA 5KYUB 2DIGA 1UHFA 5GAMe 3E9GA 5CO7A 4PJOA 4J7IA 2VB6A 4AFZC 3G71Q 3G1JA 1VQ6A 5HK0A 1IREB 3SFMA 1IXDA 2VWFA 1NEBA 2RI3A 5ECAA 3VU3C 4BE2A 4J6XA 4JDSA 3JB9J 4C8QC 2RJDA 3VUBA 2MPXC 4L5GA 2HL5C 2R5AA 5KYWA 5GMKj 2NUTB 3EFSA 4MZPA 4EIKA 2ED1A 5DM7R 3CCUT 1NM7A 1NPRA 3LWIA 4KGVB 3CCVQ 1LJOA 1CKBA 3META 2D0NA 4C5EA 1FYNA 2X51A 3JCMQ 1K8AR 1TUCA 1IRXA 2VC8A 3VS5A 1Y96B 1YN8A 2KAFA 3VS2A 1CKAA 2DVEA 2E10A 2KXDA 3CC2A 4M7DD 1AVZC 4AFSC 3OS0A 3JCMX 2KXCA 3RUXA 1UGPB 1SG5A 2CT3A 1BIBA 3M0TA 2EKHA 4P5NA 3CCQQ 2DKGA 4V2SA 2LCLA 2EYWA 2QQRA 2MYSA 4F7UG 3UF4A 3EGXA 3QDRB 2MK5A 3NTHA 4XTZA 1VQ4Q 1E7OA 4OMOA 1K76A 2EVRA 4M7DB 5GJVB 1U8RA 4M7DF 1I07A 4RMOA 4MDXA 1QKWA 3VRYA 2DBMA 3RMQA 1N27A 4X1VA 4HCZA 4MMLA 3CCMQ 4M4ZA 2J7IA 2B86A 2XMFA 2C0IA 4PJMA 1WHKA 2WACA 2EJGA 1M90U 4IURA 4FSXA 2E65A 1P92A 3GNGA 9ATCB 3NGPA 5DLQE 4OB2B 1GFCA 4KGXB 4ZN1A 2A7YA 5HY6A 5LJ5e 3OYHA 2MWOA 1MMGA 4LDYA 1TG0A 3L2UA 1WPYA 2OX7A 1Q86U 1FMVA 2YT6A 3EHRA 1Q7YR 1MUZA 1OULA 1WHMA 2EYQA 1YCYA 1X6OA 2YWWA 5IT9E 1G3SA 2W0ZA 3M9QA 2KDSA 2MIOA 1YJWQ 1MV0B 4NOYA 1M2VB 3MP1A 3UA7A 1QCOA 3RERA 3HL8A 4DBRA 2EAYA 4M78C 1W4SA 4E7ZA 2K3YA 3RDVA 3G4ST 2QEXA 3A8OB 1KQ1A 2LT4A 2PZ1A 2CGHA 1H3ZA 3TU4K 4N4HA 5GANd 2RJEA 2BIVA 3UDCA 2LDMA 2QASA 4ELZC 4F7UB 1M27C 4M75G 2KBTA 2E64A 4F7UF 1QLYA 1ZHIA 1M4ZA 1M1FA 4J8OA 5HK3A 1BI2A 2CZ6B 4J9HA 4FT4A 4II1A 5DLOA 2DLPA 1Y57A 2ZPHB 1BI3A 5I21A 2CUBA 1D3BA 2FRWA 2QXFA 3H0FA 2CP5A 3X20B 1UGVA 3OYJA 1M30A 3LGLA 3CCST 2FYKA 1YIJT 1JJ2S 3GF5A 5LL6S 1OX9A 2XDBA 2CREA 4RTUA 4F16A 1Q82C 4KH1B 4D8KA 4M77D 1IHWA 3ZL7C 4RTWA 3FIFA 2PU9B 2D8HA 1UB4A 4CC2A 4OMLA 3A8MB 1JJ2P 2EQJA 3Q1JA 3EFOA 3VKIA 1YCSB 4RG8A 4C92E 1SSHA 3P8DA 2YLBA 5I2MA 5C0MA 2DL3A 2AZVA 8ATCB 4BE0A 3JB9G 2BE7D 3CCEQ 1WJQA 3OS5A 2AZSA 3FC3A 4RTYA 2KYMA 2LT1A 2M0OA 3UATA 1GBRA 4M77B 2RHIA 4B6MA 2JW4A 2JS2A 4M77F 3S3NA 2AKLA 1VQ9Q 2F2WA 1UTIA 4JZ4A 3NFCA 8AT1B 4HCBA 5IN1A 4M75D 1X69A 2E4HA 3P8HA 2HMAA 4IUUA 5GAN8 4PLIA 3H8ZA 1M3CA 4C5GA 4VUBA 1YHQT 2O4XA 3TEEA 4RTVA 1NJIC 2EGEA 1D1AA 3H0HA 4JS5A 4FYWB 3G71A 3G6ET 5KYXB 4CC7A 2D8JA 6AT1B 2YRCA 1UECA 2DJQA 2Y4XA 2EPDA 3C12A 1S72T 1K4US 2QQSA 1M90R 2ZZDA 3CCRT 1VQ7A 3TVTA 1BB9A 4M75B 3WVDB 2V26A 3MO8A 4Y28E 4M75F 3OYBA 3CMAT 1NYFA 2LTOA 1RACB 2DXTA 2KNBB 2I0NA 3OW2P 2LX9A 5CR2A 1QVPA 4XU0A 2KSSA 2DF6A 2EYYA 2JVVA 3REBB 5I11A 3QJ6A 4DBFA 1WI7A 2FPDA 1WIEA 1Q86R 2EFIA 4C0DC 2VV5A 3DLLA 1WXBA 4KULA 4PNOA 2DILA 2F2XA 2FB7A 4C5HA 1VA7A 1ZX6A 1RABB 2P84A 2X3XD 4J83A 2V1QA 3S3OA 1KC8C 2XU8A 2P0KA 2R5MA 4HXJA 5FU6B 2CSIA 3V7SA 3C94A 3CC2Q 2WSEE 3M54A 2V1RA 3CCQA 1Q82U 3X26B 4ORZA 2CP7A 1VQMA 1XNIA 3ASKA 4FM4B 3L2RA 2YUQA 3OYLA 2FHDA 5FRNA 3BDLA 5KYYB 2XK0A 5HCKA 2ZPGB 3LWHA 4J6WA 5KCHA 3GBQA 3RKXA 3O8VA 4QQ6A 3G6EQ 1OQKA 2W10A 5C6SA 2LQWA 3HHTB 3FDRA 3E1SA 3PT9A 3M0QA 3I55T 1BI0A 1NYGA 1O75A 1S72Q 2JUFA 4J6YA 3SHWA 5I22A 3M55A 1PSFA 2GNCA 2KRMA 3VV0A 3KXTA 3M0PA 1YJ9T 3LH5A 1H641 3CPFA 2JNGA 2NYSA 3CCUA 1Y71A 4EMGA 3TCJA 1Q7YC 4EMKB 2LQ8A 2DM1A 3DB3A 1BBZA
chains in the Genus database with same CATH topology
1OI1A 4C0FA 5GAOl 5GMKe 1I5LA 4R56A 1YITT 4ZTJA 1NJIU 4IKFA 4ZN3A 3JCMe 5GMKm 5GAMd 3EFRA 4C8QG 3V7CA 2B8AA 2KQWA 3CEYA 2M1HA 3QIIA 3X28B 5LJ5f 1LNXA 3RKYA 1K9MU 4JRPA 4L6V5 3GOXA 3CCQT 3SB2A 2V8KA 3ZFJA 5GANh 3MP6A 2EWNA 1K9MC 2F5TX 1UGSB 1VQMT 2RB6A 2RHYA 3FB9A 3M4YA 5GAN4 1KQSA 3UWNA 2DXUA 5J39A 3GPLA 2DIGA 3OW2S 3MEVA 5GAMe 2LRQA 2ZPBB 3UT1A 3E9GA 1G3WA 5CO7A 4J7IA 4PJOA 2L5QA 1FX7A 3L2QA 3RIRA 1QP3A 3C95A 4DQ2A 2ZPEB 2VGNA 3MCAB 2A3LA 5CK9A 1VQ6A 4M7DB 5HK0A 1QVGA 1IREB 3SFMA 2PUOB 4OB3B 2OTLA 4XU2A 2K5LA 2E12A 4BY6C 4C0ZA 2DIQA 4PLLA 2E6NA 3M58A 1FXXA 2RI3A 3CCJT 3VU3C 4HA8A 3OQ5A 1VUBA 4BE2A 4J6XA 3QXEB 4JDSA 3JB9J 4XTVA 4C8QC 5CKFA 2JTMA 3JCMW 3OBYA 1UGRB 3OMGA 3PMIA 2RJDA 3VUBA 1ZQ1A 1I81A 4L5GA 3V7RA 3CCET 2R5AA 5GMKj 2JN0A 3EFSA 4MZPA 3OYEA 4BI3A 2FVUA 4PL6A 2BUDA 2L3RA 3I56A 2O01E 1KC8U 1OZ2A 3HRSA 1BKBA 4C0GA 5DM7R 3CCUT 3LWIA 1NPRA 4EMKC 1LJOA 4A4EA 2DXCA 1VQ9T 5GAN3 3CC4A 1MHNA 3META 3OS2A 3OYGA 4C5EA 4KUDK 5D6XA 3JCMQ 4N4GA 4EPCA 1G5VA 4JRKA 5GAN5 2DD4A 4JLGA 3VYHB 4M7DE 2VC8A 2QTXA 5J3BA 1KD1C 1Y96B 1QP2A 5GAMj 1RI0A 2X4JA 2KAFA 3L1AA 4M78E 5GANf 3S3MA 2E70A 3CC2A 2E10A 2DVEA 5M9OA 4M7DD 4RCBA 3JB9H 3SWNA 2RHXA 3OS0A 2P0QA 3DKMA 3CPWS 4M78D 3JCMX 3HFOA 3RUXA 4F7UA 3OA6A 1UGPB 1Y96A 4XTXA 1BIBA 1U1TA 4RCCA 3GNFB 4A4HA 2ZCFB 4P5NA 3EAEA 2IG0A 3JAME 2DKGA 1YJNA 4NL3A 4V2SA 2LCLA 2VGMA 5LJ5g 2RK1A 2QQRA 5GAOq 5A2QE 1GXIE 4F7UG 3OSVA 4A4KA 4QQDA 3QDRB 1I8FA 1JJ2A 3X24B 3NTHA 1Q81U 1M8VA 3QZ9B 1O9SA 4XTZA 2L89A 1VQLT 2OTLT 4PJOE 2DAQA 5CAIA 2JZ2A 2JTFA 3OBWA 2XHCA 1KG1A 3CCJA 1VQKA 4JUVA 4PKCC 3QG1A 4M7AA 4PJOD 3CBOA 3CXCS 2CS7A 2DD5A 3KUFA 4O5VA 3VYGA 1G3YA 5A0DA 5LJ3g 1VQ5A 1U8RA 4M7DF 4RMOA 4MDXA 1JRIA 2PVDB 3HRTA 4M78B 4NL2A 2LC4A 1WJSA 3QBYA 1U1SA 2GFAA 1TH7A 4M78F 3RMQA 1N27A 3JCMd 3CCLA 4XTUA 3G4SA 4E7LA 4HCZA 2OAUA 4MMLA 3I56T 3OB9A 4IUPA 3CBPA 2G3RA 3FJPA 2RO0A 4E7IA 4A53A 3L42A 2EJ9A 3WXMB 1W2BA 1XQHA 2XDDA 3CC4T 4LDWA 2CZ1B 5LJ5d 2MMPA 5CKHA 5CVIA 3JCMJ 2X4XA 1N6AA 1QVFA 4TVRA 2K2VA 2WACA 4M7DG 2EJGA 5GAOm 2OTJA 2MI6A 4IURA 1M90U 2CKKA 2VUBA 2DZ9A 3GLXA 2E65A 1P92A 2RI2A 4FSXA 4BACA 3GNGA 4M78G 2LNVA 5DLQE 1KQ2A 4OB2B 1M90C 4PJOB 3CC2T 3X25B 3A8HB 3GP8A 3HP9A 4N0AA 1UEBA 2PUKB 3QYGB 4IUTA 4PJOF 2A7YA 5HY6A 4ZN1A 5GAOr 1YI2A 2RHZA 3MEAA 4OP0A 3J7AF 4M77A 5LJ5e 5CKBA 3L2VA 3OYHA 4YTLA 2MWOA 4OGCA 3WVEB 1M1KC 2EQUA 4LDYA 2E5QA 3LGFA 4E47A 4D6WA 2K5IA 5EG2A 2VXEA 3L2UA 1WPYA 5LJ3f 1YJNT 1Q86U 3CC7T 3CCSA 5GANg 4IUQA 1QVGS 4F7UE 2V8IA 2RK2A 3QO3A 2EYQA 3LW5E 1M1GA 1YCYA 3PMTA 4BD3A 1X6OA 1Q86C 1BYMA 3H6ZA 3QKJA 1VQLA 4A4GA 5IT9E 1G3SA 3M9QA 2HD0A 1XTDA 4PJOG 5LJ3e 2KDSA 2ZGWA 2ZPFB 4NOYA 1MGQA 4C92A 3MP1A 1VQKT 2P4TA 3OW2A 2XDPA 3RERA 4M7DC 3HL8A 4OB1B 3PGGA 4JRQA 1WGSA 2EAYA 2LVMA 3F70A 1VQ5T 3A8LB 3M5AA 4M78C 2QQAA 4KUIA 1W4SA 2XKOC 4HKEA 4HT9A 4C92G 2EQKA 2K3YA 1K8AC 3CCLT 3J80E 1X75C 3G4ST 2P0PA 4EMHA 2R58A 1Y7XA 3INZA 4OF1A 1WQWA 2QEXA 3A8OB 4X9DA 4Z02A 1KQ1A 2LT4A 4M75A 2QI2A 3QJYA 3R6OA 3M56A 5KE2A 3VJPA 3SD4A 4BDZA 1QW1A 3CCVA 1KD1U 2CGHA 3A5ZB 1H3ZA 3TU4K 4N4HA 4CRIA 2GCXA 3SWNB 5FLXE 1AHJB 5LJ5j 5GANd 3GIBA 2RJEA 2BIVA 3OYAA 3JB9D 3UDCA 2K57A 2LDMA 4ELZC 4F7UB 2CZ7B 2OTJT 3OYNA 4M75G 4F7UF 2E64A 2L8DA 2VYTA 1ZHIA 4C5IA 4JJNK 2X4WA 1BI1A 1M4ZA 1M1FA 4J8OA 4B9XA 5HK3A 1BI2A 1R8OB 2CZ6B 4FT4A 2RI5A 4II1A 5J26A 5DLOA 4QVCA 1YI2T 1VQPT 1DJ7B 3QZ5B 5GANe 3OYFA 2ZPHB 3BY7A 1BI3A 4KT0E 4XU3A 5I21A 2QQ9A 5LJ3j 3PTAA 1D3BA 2QXFA 2DXBA 1ZBXA 2PQWA 3OSSC 3CC7A 3X20B 2RHUA 4ZGDB 3OYJA 2V8JA 2HAXA 3LGLA 3S6WA 3DB4A 4M77E 2F5KA 3CCST 2Y90A 2DJZA 2FYKA 3M57A 5KE3A 1YIJT 1N9SA 1JJ2S 3GF5A 5LL6S 3RMSA 2NLUA 2R57A 1EIFA 2AHJB 4X9CA 2DO3A 4LDVA 3T9NA 5GAMh 1KHCA 3G6EA 2XDBA 1UGQB 1Q82C 3G71T 4M77D 3MP8A 2RJFA 4LD9K 5CCAA 3FIFA 2PU9B 3JB9F 4BB7A 1UB4A 1M5Q1 4XTYA 1VIEA 3RKWA 1S72A 1VQ4A 2LCCA 1N9RA 3FRNA 3A8MB 1VQOT 3P8BB 2EQJA 3Q1JA 3VKIA 2LQKA 3QHSA 5CKDA 4RG8A 3JRZA 1BIAA 4C92E 2H3JA 3HSBA 1B34A 3OYCA 1XOVA 3L2WA 3P8DA 1VQNA 2YLBA 3CMEA 1JBMA 3E9FA 1V29B 2M9UA 3N5BB 3MHXA 5I2MA 3L2ZA 5C0MA 3OYIA 2YLCA 2QA4A 5FROA 4C92D 1VQMA 2PVOB 2X4YA 1M9SA 2QEXT 3CCMA 4BE0A 4DA4A 3JB9G 4OVAA 2WSFE 3TREA 1WJQA 3CCVT 3OS5A 5CQXA 3SWNC 4C0DB 3FC3A 2EJFA 2EIFA 3PNWC 2M0OA 2LT1A 5GANj 2D6FA 4M77B 2RHIA 3JCMV 4X34A 1IZ6A 4M7AE 2WSCE 4M75E 4M77F 3S3NA 2X35A 2GF7A 2XG8D 4FL6A 3C4SA 2DTIA 2GQVA 3NFCA 5GAOp 4BE1A 5KH6A 2RH2A 2DEQA 3HPWA 4HCBA 5FRMA 5IN1A 4C8QA 1M1KU 3OYKA 5GMKi 4M75D 1KQSS 2CZ0B 4M7AD 4L59A 1VQPA 3P8HA 4B9WA 5GAN2 1OYXA 2DPPB 5D6WA 5A0LA 4GLKA 5LJ3d 4IUUA 5GMKl 5GAN8 4GY5A 2F69A 3LH0A 3H8ZA 4PLIA 4C5GA 2RD1A 3NTKA 4IUVA 1NE8A 4QW2A 2K3XA 4XK8E 3HKSA 4VUBA 1YHQT 3CD6T 3JSCA 4C92B 4EMKA 1YIJA 2O4XA 4M77G 3TEEA 5IAYA 1NJIC 4XAXB 4C92F 4LDXA 4CI0C 2DK3A 4LD6A 5GAMf 1VQ8T 4BI4A 5GAN6 4JS5A 2KMTA 3E19A 3G71A 2VXFA 3G6ET 4ZTFA 2EKOA 4EDUA 3AHUA 3QPHA 3OYMA 2DTHA 2YHTA 3OY9A 4QVZA 2MWPA 4WF2A 2M16A 2DTOA 2E6ZA 4RKUE 3URGA 4FIBA 4QVDA 3VUZA 2Y4XA 4MZTA 1VQOA 3BW1A 3C12A 1YJWA 1S72T 3PIOA 2QQSA 1VQ4T 2DZCA 2HQEA 2PVGB 2ZZDA 4OMFB 1Y07A 4M7AB 3CCRT 1VQ7A 3V8KA 4M75B 2MAMA 3WVDB 4DOVA 1K8AU 4M7AF 3MO8A 3LX7A 4Y28E 4M75F 3OYBA 2K4YA 4E7KA 3CMAT 1NPPA 3I55A 2LTOA 3MEUA 2DXTA 1VQNT 1VIFA 3NTIA 3CMET 2LX9A 5CR2A 1QVPA 4XU0A 4RG2A 2KSSA 3J81E 2JVVA 4A4FA 3KBGA 5FU7B 2QA4T 3QJ6A 4JLIA 3M4GA 1PSEA 3V8LA 3CCMT 1HXDA 2E41A 3DLMA 5CIUA 4ME7A 3OYDA 2EFIA 4J5YA 4C0DC 4N0AC 4ZGJB 2VV5A 1I4K1 3FLGA 3PIPA 2BKDN 3OS1A 4M77C 1JB0E 2D9TA 3DLLA 1YJ9A 2GFUA 4KULA 4M7AG 4PNOA 2KK4A 4ELYC 4DOWA 3QUIA 4PJOC 3BFMA 1D3BB 2FB7A 2IVWA 5AYFA 4FT2A 5GMKh 4C5HA 2HQXA 5GAN7 2KVQG 1NZ9A 2RM4A 3M59A 4J83A 4R55A 4HCCA 3JCMh 3S3OA 1KC8C 2XU8A 1WQ7A 2JOYA 2P0KA 2R5MA 2RJCA 3JCMP 2K5FA 5FU6B 3V7SA 1G3TA 3JCMc 1YITA 3SDZA 4ATOA 1YHQA 3C94A 1WJRA 3CD6A 2WSEE 4FU6A 4C8QE 2I2LA 4C92C 4BUGA 1OZ3A 2RA2A 3M54A 4LDUA 4Q5WA 4O6JA 3CCQA 5LJ5h 1Q82U 3X26B 4J7FA 1VQ8A 2HNIA 4BDYA 3ER0A 4XU1A 3LYIA 4MMKA 4C8QD 4ZGEB 1XNIA 3ASKA 3JCMg 2EQMA 4FM4B 2MF2A 3L2RA 4MDWA 4Y91A 2FHDA 3LLRA 3OYLA 4XQ3A 2C06A 5FRNA 3BDLA 3CPWA 2HBPA 3OYYA 4UC4A 2XK0A 1N8RU 2XD0A 4OB0B 1B34B 2ZPGB 1RL2A 3HFNA 3LWHA 1X01A 2Y4YA 4J6WA 3A8GB 5KCHA 3ZEHA 5KCOA 3CBMA 1YJWT 1K73U 2XICA 1N8RC 1KHIA 3RKXA 3ZBDA 3CCRA 4HT8A 3O8VA 1WNLA 2QDYB 3QYHB 2CYZB 4M75C 4E7HA 4QQ6A 5LJ3h 4M7AC 3ME9A 4MZMA 3JCMb 5C6SA 1SSFA 3CMAA 1VQ7T 5CKEA 3FEOA 3HHTB 3FDRA 5GAMg 1K73C 3E1SA 3PT9A 4JRIA 2XIDA 3UPUA 1VQ6T 5L8RE 3I55T 1BI0A 1FWZA 1O75A 3JB9I 5FU6C 4N4IA 1W2BS 2JUFA 4NS5A 5FU7C 4BY6B 4BI8B 1Q81C 4J6YA 3QSUA 3M53A 3MEWA 3OMCA 4KBMB 2FL7A 3G7ZA 2KY9A 3V8JA 1HK9A 5GAOn 1QVFS 4C8QB 5A0GA 3CXCA 5DY9A 3M55A 1PSFA 4XTWA 5CQYA 5I2SA 4C8QF 4JS4A 3CCEA 2XI9A 3VV0A 4OGEA 3RESA 2E1HA 3KXTA 1YJ9T 4E7JA 4QQGA 4A54A 1Q7YU 1H641 3CPFA 2JNGA 3CCUA 2D0QB 1Y71A 2ZPIB 3BDUA 4M7DA 2YRVA 3HRUA 3JCMf 1LOJA 3TCJA 4EMGA 3PFSA 4EMKB 1Q7YC 1VQ9A 2O4XB 4M78A 2LQ8A 3DB3A 1YBYA 5HKCA 5D6YA 2QQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WVD B;  4Y28 E;  2CZ6 B;  3X28 B;  1DJ7 B;  2DD5 A;  3QZ5 B;  3VYG A;  4L6V 5;  2ZPH B;  4KT0 E;  2PVD B;  2DXB A;  1UGS B;  1PSE A;  3X20 B;  4ZGD B;  4ZGJ B;  1JB0 E;  2ZPB B;  2AHJ B;  1UGQ B;  1QP3 A;  2CZ1 B;  2ZPE B;  2PU9 B;  1IRE B;  3A8M B;  2PUO B;  4OB3 B;  4OB2 B;  3X25 B;  3A8H B;  2PUK B;  3QYG B;  2WSE E;  3QXE B;  1V29 B;  3X26 B;  3WVE B;  1UGR B;  2PVO B;  4ZGE B;  4FM4 B;  2WSF E;  2O01 E;  4OB0 B;  3LW5 E;  2ZPG B;  3A8G B;  2DXC A;  2WSC E;  2QDY B;  3QYH B;  2CYZ B;  2ZPF B;  2DD4 A;  3HHT B;  3VYH B;  2CZ0 B;  5L8R E;  4OB1 B;  1QP2 A;  2DPP B;  3A8L B;  4XK8 E;  1UGP B;  1PSF A;  2ZCF B;  3A8O B;  1GXI E;  2D0Q B;  2ZPI B;  1AHJ B;  4RKU E;  2CZ7 B;  3X24 B;  3QZ9 B;  2PVG B;  2ZZD A; 
#chains in the Genus database with same CATH topology
 1WHH A;  2DL5 A;  2ED0 A;  1MV3 A;  1AZE A;  1I5L A;  2FEI A;  4LN2 A;  4R56 A;  4ZTJ A;  1NJI U;  2H8H A;  5GAM d;  4PFP A;  2KQW A;  1YNZ A;  3QII A;  1K9M U;  2AK5 A;  4L6V 5;  3SB2 A;  1VQP Q;  2DL7 A;  5GAN 4;  3SEM A;  2DXU A;  5J39 A;  4PFO A;  1ABO A;  2X3W D;  3GPL A;  3MEV A;  1U06 A;  3UT1 A;  1G3W A;  1TOV A;  4AT1 B;  3L2Q A;  3RIR A;  1QP3 A;  2O9S A;  5CK9 A;  1ZBJ A;  2CH4 A;  2L3Q A;  2K5L A;  2DIQ A;  3M58 A;  1RAD B;  3CCJ T;  5KYN A;  3JCM W;  3OBY A;  1UGR B;  3PMI A;  4DEY A;  2QEX Q;  3OYE A;  1RAH B;  1KC8 U;  1OZ2 A;  5AT1 B;  3RNJ A;  1VOM A;  1S1N A;  2AT1 B;  2DVJ A;  1T0J A;  4A4E A;  2LNH B;  5GAN 3;  2DER A;  1MHN A;  3OYG A;  3OS2 A;  5L23 A;  4KUD K;  2LCS A;  4EPC A;  1FMW A;  3EG9 B;  4M7D E;  2QTX A;  5J3B A;  1V76 A;  1G83 A;  1RI0 A;  2PNI A;  3L1A A;  1GCQ C;  3EHQ A;  3DKM A;  4KRT A;  3CPW S;  1AT1 B;  1PG5 B;  1U1T A;  3GNF B;  2YRD A;  4LUE A;  2ECZ A;  1TXQ A;  1JEG A;  1SHG A;  2FZG B;  1VQ8 Q;  1B3Q A;  5GAO q;  3OSV A;  3CPW P;  1T0H A;  1I8F A;  1BK2 A;  2A37 A;  1JJ2 A;  2PTK A;  1VQL T;  2DAQ A;  4RTT A;  2XHC A;  2CP6 A;  4Z89 A;  4DBQ A;  4FW2 A;  2DD5 A;  1G3Y A;  4NL2 A;  1WJS A;  1U1S A;  4A63 B;  3QDF A;  2COY A;  4XTU A;  3G4S A;  4E7L A;  2ZAE A;  4J9C A;  1X43 A;  4IUP A;  3VS0 A;  3FJP A;  2RO0 A;  4A53 A;  3WXM B;  1XQH A;  1BCO A;  4D8D A;  5LJ5 d;  2KRS A;  1G8X A;  1N6A A;  2RF0 A;  4TVR A;  4M7D G;  2JTE A;  1OX8 A;  2J6K A;  2CKK A;  1XJW B;  1E6G A;  1M90 C;  2DBK A;  3A8H B;  2IIM A;  3QYG B;  4YTL A;  4GLM A;  4OGC A;  2KI7 A;  2DNU A;  2E5Q A;  1W1F A;  4LNP A;  2K5I A;  4LXC A;  2VXE A;  2YXY A;  1YJN T;  3CC7 T;  3CCS A;  4IUQ A;  4F7U E;  2V8I A;  2RK2 A;  3QO3 A;  3LW5 E;  1KQS P;  1Q86 C;  3QKJ A;  4A4G A;  1KFZ A;  1X6B A;  1ZSZ A;  4J9D A;  4C92 A;  1PWT A;  1R0C B;  1VQ7 Q;  1NJI R;  3OW2 A;  2GQI A;  1ZSG A;  1F1B B;  4OB1 B;  1K9M R;  1VQ5 T;  1UJ0 A;  2LVM A;  3M5A A;  1D0Y A;  2KRO A;  4KUI A;  2XKO C;  1LPL A;  3CCL T;  1IB8 A;  3MKD A;  1K0S A;  1N5Z A;  2P0P A;  3INZ A;  3EG3 A;  3QJY A;  3R6O A;  1K1Z A;  4J9G A;  2KGT A;  5FW9 A;  4CRI A;  3SWN B;  2OTJ T;  1X2K A;  1BI1 A;  3CQT A;  2FZK B;  1R8O B;  3TSZ A;  2RI5 A;  1DJ7 B;  3QZ5 B;  1H92 A;  5IXF A;  1SPK A;  3BY7 A;  2EGA A;  5LJ3 j;  1M3A A;  3OSS C;  4ZGD B;  2V8J A;  2MCN A;  1SKU B;  3AT1 B;  1VQM Q;  2A36 A;  3S6W A;  4M77 E;  3I5S A;  1Q95 G;  2Y90 A;  1KC8 R;  1N9S A;  4OMP A;  3G6E A;  1SHF A;  2KR3 A;  2RJF A;  4LD9 K;  1YJN Q;  2JJ9 A;  5CCA A;  4BB7 A;  2ESW A;  1S72 A;  3FRN A;  1VQO T;  3QHS A;  5CKD A;  3JRZ A;  1BIA A;  3HSB A;  2M0Y A;  3OYC A;  3A1P A;  1JBM A;  3E9F A;  2M9U A;  4Y92 A;  3OYI A;  3I35 A;  2PVO B;  1M9S A;  2NWM A;  1GFD A;  3RR6 A;  4OVA A;  1T3S A;  5CQX A;  4CC4 B;  3PNW C;  5GAN j;  3JCM V;  3CCU Q;  2K7A A;  4M75 E;  1PM3 A;  2QGG A;  2GF7 A;  2RQU A;  2X35 A;  1W2B P;  5FRM A;  1M3B A;  4M7A D;  4L59 A;  1VQP A;  1QVF P;  5GAN 2;  1OYX A;  5LJ3 d;  2OTJ Q;  5GMK l;  2F69 A;  3LH0 A;  3ULR B;  1SRL A;  4IUV A;  2K3X A;  2ROL A;  4WCI A;  3CD6 T;  4M77 G;  4LDX A;  4BI4 A;  1PCX A;  4LUD A;  1SEM A;  2KT8 A;  3M0R A;  2VXF A;  3OY9 A;  1AWJ A;  3PIO A;  5FWC A;  2ABL A;  4M7A B;  1W70 A;  5KYU A;  2MAM A;  4M7A F;  4E7K A;  3I55 A;  2LX7 A;  1IGQ A;  1VIF A;  3CME T;  4LE9 A;  1NLO C;  3KBG A;  4JLI A;  3V8L A;  1HXD A;  3DLM A;  4ME7 A;  4ZGJ B;  1I4K 1;  4JJD A;  5IHK A;  1RAF B;  2BKD N;  3OS1 A;  4J9I A;  1JB0 E;  3TQ7 P;  1YJ9 A;  3THK A;  4ELY C;  1MMA A;  2FPF A;  4DOW A;  2MOX A;  2FZC B;  4PJO C;  2ENM A;  2IVW A;  4FT2 A;  2QYZ A;  5GMK h;  2JM9 A;  2KVQ G;  1NZ9 A;  2RM4 A;  4HCC A;  2KT1 A;  2GBQ A;  1YFN A;  2RJC A;  2NUT A;  2FG0 A;  1A0N B;  1Z9Z A;  1D1B A;  1ZSZ C;  2SEM A;  2I2L A;  4C92 C;  1OZ3 A;  4LDU A;  4Q5W A;  4O6J A;  1VQ8 A;  3ER0 A;  4XU1 A;  4C8Q D;  4MMK A;  2GTO A;  2JT4 A;  2EQM A;  2DRM A;  2MF2 A;  4MDW A;  3CPW A;  3OYY A;  2XD0 A;  3D7S B;  1N8R U;  1B34 B;  3HFN A;  4FW1 A;  1AOJ A;  3U23 A;  2H3E B;  1K73 U;  2XIC A;  3VRZ A;  2C0O A;  3QYH B;  5LJ3 h;  4MZM A;  3JCM b;  2KE9 A;  5CKE A;  1U5S A;  3FEO A;  1OPL A;  2XID A;  1VQ6 T;  5L8R E;  1TTH B;  2EBP A;  3BE3 A;  5FU7 C;  4BI8 B;  3QSU A;  3M53 A;  1AD5 A;  1HK9 A;  3HTR A;  4C8Q B;  5A0G A;  2GTJ A;  4XTW A;  3G4S Q;  5I2S A;  4C8Q F;  1T3L A;  4OGE A;  1PKT A;  2E1H A;  2A28 A;  4E7J A;  2FPE A;  4OMN A;  2ZPI B;  4M7D A;  1R0B G;  4PJN A;  1LOJ A;  1JO8 A;  2KYB A;  1H8K A;  2J6O A;  2BE9 B;  5D6Y A;  1OI1 A;  4C0F A;  5GMK e;  3O5Z A;  1YIT T;  1I0C A;  2HQH A;  5EC7 A;  3V7C A;  2B8A A;  2JM8 A;  2M1H A;  1AWO A;  1LNX A;  1OPK A;  1M2O A;  5GAN h;  2EWN A;  1K9M C;  2YDL A;  4OMQ A;  1WX6 A;  3FB9 A;  1KQS A;  2HDA A;  3OW2 S;  3CCS Q;  1BCM A;  1YIJ Q;  1CSK A;  4RTX A;  1UFF A;  1FX7 A;  2X9H A;  3C95 A;  2BTT A;  3MCA B;  2A3L A;  3RBB B;  2LZ6 B;  2HBW A;  3EG2 A;  4OB3 B;  4XU2 A;  1D0Z A;  2QG9 B;  2E12 A;  4BY6 C;  4HA8 A;  1QKX A;  3OQ5 A;  3QXE B;  4XTV A;  5CKF A;  2JTM A;  1PRL C;  3OMG A;  1I81 A;  2K6D A;  1U3O A;  2VAS A;  2JN0 A;  2BZX A;  1M2V A;  4BI3 A;  2FVU A;  4PL6 A;  4C0G A;  1QWF A;  1ABQ A;  2GGR A;  4Z88 A;  4N4G A;  4JRK A;  2DD4 A;  3VYH B;  2K2M A;  1I1J A;  1ZUK A;  5GAM j;  3EG0 A;  5GAN f;  1AWW A;  3S3M A;  2E70 A;  1WA7 A;  3PE0 A;  2DYB A;  3A98 A;  4RCB A;  3JB9 H;  5IXB A;  2RHX A;  1ARK A;  4M78 D;  3HFO A;  4F7U A;  4RTZ A;  1YHQ Q;  4RCC A;  4A4H A;  2ZCF B;  1W6X A;  2DMO A;  1YJN A;  3EGD B;  4NL3 A;  2JXB A;  4E6R A;  3EG1 A;  3MJX A;  4PJJ A;  3X24 B;  2OTL T;  2JTF A;  1UDL A;  2OI3 A;  3CCR Q;  4JUV A;  1PRM C;  3QG1 A;  3VS3 A;  4PFZ A;  4PJO D;  3NPF A;  2CP2 A;  3CMA Q;  3CBO A;  3CXC S;  4O5V A;  5LJ3 g;  3KUF A;  1VQ5 A;  2O2O A;  2PVD B;  3HRT A;  4M78 B;  1NBE B;  2E5K A;  1TH7 A;  4M78 F;  3JCM d;  2L0A A;  3CCL A;  4AFQ C;  3I56 T;  2OAU A;  3OB9 A;  1KJW A;  1ZLM A;  2G3R A;  1N8R R;  1WDX A;  4FYX B;  1W2B A;  3CXC P;  1QCN A;  2XDD A;  3CC4 T;  2NUP A;  4E7S A;  1K73 R;  2CZ1 B;  3IQL A;  2LMJ A;  4F14 A;  5CKH A;  4GBQ A;  1LCK A;  3JCM J;  2X4X A;  1AZG B;  1QVF A;  1RAA B;  2K2V A;  2OTJ A;  5GAO m;  3H41 A;  2MI6 A;  4BAC A;  2EGC A;  2LNV A;  1KQ2 A;  4PJO B;  3GP8 A;  3HP9 A;  2ATC B;  4N0A A;  4PJO F;  4OP0 A;  4M77 A;  2HZY A;  3WVE B;  1M1K C;  1Y0M A;  2RQV A;  2IPO B;  3VS6 A;  2JMA A;  5GAN g;  1X2Q A;  1QVG S;  1GCP A;  3PMT A;  1BYM A;  3H6Z A;  2BZ8 A;  1XTD A;  2QDL A;  1WLP B;  2ZGW A;  1MGQ A;  5KYW B;  2RQT A;  1VQK T;  2XDP A;  1I5O B;  1QVG P;  4M7D C;  2A08 A;  1VYV A;  3I55 Q;  1WGS A;  5KYX A;  3A8L B;  4HT9 A;  4DEX A;  3J80 E;  4HVV A;  1X75 C;  4EMH A;  2DL8 A;  2R58 A;  1UE9 A;  4OF1 A;  1WQW A;  1EZZ B;  4Z02 A;  4M75 A;  2QI2 A;  1M8M A;  5KE2 A;  2LJ3 A;  4IIM A;  4BDZ A;  1QW1 A;  3A5Z B;  1YJ9 Q;  2GCX A;  5FLX E;  1AHJ B;  5LJ5 j;  3GIB A;  3OYA A;  3I56 Q;  2K57 A;  4JJB A;  2L8D A;  5IHN A;  2VYT A;  3QWY A;  4FSS A;  1C1A A;  2KEA A;  1BU1 A;  5J26 A;  1YI2 T;  2EYZ A;  3UA6 A;  3EGX B;  3OYF A;  4KT0 E;  2QQ9 A;  3PTA A;  2DXB A;  1ZBX A;  2RHU A;  4RUG A;  4K11 A;  5KE3 A;  3RMS A;  2NUZ A;  2R57 A;  1EIF A;  3T9N A;  5GAM h;  1KHC A;  1OEB A;  1UGQ B;  3G71 T;  4XTY A;  2HSE B;  3P8B B;  1JXM A;  1RLQ C;  2LQK A;  2EW3 A;  5KYY A;  2DL4 A;  3L2W A;  1XOV A;  1WHJ A;  3CME A;  3CCJ Q;  2YLC A;  2L3S A;  5FRO A;  1QCF A;  2X4Y A;  1D1C A;  1D0X A;  2WSF E;  4F04 B;  3TRE A;  3CCV T;  4C0D B;  1C0M A;  1HSQ A;  2D6F A;  1RUW A;  4X34 A;  1IZ6 A;  4M7A E;  2WSC E;  2CP0 A;  3MPU B;  2XG8 D;  4FL6 A;  4BE1 A;  2GQV A;  5GAO p;  2DX1 A;  2RH2 A;  3NMZ C;  4J9E A;  5KH6 A;  1M1K U;  2DEU A;  1KQS S;  2O9V A;  2CDT A;  1MND A;  1PNJ A;  2RD1 A;  3NTK A;  4QW2 A;  2F2V A;  3C0C A;  3HKS A;  4XK8 E;  3JSC A;  4EMK A;  2CH4 W;  1YIJ A;  2E3I A;  4XAX B;  1UHC A;  4CI0 C;  3KFV A;  2DK3 A;  4LD6 A;  5GAM f;  5GAN 6;  2QTV A;  3E19 A;  4ZTF A;  2YUN A;  2CP3 A;  1GRI A;  3QPH A;  2DTH A;  2RN8 A;  4QVZ A;  4WF2 A;  1LVK A;  2EYX A;  2M16 A;  3URG A;  4RKU E;  4FIB A;  3VUZ A;  4MZT A;  1YWO A;  1VQ4 T;  2J05 A;  1ACM B;  2RMO A;  1VQL Q;  3V8K A;  1ZUU A;  2LQN A;  4F17 A;  2RQR A;  3LX7 A;  1ZA1 B;  1VQN T;  4JZ3 A;  3J81 E;  4J9F A;  4A4F A;  2QA4 T;  4HVW A;  3M4G A;  1PSE A;  3CCM T;  2E41 A;  5CIU A;  3OYD A;  4J5Y A;  4AMC A;  4N0A C;  1B7T A;  3FLG A;  3PIP A;  2OJ2 A;  1WHG A;  4M77 C;  2D9T A;  4M7A G;  2GFU A;  2KK4 A;  3EH1 A;  3QUI A;  1UJY A;  5AYF A;  1D3B B;  2C0T A;  2QGF B;  4R55 A;  1MMN A;  1WQ7 A;  3JCM P;  2O88 A;  2L2P A;  1YIT A;  4ATO A;  1YHQ A;  1WJR A;  4FU6 A;  4C8Q E;  3VS7 A;  4BUG A;  2RA2 A;  5LJ5 h;  2HNI A;  7AT1 B;  3LYI A;  4ZGE B;  3JCM g;  3EG9 A;  3EFO B;  4Y91 A;  3LLR A;  4XQ3 A;  4UC4 A;  3CC7 Q;  4OB0 B;  1RL2 A;  1X01 A;  2KRN A;  3A8G B;  3CBM A;  1YJW T;  1HYO A;  1N8R C;  3ZBD A;  1MMD A;  3CCR A;  1WNL A;  4E7H A;  4M75 C;  1JU5 C;  3ME9 A;  3CMA A;  1K73 C;  1VYT A;  5GAM g;  4QKU A;  1FWZ A;  1G2B A;  3R6N A;  3JB9 I;  4N4I A;  3H0I A;  1W2B S;  1YWP A;  1VQ5 Q;  1Q81 C;  3OMC A;  3MEW A;  4KBM B;  3V8J A;  1QVF S;  1UUE A;  3CXC A;  3CCL Q;  1VQN Q;  1K0X A;  2SRC A;  4JS4 A;  2QA4 Q;  4QQG A;  2HEQ A;  3EGU A;  3BDU A;  3HRU A;  3PFS A;  2O4X B;  1YBY A;  3UWN A;  1WZO A;  5FU6 C;  3QWX X;  4IKF A;  1WHL A;  4ZN3 A;  2D1X A;  4HVU A;  4C8Q G;  2J06 A;  3X28 B;  5LJ5 f;  3M0S A;  3GOX A;  3ZFJ A;  2V8K A;  3FJ5 A;  2F5T X;  1UGS B;  1ZA2 B;  2HKQ B;  2RB6 A;  2RHY A;  3M4Y A;  2LRQ A;  2ZPB B;  2L5Q A;  2P4R A;  4DQ2 A;  2ZPE B;  2VGN A;  1ZUY A;  1QVG A;  2YUO A;  1M1K R;  1HD3 A;  2PUO B;  2OTL A;  1VQO Q;  4C0Z A;  4PLL A;  2E6N A;  1FXX A;  2COZ A;  2J6F A;  1VUB A;  1WXU A;  4WTO B;  2M02 A;  1ZQ1 A;  3V7R A;  3CCE T;  3I56 A;  2BUD A;  2L3R A;  2AIR B;  2O01 E;  2E3H A;  3HRS A;  1BKB A;  2K9G A;  4EMK C;  2DXC A;  4AFU C;  1VQ9 T;  3CC4 A;  5FWB A;  5D6X A;  1FMK A;  1G5V A;  5GAN 5;  2DA9 A;  4JLG A;  1KD1 C;  1QP2 A;  2X4J A;  4M78 E;  5M9O A;  2CSQ A;  2CT4 A;  4OMM A;  3SWN A;  2P0Q A;  3OA6 A;  1Y96 A;  2FRY A;  4XTX A;  3CD6 Q;  1TUD A;  3PVL A;  3EAE A;  2IG0 A;  3JAM E;  2VGM A;  5LJ5 g;  2RK1 A;  1GXI E;  5A2Q E;  1K9A A;  2RQW A;  4A4K A;  4QQD A;  3E2U A;  1Q81 U;  1M8V A;  3QZ9 B;  1O9S A;  2L89 A;  3VS1 A;  2RPN A;  4PJO E;  1JQQ A;  1VYU A;  1TSF A;  5CAI A;  2JZ2 A;  3OBW A;  4FYY B;  1KG1 A;  3CCJ A;  1VQK A;  4PKC C;  1SRM A;  2CS7 A;  3VYG A;  1Z9Q A;  5A0D A;  1OV3 A;  3CME Q;  1JRI A;  2LC4 A;  2NUP B;  2CUD A;  3QBY A;  2GFA A;  1IHV A;  1KK7 A;  1QWE A;  4E2F B;  1PC0 A;  5IHI A;  1NEG A;  3CBP A;  1EFN A;  3NHN A;  4E7I A;  3L42 A;  2EJ9 A;  1OOT A;  4IIO A;  4LDW A;  2QAZ A;  2F1L A;  2MMP A;  5CVI A;  4ZNX A;  2VUB A;  2DZ9 A;  3GLX A;  2RI2 A;  4AG1 C;  4M78 G;  2DET A;  3CC2 T;  3X25 B;  2DYI A;  1UEB A;  2PUK B;  4IUT A;  1YI2 A;  5GAO r;  2RHZ A;  3MEA A;  3J7A F;  5CKB A;  3L2V A;  4PK4 A;  2OAW A;  2EQU A;  2LP5 A;  3LGF A;  4E47 A;  4D6W A;  5EG2 A;  2HL3 A;  5LJ3 f;  1M1G A;  4BD3 A;  1VQL A;  2HD0 A;  4PJO G;  5LJ3 e;  2O31 A;  1MNE A;  2ZPF B;  2AKK A;  1PKS A;  2P4T A;  1SF9 A;  1GCQ A;  3PGG A;  1VQ6 Q;  4JRQ A;  3F70 A;  4PJL A;  2QQA A;  1B07 A;  4HKE A;  4C92 G;  2EQK A;  1K8A C;  1V1C A;  1Y7X A;  1YP5 A;  4X9D A;  4M7A A;  3M56 A;  1OU9 A;  3VJP A;  3SD4 A;  3CCV A;  1KD1 U;  4KH0 B;  2DE0 X;  3JB9 D;  2CZ7 B;  3OYN A;  1GL5 A;  4C5I A;  1EX4 A;  4JJN K;  2X4W A;  1OU8 A;  3M0U A;  4B9X A;  3PVQ A;  4CC3 A;  1YIT Q;  4QVC A;  1NG2 A;  1R77 A;  1VQP T;  5GAN e;  4XU3 A;  1QMC A;  2PQW A;  3CC7 A;  1TU0 B;  2HAX A;  1UG1 A;  3DB4 A;  2F5K A;  2DJZ A;  3M57 A;  2NLU A;  2AHJ B;  4X9C A;  3H9N A;  2DO3 A;  4LDV A;  5GJW B;  3MP8 A;  3JB9 F;  1M5Q 1;  3RKW A;  1VIE A;  1VQ4 A;  2LCC A;  1N9R A;  4HCK A;  1AEY A;  2H3J A;  1B34 A;  1VQN A;  1D09 B;  1V29 B;  3N5B B;  3MHX A;  3EH2 A;  3L2Z A;  2QA4 A;  4C92 D;  2K3B A;  2QEX T;  3CCM A;  4DA4 A;  2HKN A;  3SWN C;  2EJF A;  2EIF A;  2BZY A;  1Q81 R;  3C4S A;  2DTI A;  3HPW A;  2DEQ A;  1QQJ A;  1RLP C;  4Z8A A;  4C8Q A;  3OYK A;  2HSP A;  5GMK i;  2CZ0 B;  3JV3 A;  4B9W A;  5D6W A;  2DPP B;  5A0L A;  1X6G A;  4GLK A;  2M51 A;  4GY5 A;  1TS9 A;  1WXT A;  1E6H A;  1NE8 A;  2LJ1 A;  1ZSZ B;  4C92 B;  1RAE B;  4DBH A;  5IAY A;  4C92 F;  1VQ8 T;  5D7U A;  2KMT A;  2EKO A;  4EDU A;  3AHU A;  4FYV B;  1GBQ A;  3OYM A;  2YHT A;  2MWP A;  1J3T A;  1NLP C;  2DTO A;  2E6Z A;  4QVD A;  1VQO A;  3BW1 A;  1YJW A;  2YSQ A;  4KGZ B;  1PHT A;  2DZC A;  2HQE A;  2PVG B;  2K79 A;  4OMF B;  1Y07 A;  4DOV A;  4R0K A;  1K8A U;  2OTL Q;  4QT7 A;  2YUP A;  2K4Y A;  2RNA A;  1NPP A;  3MEU A;  3NTI A;  2L3P A;  4RG2 A;  5FU7 B;  2FO0 A;  3I5R A;  2DFU A;  1H3H A;  3CC4 Q;  3BFM A;  4JPB W;  2HQX A;  5GAN 7;  3M59 A;  3JCM h;  1PD0 A;  1RAI B;  2COW A;  2JOY A;  2K5F A;  2EQI A;  1G3T A;  3JCM c;  2JMC A;  3SDZ A;  1TWB A;  3CD6 A;  1KSW A;  1C6V X;  2LJ0 A;  1X27 A;  4J7F A;  4BDY A;  2C06 A;  1IO6 A;  2HBP A;  1KD1 R;  5IH2 A;  2QK0 A;  1KIK A;  2Y4Y A;  5KCO A;  3ZEH A;  1KHI A;  4HT8 A;  4M7A C;  1AWX A;  2QDY B;  2CYZ B;  2DRK A;  3VS4 A;  2A0F B;  1SSF A;  1VQ7 T;  4JJC A;  4JRI A;  1JXO A;  3UPU A;  3REA B;  4ESR A;  1VQK Q;  2JS0 A;  3EGD A;  3I9Q A;  4NS5 A;  4BY6 B;  4FCY A;  2FL7 A;  3G7Z A;  3TSW A;  2KY9 A;  4ANJ A;  1TUG B;  5GAO n;  1WFW A;  4J9B A;  5DY9 A;  4AG2 C;  1Q82 R;  5CQY A;  3CCE A;  2XI9 A;  2VVK A;  3RES A;  4A54 A;  1Q7Y U;  1PD1 A;  2D0Q B;  1WYX A;  2HCK A;  2YRV A;  1VQ9 A;  2ROT A;  1RI9 A;  3JCM f;  4M78 A;  2G6F X;  5HKC A;  2QQB A;  5GAO l;  3JCM e;  5GMK m;  3EFR A;  3CEY A;  1HJD A;  1IGU A;  3RKY A;  4JRP A;  1YI2 Q;  3CCQ T;  1RAG B;  3MP6 A;  2Z0W A;  1VQM T;  2VKN A;  5KYU B;  2DIG A;  1UHF A;  5GAM e;  3E9G A;  5CO7 A;  4PJO A;  4J7I A;  2VB6 A;  4AFZ C;  3G71 Q;  3G1J A;  1VQ6 A;  5HK0 A;  1IRE B;  3SFM A;  1IXD A;  2VWF A;  1NEB A;  2RI3 A;  5ECA A;  3VU3 C;  4BE2 A;  4J6X A;  4JDS A;  3JB9 J;  4C8Q C;  2RJD A;  3VUB A;  2MPX C;  4L5G A;  2HL5 C;  2R5A A;  5KYW A;  5GMK j;  2NUT B;  3EFS A;  4MZP A;  4EIK A;  2ED1 A;  5DM7 R;  3CCU T;  1NM7 A;  1NPR A;  3LWI A;  4KGV B;  3CCV Q;  1LJO A;  1CKB A;  3MET A;  2D0N A;  4C5E A;  1FYN A;  2X51 A;  3JCM Q;  1K8A R;  1TUC A;  1IRX A;  2VC8 A;  3VS5 A;  1Y96 B;  1YN8 A;  2KAF A;  3VS2 A;  1CKA A;  2DVE A;  2E10 A;  2KXD A;  3CC2 A;  4M7D D;  1AVZ C;  4AFS C;  3OS0 A;  3JCM X;  2KXC A;  3RUX A;  1UGP B;  1SG5 A;  2CT3 A;  1BIB A;  3M0T A;  2EKH A;  4P5N A;  3CCQ Q;  2DKG A;  4V2S A;  2LCL A;  2EYW A;  2QQR A;  2MYS A;  4F7U G;  3UF4 A;  3EGX A;  3QDR B;  2MK5 A;  3NTH A;  4XTZ A;  1VQ4 Q;  1E7O A;  4OMO A;  1K76 A;  2EVR A;  4M7D B;  5GJV B;  1U8R A;  4M7D F;  1I07 A;  4RMO A;  4MDX A;  1QKW A;  3VRY A;  2DBM A;  3RMQ A;  1N27 A;  4X1V A;  4HCZ A;  4MML A;  3CCM Q;  4M4Z A;  2J7I A;  2B86 A;  2XMF A;  2C0I A;  4PJM A;  1WHK A;  2WAC A;  2EJG A;  1M90 U;  4IUR A;  4FSX A;  2E65 A;  1P92 A;  3GNG A;  9ATC B;  3NGP A;  5DLQ E;  4OB2 B;  1GFC A;  4KGX B;  4ZN1 A;  2A7Y A;  5HY6 A;  5LJ5 e;  3OYH A;  2MWO A;  1MMG A;  4LDY A;  1TG0 A;  3L2U A;  1WPY A;  2OX7 A;  1Q86 U;  1FMV A;  2YT6 A;  3EHR A;  1Q7Y R;  1MUZ A;  1OUL A;  1WHM A;  2EYQ A;  1YCY A;  1X6O A;  2YWW A;  5IT9 E;  1G3S A;  2W0Z A;  3M9Q A;  2KDS A;  2MIO A;  1YJW Q;  1MV0 B;  4NOY A;  1M2V B;  3MP1 A;  3UA7 A;  1QCO A;  3RER A;  3HL8 A;  4DBR A;  2EAY A;  4M78 C;  1W4S A;  4E7Z A;  2K3Y A;  3RDV A;  3G4S T;  2QEX A;  3A8O B;  1KQ1 A;  2LT4 A;  2PZ1 A;  2CGH A;  1H3Z A;  3TU4 K;  4N4H A;  5GAN d;  2RJE A;  2BIV A;  3UDC A;  2LDM A;  2QAS A;  4ELZ C;  4F7U B;  1M27 C;  4M75 G;  2KBT A;  2E64 A;  4F7U F;  1QLY A;  1ZHI A;  1M4Z A;  1M1F A;  4J8O A;  5HK3 A;  1BI2 A;  2CZ6 B;  4J9H A;  4FT4 A;  4II1 A;  5DLO A;  2DLP A;  1Y57 A;  2ZPH B;  1BI3 A;  5I21 A;  2CUB A;  1D3B A;  2FRW A;  2QXF A;  3H0F A;  2CP5 A;  3X20 B;  1UGV A;  3OYJ A;  1M30 A;  3LGL A;  3CCS T;  2FYK A;  1YIJ T;  1JJ2 S;  3GF5 A;  5LL6 S;  1OX9 A;  2XDB A;  2CRE A;  4RTU A;  4F16 A;  1Q82 C;  4KH1 B;  4D8K A;  4M77 D;  1IHW A;  3ZL7 C;  4RTW A;  3FIF A;  2PU9 B;  2D8H A;  1UB4 A;  4CC2 A;  4OML A;  3A8M B;  1JJ2 P;  2EQJ A;  3Q1J A;  3EFO A;  3VKI A;  1YCS B;  4RG8 A;  4C92 E;  1SSH A;  3P8D A;  2YLB A;  5I2M A;  5C0M A;  2DL3 A;  2AZV A;  8ATC B;  4BE0 A;  3JB9 G;  2BE7 D;  3CCE Q;  1WJQ A;  3OS5 A;  2AZS A;  3FC3 A;  4RTY A;  2KYM A;  2LT1 A;  2M0O A;  3UAT A;  1GBR A;  4M77 B;  2RHI A;  4B6M A;  2JW4 A;  2JS2 A;  4M77 F;  3S3N A;  2AKL A;  1VQ9 Q;  2F2W A;  1UTI A;  4JZ4 A;  3NFC A;  8AT1 B;  4HCB A;  5IN1 A;  4M75 D;  1X69 A;  2E4H A;  3P8H A;  2HMA A;  4IUU A;  5GAN 8;  4PLI A;  3H8Z A;  1M3C A;  4C5G A;  4VUB A;  1YHQ T;  2O4X A;  3TEE A;  4RTV A;  1NJI C;  2EGE A;  1D1A A;  3H0H A;  4JS5 A;  4FYW B;  3G71 A;  3G6E T;  5KYX B;  4CC7 A;  2D8J A;  6AT1 B;  2YRC A;  1UEC A;  2DJQ A;  2Y4X A;  2EPD A;  3C12 A;  1S72 T;  1K4U S;  2QQS A;  1M90 R;  2ZZD A;  3CCR T;  1VQ7 A;  3TVT A;  1BB9 A;  4M75 B;  3WVD B;  2V26 A;  3MO8 A;  4Y28 E;  4M75 F;  3OYB A;  3CMA T;  1NYF A;  2LTO A;  1RAC B;  2DXT A;  2KNB B;  2I0N A;  3OW2 P;  2LX9 A;  5CR2 A;  1QVP A;  4XU0 A;  2KSS A;  2DF6 A;  2EYY A;  2JVV A;  3REB B;  5I11 A;  3QJ6 A;  4DBF A;  1WI7 A;  2FPD A;  1WIE A;  1Q86 R;  2EFI A;  4C0D C;  2VV5 A;  3DLL A;  1WXB A;  4KUL A;  4PNO A;  2DIL A;  2F2X A;  2FB7 A;  4C5H A;  1VA7 A;  1ZX6 A;  1RAB B;  2P84 A;  2X3X D;  4J83 A;  2V1Q A;  3S3O A;  1KC8 C;  2XU8 A;  2P0K A;  2R5M A;  4HXJ A;  5FU6 B;  2CSI A;  3V7S A;  3C94 A;  3CC2 Q;  2WSE E;  3M54 A;  2V1R A;  3CCQ A;  1Q82 U;  3X26 B;  4ORZ A;  2CP7 A;  1VQM A;  1XNI A;  3ASK A;  4FM4 B;  3L2R A;  2YUQ A;  3OYL A;  2FHD A;  5FRN A;  3BDL A;  5KYY B;  2XK0 A;  5HCK A;  2ZPG B;  3LWH A;  4J6W A;  5KCH A;  3GBQ A;  3RKX A;  3O8V A;  4QQ6 A;  3G6E Q;  1OQK A;  2W10 A;  5C6S A;  2LQW A;  3HHT B;  3FDR A;  3E1S A;  3PT9 A;  3M0Q A;  3I55 T;  1BI0 A;  1NYG A;  1O75 A;  1S72 Q;  2JUF A;  4J6Y A;  3SHW A;  5I22 A;  3M55 A;  1PSF A;  2GNC A;  2KRM A;  3VV0 A;  3KXT A;  3M0P A;  1YJ9 T;  3LH5 A;  1H64 1;  3CPF A;  2JNG A;  2NYS A;  3CCU A;  1Y71 A;  4EMG A;  3TCJ A;  1Q7Y C;  4EMK B;  2LQ8 A;  2DM1 A;  3DB3 A;  1BBZ A; 
#chains in the Genus database with same CATH homology
 1OI1 A;  4C0F A;  5GAO l;  5GMK e;  1I5L A;  4R56 A;  1YIT T;  4ZTJ A;  1NJI U;  4IKF A;  4ZN3 A;  3JCM e;  5GMK m;  5GAM d;  3EFR A;  4C8Q G;  3V7C A;  2B8A A;  2KQW A;  3CEY A;  2M1H A;  3QII A;  3X28 B;  5LJ5 f;  1LNX A;  3RKY A;  1K9M U;  4JRP A;  4L6V 5;  3GOX A;  3CCQ T;  3SB2 A;  2V8K A;  3ZFJ A;  5GAN h;  3MP6 A;  2EWN A;  1K9M C;  2F5T X;  1UGS B;  1VQM T;  2RB6 A;  2RHY A;  3FB9 A;  3M4Y A;  5GAN 4;  1KQS A;  3UWN A;  2DXU A;  5J39 A;  3GPL A;  2DIG A;  3OW2 S;  3MEV A;  5GAM e;  2LRQ A;  2ZPB B;  3UT1 A;  3E9G A;  1G3W A;  5CO7 A;  4J7I A;  4PJO A;  2L5Q A;  1FX7 A;  3L2Q A;  3RIR A;  1QP3 A;  3C95 A;  4DQ2 A;  2ZPE B;  2VGN A;  3MCA B;  2A3L A;  5CK9 A;  1VQ6 A;  4M7D B;  5HK0 A;  1QVG A;  1IRE B;  3SFM A;  2PUO B;  4OB3 B;  2OTL A;  4XU2 A;  2K5L A;  2E12 A;  4BY6 C;  4C0Z A;  2DIQ A;  4PLL A;  2E6N A;  3M58 A;  1FXX A;  2RI3 A;  3CCJ T;  3VU3 C;  4HA8 A;  3OQ5 A;  1VUB A;  4BE2 A;  4J6X A;  3QXE B;  4JDS A;  3JB9 J;  4XTV A;  4C8Q C;  5CKF A;  2JTM A;  3JCM W;  3OBY A;  1UGR B;  3OMG A;  3PMI A;  2RJD A;  3VUB A;  1ZQ1 A;  1I81 A;  4L5G A;  3V7R A;  3CCE T;  2R5A A;  5GMK j;  2JN0 A;  3EFS A;  4MZP A;  3OYE A;  4BI3 A;  2FVU A;  4PL6 A;  2BUD A;  2L3R A;  3I56 A;  2O01 E;  1KC8 U;  1OZ2 A;  3HRS A;  1BKB A;  4C0G A;  5DM7 R;  3CCU T;  3LWI A;  1NPR A;  4EMK C;  1LJO A;  4A4E A;  2DXC A;  1VQ9 T;  5GAN 3;  3CC4 A;  1MHN A;  3MET A;  3OS2 A;  3OYG A;  4C5E A;  4KUD K;  5D6X A;  3JCM Q;  4N4G A;  4EPC A;  1G5V A;  4JRK A;  5GAN 5;  2DD4 A;  4JLG A;  3VYH B;  4M7D E;  2VC8 A;  2QTX A;  5J3B A;  1KD1 C;  1Y96 B;  1QP2 A;  5GAM j;  1RI0 A;  2X4J A;  2KAF A;  3L1A A;  4M78 E;  5GAN f;  3S3M A;  2E70 A;  3CC2 A;  2E10 A;  2DVE A;  5M9O A;  4M7D D;  4RCB A;  3JB9 H;  3SWN A;  2RHX A;  3OS0 A;  2P0Q A;  3DKM A;  3CPW S;  4M78 D;  3JCM X;  3HFO A;  3RUX A;  4F7U A;  3OA6 A;  1UGP B;  1Y96 A;  4XTX A;  1BIB A;  1U1T A;  4RCC A;  3GNF B;  4A4H A;  2ZCF B;  4P5N A;  3EAE A;  2IG0 A;  3JAM E;  2DKG A;  1YJN A;  4NL3 A;  4V2S A;  2LCL A;  2VGM A;  5LJ5 g;  2RK1 A;  2QQR A;  5GAO q;  5A2Q E;  1GXI E;  4F7U G;  3OSV A;  4A4K A;  4QQD A;  3QDR B;  1I8F A;  1JJ2 A;  3X24 B;  3NTH A;  1Q81 U;  1M8V A;  3QZ9 B;  1O9S A;  4XTZ A;  2L89 A;  1VQL T;  2OTL T;  4PJO E;  2DAQ A;  5CAI A;  2JZ2 A;  2JTF A;  3OBW A;  2XHC A;  1KG1 A;  3CCJ A;  1VQK A;  4JUV A;  4PKC C;  3QG1 A;  4M7A A;  4PJO D;  3CBO A;  3CXC S;  2CS7 A;  2DD5 A;  3KUF A;  4O5V A;  3VYG A;  1G3Y A;  5A0D A;  5LJ3 g;  1VQ5 A;  1U8R A;  4M7D F;  4RMO A;  4MDX A;  1JRI A;  2PVD B;  3HRT A;  4M78 B;  4NL2 A;  2LC4 A;  1WJS A;  3QBY A;  1U1S A;  2GFA A;  1TH7 A;  4M78 F;  3RMQ A;  1N27 A;  3JCM d;  3CCL A;  4XTU A;  3G4S A;  4E7L A;  4HCZ A;  2OAU A;  4MML A;  3I56 T;  3OB9 A;  4IUP A;  3CBP A;  2G3R A;  3FJP A;  2RO0 A;  4E7I A;  4A53 A;  3L42 A;  2EJ9 A;  3WXM B;  1W2B A;  1XQH A;  2XDD A;  3CC4 T;  4LDW A;  2CZ1 B;  5LJ5 d;  2MMP A;  5CKH A;  5CVI A;  3JCM J;  2X4X A;  1N6A A;  1QVF A;  4TVR A;  2K2V A;  2WAC A;  4M7D G;  2EJG A;  5GAO m;  2OTJ A;  2MI6 A;  4IUR A;  1M90 U;  2CKK A;  2VUB A;  2DZ9 A;  3GLX A;  2E65 A;  1P92 A;  2RI2 A;  4FSX A;  4BAC A;  3GNG A;  4M78 G;  2LNV A;  5DLQ E;  1KQ2 A;  4OB2 B;  1M90 C;  4PJO B;  3CC2 T;  3X25 B;  3A8H B;  3GP8 A;  3HP9 A;  4N0A A;  1UEB A;  2PUK B;  3QYG B;  4IUT A;  4PJO F;  2A7Y A;  5HY6 A;  4ZN1 A;  5GAO r;  1YI2 A;  2RHZ A;  3MEA A;  4OP0 A;  3J7A F;  4M77 A;  5LJ5 e;  5CKB A;  3L2V A;  3OYH A;  4YTL A;  2MWO A;  4OGC A;  3WVE B;  1M1K C;  2EQU A;  4LDY A;  2E5Q A;  3LGF A;  4E47 A;  4D6W A;  2K5I A;  5EG2 A;  2VXE A;  3L2U A;  1WPY A;  5LJ3 f;  1YJN T;  1Q86 U;  3CC7 T;  3CCS A;  5GAN g;  4IUQ A;  1QVG S;  4F7U E;  2V8I A;  2RK2 A;  3QO3 A;  2EYQ A;  3LW5 E;  1M1G A;  1YCY A;  3PMT A;  4BD3 A;  1X6O A;  1Q86 C;  1BYM A;  3H6Z A;  3QKJ A;  1VQL A;  4A4G A;  5IT9 E;  1G3S A;  3M9Q A;  2HD0 A;  1XTD A;  4PJO G;  5LJ3 e;  2KDS A;  2ZGW A;  2ZPF B;  4NOY A;  1MGQ A;  4C92 A;  3MP1 A;  1VQK T;  2P4T A;  3OW2 A;  2XDP A;  3RER A;  4M7D C;  3HL8 A;  4OB1 B;  3PGG A;  4JRQ A;  1WGS A;  2EAY A;  2LVM A;  3F70 A;  1VQ5 T;  3A8L B;  3M5A A;  4M78 C;  2QQA A;  4KUI A;  1W4S A;  2XKO C;  4HKE A;  4HT9 A;  4C92 G;  2EQK A;  2K3Y A;  1K8A C;  3CCL T;  3J80 E;  1X75 C;  3G4S T;  2P0P A;  4EMH A;  2R58 A;  1Y7X A;  3INZ A;  4OF1 A;  1WQW A;  2QEX A;  3A8O B;  4X9D A;  4Z02 A;  1KQ1 A;  2LT4 A;  4M75 A;  2QI2 A;  3QJY A;  3R6O A;  3M56 A;  5KE2 A;  3VJP A;  3SD4 A;  4BDZ A;  1QW1 A;  3CCV A;  1KD1 U;  2CGH A;  3A5Z B;  1H3Z A;  3TU4 K;  4N4H A;  4CRI A;  2GCX A;  3SWN B;  5FLX E;  1AHJ B;  5LJ5 j;  5GAN d;  3GIB A;  2RJE A;  2BIV A;  3OYA A;  3JB9 D;  3UDC A;  2K57 A;  2LDM A;  4ELZ C;  4F7U B;  2CZ7 B;  2OTJ T;  3OYN A;  4M75 G;  4F7U F;  2E64 A;  2L8D A;  2VYT A;  1ZHI A;  4C5I A;  4JJN K;  2X4W A;  1BI1 A;  1M4Z A;  1M1F A;  4J8O A;  4B9X A;  5HK3 A;  1BI2 A;  1R8O B;  2CZ6 B;  4FT4 A;  2RI5 A;  4II1 A;  5J26 A;  5DLO A;  4QVC A;  1YI2 T;  1VQP T;  1DJ7 B;  3QZ5 B;  5GAN e;  3OYF A;  2ZPH B;  3BY7 A;  1BI3 A;  4KT0 E;  4XU3 A;  5I21 A;  2QQ9 A;  5LJ3 j;  3PTA A;  1D3B A;  2QXF A;  2DXB A;  1ZBX A;  2PQW A;  3OSS C;  3CC7 A;  3X20 B;  2RHU A;  4ZGD B;  3OYJ A;  2V8J A;  2HAX A;  3LGL A;  3S6W A;  3DB4 A;  4M77 E;  2F5K A;  3CCS T;  2Y90 A;  2DJZ A;  2FYK A;  3M57 A;  5KE3 A;  1YIJ T;  1N9S A;  1JJ2 S;  3GF5 A;  5LL6 S;  3RMS A;  2NLU A;  2R57 A;  1EIF A;  2AHJ B;  4X9C A;  2DO3 A;  4LDV A;  3T9N A;  5GAM h;  1KHC A;  3G6E A;  2XDB A;  1UGQ B;  1Q82 C;  3G71 T;  4M77 D;  3MP8 A;  2RJF A;  4LD9 K;  5CCA A;  3FIF A;  2PU9 B;  3JB9 F;  4BB7 A;  1UB4 A;  1M5Q 1;  4XTY A;  1VIE A;  3RKW A;  1S72 A;  1VQ4 A;  2LCC A;  1N9R A;  3FRN A;  3A8M B;  1VQO T;  3P8B B;  2EQJ A;  3Q1J A;  3VKI A;  2LQK A;  3QHS A;  5CKD A;  4RG8 A;  3JRZ A;  1BIA A;  4C92 E;  2H3J A;  3HSB A;  1B34 A;  3OYC A;  1XOV A;  3L2W A;  3P8D A;  1VQN A;  2YLB A;  3CME A;  1JBM A;  3E9F A;  1V29 B;  2M9U A;  3N5B B;  3MHX A;  5I2M A;  3L2Z A;  5C0M A;  3OYI A;  2YLC A;  2QA4 A;  5FRO A;  4C92 D;  1VQM A;  2PVO B;  2X4Y A;  1M9S A;  2QEX T;  3CCM A;  4BE0 A;  4DA4 A;  3JB9 G;  4OVA A;  2WSF E;  3TRE A;  1WJQ A;  3CCV T;  3OS5 A;  5CQX A;  3SWN C;  4C0D B;  3FC3 A;  2EJF A;  2EIF A;  3PNW C;  2M0O A;  2LT1 A;  5GAN j;  2D6F A;  4M77 B;  2RHI A;  3JCM V;  4X34 A;  1IZ6 A;  4M7A E;  2WSC E;  4M75 E;  4M77 F;  3S3N A;  2X35 A;  2GF7 A;  2XG8 D;  4FL6 A;  3C4S A;  2DTI A;  2GQV A;  3NFC A;  5GAO p;  4BE1 A;  5KH6 A;  2RH2 A;  2DEQ A;  3HPW A;  4HCB A;  5FRM A;  5IN1 A;  4C8Q A;  1M1K U;  3OYK A;  5GMK i;  4M75 D;  1KQS S;  2CZ0 B;  4M7A D;  4L59 A;  1VQP A;  3P8H A;  4B9W A;  5GAN 2;  1OYX A;  2DPP B;  5D6W A;  5A0L A;  4GLK A;  5LJ3 d;  4IUU A;  5GMK l;  5GAN 8;  4GY5 A;  2F69 A;  3LH0 A;  3H8Z A;  4PLI A;  4C5G A;  2RD1 A;  3NTK A;  4IUV A;  1NE8 A;  4QW2 A;  2K3X A;  4XK8 E;  3HKS A;  4VUB A;  1YHQ T;  3CD6 T;  3JSC A;  4C92 B;  4EMK A;  1YIJ A;  2O4X A;  4M77 G;  3TEE A;  5IAY A;  1NJI C;  4XAX B;  4C92 F;  4LDX A;  4CI0 C;  2DK3 A;  4LD6 A;  5GAM f;  1VQ8 T;  4BI4 A;  5GAN 6;  4JS5 A;  2KMT A;  3E19 A;  3G71 A;  2VXF A;  3G6E T;  4ZTF A;  2EKO A;  4EDU A;  3AHU A;  3QPH A;  3OYM A;  2DTH A;  2YHT A;  3OY9 A;  4QVZ A;  2MWP A;  4WF2 A;  2M16 A;  2DTO A;  2E6Z A;  4RKU E;  3URG A;  4FIB A;  4QVD A;  3VUZ A;  2Y4X A;  4MZT A;  1VQO A;  3BW1 A;  3C12 A;  1YJW A;  1S72 T;  3PIO A;  2QQS A;  1VQ4 T;  2DZC A;  2HQE A;  2PVG B;  2ZZD A;  4OMF B;  1Y07 A;  4M7A B;  3CCR T;  1VQ7 A;  3V8K A;  4M75 B;  2MAM A;  3WVD B;  4DOV A;  1K8A U;  4M7A F;  3MO8 A;  3LX7 A;  4Y28 E;  4M75 F;  3OYB A;  2K4Y A;  4E7K A;  3CMA T;  1NPP A;  3I55 A;  2LTO A;  3MEU A;  2DXT A;  1VQN T;  1VIF A;  3NTI A;  3CME T;  2LX9 A;  5CR2 A;  1QVP A;  4XU0 A;  4RG2 A;  2KSS A;  3J81 E;  2JVV A;  4A4F A;  3KBG A;  5FU7 B;  2QA4 T;  3QJ6 A;  4JLI A;  3M4G A;  1PSE A;  3V8L A;  3CCM T;  1HXD A;  2E41 A;  3DLM A;  5CIU A;  4ME7 A;  3OYD A;  2EFI A;  4J5Y A;  4C0D C;  4N0A C;  4ZGJ B;  2VV5 A;  1I4K 1;  3FLG A;  3PIP A;  2BKD N;  3OS1 A;  4M77 C;  1JB0 E;  2D9T A;  3DLL A;  1YJ9 A;  2GFU A;  4KUL A;  4M7A G;  4PNO A;  2KK4 A;  4ELY C;  4DOW A;  3QUI A;  4PJO C;  3BFM A;  1D3B B;  2FB7 A;  2IVW A;  5AYF A;  4FT2 A;  5GMK h;  4C5H A;  2HQX A;  5GAN 7;  2KVQ G;  1NZ9 A;  2RM4 A;  3M59 A;  4J83 A;  4R55 A;  4HCC A;  3JCM h;  3S3O A;  1KC8 C;  2XU8 A;  1WQ7 A;  2JOY A;  2P0K A;  2R5M A;  2RJC A;  3JCM P;  2K5F A;  5FU6 B;  3V7S A;  1G3T A;  3JCM c;  1YIT A;  3SDZ A;  4ATO A;  1YHQ A;  3C94 A;  1WJR A;  3CD6 A;  2WSE E;  4FU6 A;  4C8Q E;  2I2L A;  4C92 C;  4BUG A;  1OZ3 A;  2RA2 A;  3M54 A;  4LDU A;  4Q5W A;  4O6J A;  3CCQ A;  5LJ5 h;  1Q82 U;  3X26 B;  4J7F A;  1VQ8 A;  2HNI A;  4BDY A;  3ER0 A;  4XU1 A;  3LYI A;  4MMK A;  4C8Q D;  4ZGE B;  1XNI A;  3ASK A;  3JCM g;  2EQM A;  4FM4 B;  2MF2 A;  3L2R A;  4MDW A;  4Y91 A;  2FHD A;  3LLR A;  3OYL A;  4XQ3 A;  2C06 A;  5FRN A;  3BDL A;  3CPW A;  2HBP A;  3OYY A;  4UC4 A;  2XK0 A;  1N8R U;  2XD0 A;  4OB0 B;  1B34 B;  2ZPG B;  1RL2 A;  3HFN A;  3LWH A;  1X01 A;  2Y4Y A;  4J6W A;  3A8G B;  5KCH A;  3ZEH A;  5KCO A;  3CBM A;  1YJW T;  1K73 U;  2XIC A;  1N8R C;  1KHI A;  3RKX A;  3ZBD A;  3CCR A;  4HT8 A;  3O8V A;  1WNL A;  2QDY B;  3QYH B;  2CYZ B;  4M75 C;  4E7H A;  4QQ6 A;  5LJ3 h;  4M7A C;  3ME9 A;  4MZM A;  3JCM b;  5C6S A;  1SSF A;  3CMA A;  1VQ7 T;  5CKE A;  3FEO A;  3HHT B;  3FDR A;  5GAM g;  1K73 C;  3E1S A;  3PT9 A;  4JRI A;  2XID A;  3UPU A;  1VQ6 T;  5L8R E;  3I55 T;  1BI0 A;  1FWZ A;  1O75 A;  3JB9 I;  5FU6 C;  4N4I A;  1W2B S;  2JUF A;  4NS5 A;  5FU7 C;  4BY6 B;  4BI8 B;  1Q81 C;  4J6Y A;  3QSU A;  3M53 A;  3MEW A;  3OMC A;  4KBM B;  2FL7 A;  3G7Z A;  2KY9 A;  3V8J A;  1HK9 A;  5GAO n;  1QVF S;  4C8Q B;  5A0G A;  3CXC A;  5DY9 A;  3M55 A;  1PSF A;  4XTW A;  5CQY A;  5I2S A;  4C8Q F;  4JS4 A;  3CCE A;  2XI9 A;  3VV0 A;  4OGE A;  3RES A;  2E1H A;  3KXT A;  1YJ9 T;  4E7J A;  4QQG A;  4A54 A;  1Q7Y U;  1H64 1;  3CPF A;  2JNG A;  3CCU A;  2D0Q B;  1Y71 A;  2ZPI B;  3BDU A;  4M7D A;  2YRV A;  3HRU A;  3JCM f;  1LOJ A;  3TCJ A;  4EMG A;  3PFS A;  4EMK B;  1Q7Y C;  1VQ9 A;  2O4X B;  4M78 A;  2LQ8 A;  3DB3 A;  1YBY A;  5HKC A;  5D6Y A;  2QQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...