2PVPA

Crystal structure of d-alanine-d-alanine ligase from helicobacter pylori
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
329
structure length
329
Chain Sequence
HMEFCVLFGGASFEHEISIVSAIALKGVLKDRIKYFIFLDENHHFYLIEESNMHSKYFAQIKEKKLPPLILTHNGLLKNSFLGAKIIELPLVINLVHGGDGEDGKLASLLEFYRIAFIGPRIEASVLSYNKYLTKLYAKDLGIKTLDYVLLNEKNRANALDLMNFNFPFIVKPSNAGSSLGVNVVKEEKELIYALDSAFEYSKEVLIEPFIQGVKEYNLAGCKIKKDFCFSYIEEPNKQEFLDFKQKYLDFSRNKAPKASLSNALEEQLKENFKKLYSDLFDGAIIRCDFFVIENEVYLNEINPIPGSLANYLFDDFKTTLENLAQSLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine-D-alanine ligase
publication title Enzymatic characterization and crystal structure analysis of the D-alanine-D-alanine ligase from Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Ligase
total genus 86
structure length 329
sequence length 329
chains with identical sequence B
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2007-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2pvpA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2pvpA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pvpA01
2OLSA 4FFNA 2YS6A 5KKNB 2XD4A 2NU9B 1PK8A 5FNVF 1JDEA 1DIKA 1EZ1A 3K3PA 2V5AA 1IOWA 1BNCA 1VBHA 2SCUB 4XZ3B 4IHJF 3MWDA 3BSSA 5LXTF 3TIIA 4EA7A 2W6NA 4FFRA 2NU6B 5C8YF 2R7NA 3ETHA 3VMMA 2Z04A 4EABA 3JRXA 2HJWA 3KAJA 2FB9A 2FPGB 3V4SA 2DIKA 1Z2PX 2NU8B 4M9CA 2FPIB 5LYJF 2NU7B 3VPDA 4O86A 1JLLB 4YJ3F 4IWXA 3RV4A 4MA5A 5CB4F 5IYZF 3MWEA 3WO1A 4FFOA 1Z2NX 1M0TA 2YW2A 2NPOA 2VR1A 4I4TF 4MAMA 4XYLB 3NUAA 4O7VA 3OUUA 4O7SA 1A9XA 1E4EB 3KAKA 2R82A 2NUAB 4YAJB 5LA6F 3LP8A 5HBRB 2CZGA 5JVDF 2GQSA 5C1OA 3K5HA 1KJIA 1KEEA 2DZDA 3TIGA 2YWVA 4TV9F 2GPSA 2FP4B 4O2AF 1BXRA 1EHIA 2VPQA 3Q1KA 3K5IA 1I7LA 4HR7A 4FGRA 2V58A 1W96A 3MJFA 2WYOA 3G8DA 3VPCA 4MV1A 4EGQA 4ZI7F 3WO0A 4HNVA 1KJ8A 2ZDQA 2GQRA 2CNUA 3R23A 3R5XA 3SE7A 2YZNA 2R86A 2IP4A 3GIDA 4MV8A 4MV3A 5LOVF 5JQWA 3U55A 4HQ6A 4YB8B 4EA9A 3VPBA 2R7KA 3HBLA 2VQDA 4O83A 1KUTA 3ORRA 1CQIB 3ETJA 3Q2OA 1W93A 2YZMA 4O7ZA 4FU0A 4O84A 3R5FA 3RV3A 4WD3A 5HV6A 4MV7A 2XCLA 4TUYF 2YZLA 3E5NA 1VBGA 2R7MA 3AX6A 4MV9A 3QFFA 5J2UF 2C00A 4HNUA 4O4IF 4QSHA 4TV8F 5JVLA 3V4ZA 4ZHQF 3GLKA 1ULZA 1DV1A 2YRXA 4ZQIA 5CAEB 5BPHA 2GPWA 2FPPB 4O4HF 4IWYA 1JDBB 4MV4A 4FFLA 3RUPA 4HNTA 1EUDB 1M0WA 3JRWA 2DLNA 3WNZA 4O82A 1AUXA 2Z02A 1UC8A 5C1PA 5CA1F 5LP6F 2PVPA 2VHEA 2W70A 4YAKB 4EGJA 1T36A 1KJJA 3JZIA 4O7LA 1I7NA 3U9TA 4NYEA 1GGOA 2QK4A 4XX0B 2W6MA 5D8DA 4XYMB 2I80A 2W6OA 4O7NA 3BSYA 4M99A 4J6EA 4O2BF 3U54A 2X0SA 3UFXB 2R84A 1M6VA 1PX2A 1AUVA 5BPFA 3RFCA 2ZDGA 4ME6A 3VOTA 2PN1A 3HB9A 2DWCA 3LWBA 4IIJF 5H80A 3BFPA 2I8CA 2YYAA 3BSWA 4M98A 3KALA 2YS7A 3R5HA 4O7WA 5JH7F 1GLVA 1E4EA 4MV6A 1DV2A 1CE8A 4M9UA 5GONF 2W71A 4I55F 2R85A 2V59A 4GGMX 1A48A 2CNQA 4WBNF 2CNVA 5BMVF 3TW6A 4O7TA 4EG0A 1WR2A 4YJ2F 5KX5F 2ZDHA 5K2MA 4Y8VB 1Z2OX 2QF7A 4E4TA 3G8CA 4EAAA 1KJ9A 3TQTA 3BG5A 1EUCB 4O7YA 1OBDA 2W6ZA 4DLKA 2PBZA 3N6RA 2YL2A 4C5CA 2R87A 3I12A 2CQYA 1GSHA 2W6PA 5I47A 2HGSA 2YRWA 1GSAA 1CS0A 2YZGA 1JKJB 1C3OA 2R6FA 3U9SA 5JQGF 4C5AA 4MA0A 4I50F 2GLTA 3JZFA 1IOVA 1CQJB 5J2TF 4FFPA 3OUZA 4ZOLF 1GSOA 3ORQA 2P0AA 4IZOA 3AW8A 3TINA 4FE2A 4L1KA 4DIMA 1KBLA 1UC9A 1C30A 4RZQA 1OBGA 3R9RA 4C5BA 4EA8A 2J9GA 3DF7A 4YBZB 4O81A 1EYZA 5EZYF 1SCUB 2R7LA 4O7RA 1B6RA 5CA0F 1VKZA 3KREA 1KC7A 3HO8A 4O4LF 4FFMA 3N8DA 2W6QA 2I87A 5DMXA 1B6SA 1KJQA 3VA7A 4O4JF
chains in the Genus database with same CATH superfamily
1KBOA 3KCQA 4CTMA 4AWAA 4L02A 5GADl 1DIKA 5D1HA 4XAQA 1A82A 4BNJA 5BWCA 4LXGA 3BA9A 5T4FA 4AY4A 2R79A 1QCDA 5EJIA 3HBMA 1ZAKA 1QO9A 4G0UA 1NR1A 2VLIA 3A0UA 1JAXA 5LZ8A 4PU0A 1C9MA 3D8SA 1TEHA 2H9IA 4MAFA 3BJEA 3AEUA 4GNKA 3R3YA 2Q6IA 4L28A 1RJ9B 3ADOA 1Q7TA 1AQUA 3GRUA 1TWAA 1FB5A 2WMNB 2AJBA 4H1UA 1V8OA 2FPRA 4I4TF 4KV7A 1Y80A 2V7TA 3SIXA 1C81A 3KAKA 4MW2A 3RYIA 2JKYA 1IVNA 1DUSA 2BGKA 2CZGA 5KDLA 1RLJA 2AKAB 2IDKA 1UJ6A 5ICGA 2G9NA 4IGFA 4Y1RA 2ZATA 3ZZ0A 4QLOA 4KFTA 3MHTA 3C7TA 2MOKA 4UNRA 2XOKA 3MFYA 4JC4A 1W85A 2WA1A 2HLNA 2YV4A 2YXBA 3C6YA 1BRMA 3D3EA 3ASZA 2YY5A 4GRIA 3NBAA 1B73A 4COKA 4IKEA 1VGRA 2H7VA 4ID9A 4R0VA 1GHTA 1ZQ9A 5EEHA 5FUVA 4K05A 5HZMA 3VX3A 2JZOA 1VAJA 1QIKA 4QTYA 4X95A 4QFCA 2EX4A 1VPDA 4QFBA 4AP6A 5FOWA 2JJMA 2VQEH 5L3QB 2MMGA 2AE1A 2PNFA 1WCIB 1XZIA 4YPFA 4X41A 3IUJA 4FZJA 4I8DA 4IXTA 3RSLA 4X24A 4DR6B 2Y76A 1TIBA 5IVPA 1V9PA 4PYRA 4MB0A 4FBUA 2C00A 3ADBA 5DYNA 1LLQA 1FX1A 1T13A 4QAQA 4IXMA 4N39A 5I5GA 5DM4A 1VIYA 4W5JA 5EHGA 4WCFC 3N40P 1D07A 2OZKA 1QFZA 3WLTA 1TA0A 2TRSB 4HMOA 4LQLA 3DBHA 2CBGA 1HDOA 3RB0A 3PO3G 4MW9A 5FQNA 4E33A 2IRWA 1SUSA 2CMHA 2ENUA 3DP9A 4FWIB 3WLFA 1E0SA 1YVEI 3BT7A 4NEQA 5COQA 4Y2VA 4IIJA 4LVOA 3OQMA 4V0RA 2D1SA 1T1EA 1LKZA 3SQXA 3VJRA 1SIBE 2G7ZA 5KFIA 4IH1A 3FWKA 1SEVA 2XWSA 3QLVC 3HDHA 1JFFB 4DOMA 3L8DA 3AEQB 3OJXA 3UZBA 1EB9A 3VTFA 2R25B 4K46A 3ZDRA 5AJXA 3ZZTA 3R0ZA 4BQQA 3C15C 3KYDA 2ZSUA 3FH0A 4F46A 1EIWA 4O7YA 2NT3A 5BYKA 4HV4A 1XWFA 4Z4GA 1D2GA 4MPJA 3PGVA 1J0EA 1BKYA 4NU6A 5BWNA 4LF6B 3WYBA 2GEBA 1P0QA 5ARBA 1FJXA 4EVSA 1Q7GA 3I1JA 3H0CA 3BXPA 5HTOA 3A37A 2F64A 5CB6A 1EEHA 1DOZA 3PX2A 2HWUA 2VT2A 1KBLA 4IQ0A 2OV6A 2XF8A 3VTZA 2GRAA 4BTEA 4A15A 1XTQA 3KT8A 1OHHA 3MTGA 1GAQA 4DL7A 3IPLA 5J1TB 4DLWA 1DEXA 1U8YA 3ER9A 3UAYA 3IPRA 1TIKA 5H3HA 4ZFNA 4AROA 4F50A 3UW1A 3WWZA 3E2IA 3H1TA 2PZAA 2FWAA 1V71A 2HA4A 4MO2A 4AF6A 3O8NA 3RADC 3MBKA 4BBJA 2H6EA 3A05A 4N65A 3V1UA 4IQFA 1A7UA 2JHCA 1T34A 4LG1A 1QGUA 3ZWBA 1YZQA 1NNEA 1IN4A 4NI5A 2F55A 1YQ9A 2O8VA 3GFSA 2H1LA 1R10A 4DR2H 2EBWA 3SOPA 1C1DA 1CJUC 4NDNE 4CEJB 1UK6A 1ZW1A 2WF5A 2JIZA 4DPKA 1VBMA 4ZRNA 4D26A 1R6VA 3B1ZA 3RAQA 3T1TA 5EIWA 3Q8SB 5ALLA 5A62A 2IY8A 1NBME 3ZHCA 3B7PA 2J0QA 1L1QA 1ONPA 2C9DA 4UVDA 2RB4A 1WF3A 2PLRA 3JWHA 1PJRA 5FUXA 2XUKA 1CUIA 2BHTA 2V3VA 3V8QA 4J75A 4BP3A 3PHBE 2QJWA 4UM7A 4ENRA 4IINA 3NORA 4MGYR 3THWB 1K88A 2V9ZA 4IIBA 3EMBA 1T2FA 1ZC4A 3S3TA 4HB4A 6REQA 1SOWA 3AUFA 4IVNA 1YRQA 1Q0UA 1U9IC 3IP1A 1OBVA 3PDIA 4Q0MA 1EK1A 2C2YA 4XDGA 2Y1EA 4JLSA 4G86A 1ZIPA 1N2CA 4XFDA 5FTKA 1TYCA 1KKUA 4EY8A 2YDYA 1CLEA 1E5QA 3RSQA 1J4AA 1QXSA 1L7QA 1L4GA 3KOZA 2CCJA 4A0RA 3I09A 4PX3A 1PG0A 2HMVA 1QRDA 3T7DA 3C97A 5E0OA 5K05A 3ZIDA 5EGSA 2E89A 3PB3A 1WSWA 4ARIA 2VHUA 2XCTB 2R8EA 2LCIA 1O97C 4L27A 4JBNA 5CLLA 4C7OB 2OVFA 2Y0SE 3UHAA 1M2OB 3T0IA 4UD6A 1EFUA 2IU4A 3WHKA 1K9SA 4KI0A 2E6UX 4ZOLA 3P32A 5BN5B 3LHSA 5GGYA 2B36A 1YOVB 4S1WA 1DEOA 1O03A 4NNJA 4D57A 5AXBA 4PSDA 4JLUA 4IJ5A 3VH4A 1BX0A 4NONA 2C4TA 1ATZA 1XHEA 5IT0A 2FI1A 1W34A 3OHPA 4KIUA 1WZUA 3PNKA 2NT4A 2IDZA 3ZWKA 4KHZA 4YJDA 4ECUA 4NX2A 4N5IX 1IN8A 4FCVA 4NYMR 5BWXA 2OHHA 1TZ2A 3PC7A 5GY7A 1BHO1 1H23A 5JJCA 4XWTA 3O26A 1IBSA 1D5WA 3O9ZA 4LHYA 4CUJA 2YS7A 4UFZA 2C54A 4RY8A 1V1MB 3OF2A 2CV1A 4GMHA 1V96A 4B8WA 4KI7A 2Z5VA 2WWXA 1W25A 4CF4A 4QVKA 2O3QA 3PI6A 4DWOA 1UWLA 3DTFA 4YDQA 5ENDA 3TY5A 3EG9A 2R8OA 1Q2XA 2IPMA 3CUKA 1Y37A 3NIBA 3VC7A 1C8BA 5FORA 3RVPA 5CFNA 3SYRA 4O3FA 4C0WA 1U80A 3FPKA 4RTLA 2XNDD 2P0YA 3STVA 3TUZC 4TL7A 3T1YB 1CS0A 3PTLA 1J42A 5DEIA 1N0WA 2OAEA 3EXHA 5MGBA 3H2ZA 3DE4X 1XJ0A 2WQZA 4RNMA 5GONB 1PT7A 4ND7A 3HO6A 1CPYA 1AQLA 2BT4A 4CKCB 1EUQA 4LF7B 3ZDEA 3EZFA 2J0UB 3A70A 3LCMA 2W11A 1OU4A 1K2WA 2YYSA 4DMLA 5TJ9A 3OJ0A 1K8ZB 4TXHA 1AHHA 5TF4A 4E7PA 2YIJA 4V2IA 1G20B 1U3VA 3K0KA 3D2CA 3WGQA 4TKUB 1EMDA 1DBWA 4UHCA 4FS3A 1E6CA 3VYUB 2I6SA 2DFDA 2FPUA 3EXIA 2PA0A 5JQGB 3T54A 3EFBA 5KKNB 4G09A 4B4OA 3H2HA 4JI8B 3HCDA 2WJIA 2C95A 3MBOA 3ZJTA 4XCVA 1BE1A 1S10A 1FNNA 1QZXA 4GECA 2ADMA 3D8HA 3A7EA 5CH3A 4I1PA 4JA2A 1DEKA 2HV9A 3EZ2A 5FTLA 1O96A 2A7XA 2PMDA 3PN1A 5EZSA 4ZT6A 4B7CA 3TKAA 2OYSA 4L8GA 2HTFA 4LRUA 5JATA 1TAQA 3PE4A 3JAKA 2H2HA 3HWX1 2PUCA 5KFJA 3L7KA 1SKBA 4RS3A 2PHZA 3KD3A 4DSTA 4HYQA 4OMDA 2J67A 3F71A 3ZI0A 2G80A 4RFSB 5EGNA 2JFQA 4WZAE 3U5TA 2ZCUA 1X7XA 4EELA 1TF2A 1X42A 2E0IA 1MZBA 5KDDA 1E3JA 2P77A 2FZEA 1FFBA 3MWDB 3DLPX 3NKFA 4EHNA 2ZIEA 3CRMA 5TDHA 4CIWA 2MIIA 2PMKA 4H35A 3SSAA 5LQMA 1F51E 5CE8A 3G8DA 3AVQA 4ESOA 1H05A 3ZLVA 1F8FA 3EZNA 1DRVA 1RNLA 4PG7A 5IMBA 1A8PA 4BAGA 2V9CA 3H20A 1KQ3A 4R8KA 3T3DA 2WNHA 4I4TB 4QUGA 2JLUA 3NHFA 2XLBA 2YZNA 5DX0A 3ZEIA 3OPVA 5IRCD 1VG0B 1HYHA 5L4LA 3SXUB 5CXSA 3T15A 2EJ3A 2NVXA 1C9DB 1H2EA 3VC2A 3VR5A 3IP7A 4RD0A 4UBJA 3HVRA 4KWCA 1F2DA 3PNLA 4GKKB 4WMLA 1PZMA 2Q62A 1XZKA 4GXQA 3OD5A 3L1JA 1NI3A 4DA7A 5K09A 2WUVA 4KNVA 3QNWA 2C0QA 1L7BA 4UMDA 1YJ5A 5LIRA 3LPDA 3GTJA 3T5CA 3V3KA 1UF9A 1C3VA 3MGAA 2R5NA 8LDHA 2LP4Y 5IJXA 4C78A 1N6HA 3H0EA 4XRGA 5JRJA 3QPCA 4QHTA 4Z4EA 4PZAA 5JDCC 4QICA 5ECYA 5LP6F 2WTUA 3NPMA 1FDTA 4E22A 3MNFA 5EUQB 2N1BA 4O2BA 4B3SB 2QK4A 2XGGA 5F9LA 1P45A 4PO3X 2J3JA 1G5QA 1L5OA 2QYOA 3UWDA 1JKJA 4ZQGA 1U9CA 1EFAA 4PCAA 1BWQA 3ZVLA 3EIFA 1U1CA 1OV4A 5ANRB 4J9NA 3NNNA 1PEYA 4GC7A 2W57A 4G8JA 2OFWA 4EPRA 4DC1A 3WISA 4YAGA 2HU5A 2JCVA 5JAHA 3I9KA 1T3GA 1L9XA 4EF4A 4LE2A 5A04A 1NQXA 1NE7A 4GPEA 1NW3A 1X9HA 3NNSA 4OM7A 5EVJA 1U5CA 3E8MA 3SKYA 1E79D 5E6SB 2VCYA 3IEIA 4CU5A 5E4FA 1T9DA 4XD2A 2VCHA 4UEOA 2I7CA 1Y1WA 3HM2A 1K89A 1OX4B 1Z7EA 4BVEA 4S1VA 4NBLA 5KMGA 4RV9A 4OI4A 4HYEA 3U13A 1OAOC 2A92A 5TQVA 2XPCA 3RS2A 2R8HA 3EDRA 1VC2A 4ALMA 4QFDA 2QL9A 1U9YA 1LZLA 3NM5A 4BASA 1YAHA 3RFUA 1NU6A 3OP1A 4TLDA 1LLFA 3OLQA 4XD7D 4E88A 3TZ6A 2JB9A 1FTQA 2VUSA 3NPAA 1WTCA 5DBHX 1EJ0A 2I2DA 4U7GA 1B0AA 4WAUA 2COEA 1JI0A 4V1CB 2AX3A 4WL0A 3V7NA 2JZNA 2PUWA 5I9MA 3ZVNA 5KAPA 5C3EG 2WP8J 1LVHA 2AOUB 5HUJA 3OE7D 1EFRA 2JGIA 1Y9DA 1IMOA 5HWSA 2DU8A 2X15A 4E5YA 4GIBA 2GGSA 2Y4NA 3S27A 3G6YA 1J00A 2B5VA 1N6KA 2H63A 4G5FA 3GIPA 5L1JA 4Z86A 3F7MA 3RTBA 2WVAA 3MWEA 2FP3A 2YVUA 1WETA 1AGXA 4N6NA 4J9KA 2PS3A 3OHBA 1ZETA 5D7BA 4YV7A 1ST3A 5GM1A 2EBUA 3KVOA 2CUKA 2RJNA 4X92A 4PCUA 4S1TA 3GFVA 1NLMA 4NZMA 4C4ZA 2ECQA 1GCAA 2H07A 2J5BA 4CTKA 4QIWA 3NC0B 5BOSA 4WHMA 3TW4A 3HXQA 3HXOA 3PQ4A 2C77A 1B76A 1LV7A 5JSFA 4H1HA 5F98A 5H4GA 4L7QA 4B7UA 2O48X 2VVTA 3MWJA 5HNEA 3D1JA 1U63A 3ZD9A 3K5WA 1JAYA 3JR3A 2QIPA 2BFCB 3D8UA 4YCAA 4RZHA 1GQRA 4P80A 2I1LA 4EVRA 1SK9A 3C43A 4PAGA 2VT3A 4M1KA 3U7FB 4R16A 1KI9A 3NT4A 4B6QA 1JR6A 5I7RA 1VIAA 1C8LA 1PJ4A 5F3WB 4N5MA 4MPTA 1JIVA 3HN2A 3CCCA 3CCFA 2V8OA 1J2JA 4WXRA 3FBTA 4H9GA 3ITKA 3L49A 1AO3A 1PBTA 3P9QA 1IWPB 4GWKA 3TI7A 2MMCA 4BRUA 4KWTA 1FLDA 4FD2A 1N2EA 2JS7A 5KFWA 1DIOB 1WCXA 4DIOA 1NRIA 3FZQA 3HZZA 1FNSA 2OA0A 4ECRA 2B61A 3MC1A 2QRHA 4HQLA 2RI1A 3BKXA 2QTRA 1QONA 2ZJ8A 2OHFA 1P1HA 3WG9A 4F4UA 4JEUA 4LMPA 1JA9A 4ISCA 3AZOA 3WFZA 1MC8A 2PO7A 5KTOA 1OAKA 4B45A 5F7JA 4C03A 2LVBA 4EEYA 2ZU0C 3HB5X 4UEQA 3GT7A 2ZQYA 3UIEA 4GP6A 5CFQA 2XTNA 3QYAA 4LJSA 5HS4A 4EHIA 4GKJH 1H93A 3TWOA 3F2VA 3CH4B 2XCUA 2VTVA 4WEOA 4K2AA 3CLKA 2B2CA 3UQ8A 4LRYA 2H18A 4FP9A 5DZSA 1WPGA 1RYEA 2CJWB 1F8XA 4UUQA 4EI8A 3I92A 3GAZA 1B7GO 4GM0A 4BCDA 2AD1A 4J43A 1M34B 4Q4JA 1V48A 1F38A 1R4MB 4CKYA 2CLIB 4YHHB 5C2JB 5ESWA 1OWOA 4A3EG 3BICA 3VKUA 3T3MB 2MT9A 3H1BA 4P8RA 3V9AA 2NUBA 4Q12A 2IHNA 3OM8A 4MV5A 1V11A 1XD2B 4HB3A 4NJEA 3C3MA 2GX6A 4FINA 5CU7A 2AE2A 5IUKC 1Y89A 2X4DA 1WMBA 1CUHA 2JJ1A 3BMOB 4NARA 1DQPA 2R1VA 3SIPA 3A1VA 4RHEA 3PGMA 4Q3AA 2ZJOA 4LWOA 1Z0FA 3ZWQA 2JGKA 2XQGA 2GKSA 3RHSA 1JBEA 3GJ3A 4EGFA 5DMXA 3UJ9A 2ZIXA 4G9GA 2RJOA 3BRQA 3K9BA 1BE0A 4X66H 2H4FA 5C5CA 3WYGA 8GPBA 2IUFA 1M54A 4N5DA 1DGQA 1KI7A 1G63A 3ICEA 2IEDA 3VDMA 5AKJA 3PX7A 2NTVA 5CXXA 2C3YA 3Q7RA 4DMHA 5L7WA 2YVKA 3EEYA 2C07A 4HN4B 4DV0H 1S9HA 3H83A 2ID8A 1YS7A 4MUFA 3RJ5A 1PNTA 2HA0A 4HK4A 3NXKA 5C53B 1H0RA 3D7MA 2D2IA 2WM2A 2J41A 5IT4A 1H8ED 4KXNA 1EVJA 1RWVA 3F6RA 4IP0A 4E5MA 5HGJA 5LKRA 1EX7A 4H17A 4YREA 4O86A 3TW8A 4D9MA 3SHQA 2M6SA 5DHPA 2G6TA 3RKUA 4I7HA 1O0CA 1YS2X 2BHSA 3EOBI 3MPUA 4FE7A 1Z33A 1JQ3A 3O8LA 5JNUA 5CLFA 1M2VA 5KG3A 1N4AA 1FMCA 5FLKA 4D9HA 3ZJVA 4JI7B 2W2LD 3D8NA 2X9LA 2EP7A 3BK7A 3GRKA 1UT5A 4HN2A 1H0SA 3LPLA 4OHMA 3P9IA 2NMVA 3PWSA 1HE1C 4LOKA 1GD1O 1IPFA 4FYMA 4QYXA 4WBXC 2B4YA 4K6NA 1VCIA 2QJFA 2QN7A 2OORC 4RSHA 3NATA 1ZZEA 2WSMA 3DS8A 4V0SA 1NP7A 4B3RH 4YAWA 2PMEA 1ZD2P 1M7JA 6ABPA 4GSKA 4L9RA 2X0NA 4XVRA 1JIIA 3I9V1 2C2GA 1TMOA 5LB4A 1FMLA 4RD4A 3DLTA 1SKQA 1PZHA 3HSSA 4B7XA 5JAPA 3KTAB 3DXFA 3HEMA 1EUDA 1UC5B 2Q3EA 2NVBA 1E5VA 4H4EA 2DWPA 4IHAA 1Q0QA 4CCYB 1FLAA 2VHVA 1VJCA 5LCXA 5T4HA 4C6HA 1IUKA 2WAYA 5CEEA 3FSGD 5C31A 1D7OA 5HP4A 2HMAA 3HACA 4KITB 1JAHA 1PR6A 5TF0A 1N5JA 4CMAA 3ZNQA 1JH8A 1KERA 1P7WA 4YQZA 3T7TA 4C29A 1Q3KA 2RGBA 3ADKA 3T5MA 2H65A 3IA2A 3G2IA 1VKHA 3PNQA 1RQ7A 2I4OA 3TTUA 1JDBB 3MTEA 2BSXA 2FUCA 5ICEA 1AUXA 5HVNA 4EF6A 4ILEA 4URHA 3DE6X 5AJWA 3W90A 4G8BA 1U7TA 3OPXA 4Q5IA 4V0NA 3S99A 1DAAA 1D6JA 4EFKA 3C85A 1NC3A 5K3BA 3L6EA 3RBXA 1AN9A 1ZHHA 2ZTUA 4A2QA 3IERA 4D8UA 3QUAA 1DKRA 4CM4A 3RFCA 2FZWA 4A27A 4CIXA 5CDUA 3HABA 2XGOA 2HFJA 4OB7A 4ZJUA 2BSAA 1FFEA 3F4BA 3ZWOA 1JEQA 4FC6A 4H0NA 1THMA 4BVHA 2HRDA 3NIFB 5D6NA 4KQ1A 1MCZA 4F2GA 4F11A 5LP6B 5KX5F 5DHFA 2PIDA 1JT2A 4OHBA 1A4UA 2AK3A 1PT6A 5AKGA 3LI2A 4LHEA 1JLHA 3DQQA 1Z9BA 1NPDA 3N2KB 1OXUA 4D0SA 2Z8XA 3WLIA 1EKFA 5DQHA 2C2EA 5AW9A 5FOSA 3O1JC 1VE5A 4O63O 5B6PA 2LDXA 2YWRA 1E1QD 3DWFA 3E5HA 1E89A 2FUG6 2VSOA 4FUQA 1WBJB 3T9DA 1KE2A 1Z28A 4ESVA 2ZM6H 3T6KA 2UVPB 2VJMB 3AJ8A 4EG5A 3QITA 2F43A 4XB6B 3HL4A 3OT1A 4NV3A 1CY4A 1U3DA 4YAUA 4ZOEA 1XWIA 1XU4A 2Y1GA 2C78A 3D6JA 2Z8YA 1LBQA 2ZJ7A 3HJUA 4XPIB 4MUKA 1E2KA 2Q0XA 5BSEA 1CZOA 2PCJA 2Q50A 5C0OE 4JXXA 2XNHA 5KT2A 1GADO 2J48A 3BZBA 2AJ8A 1IC6A 2PWAA 1SGWA 4OHKA 1M5UA 3DOCA 4R98A 4Z51A 2ACWA 1N2BA 2VBIA 4YMTA 3O3CA 5EOYA 3P2IA 4TMWA 1MOSA 3LT4A 1XN4A 1ZAUA 2F9LA 2PUTA 3AGPA 4BX8A 1I9CA 2WHXA 1VA5A 3TJMA 1UK7A 3PSHA 2FVXA 3NR2A 4C7XA 8ADHA 5KYVA 1P0CA 1XEXA 4MMYB 2PX2A 1AV7A 4AN0A 4Q9HA 4MW4A 4P3PA 1PSZA 1KF0A 2HHCA 1GKKA 4M0KA 4O25A 2A0XA 1DQNA 2AZXA 2EJTA 2Y2VA 3DJFA 5G0UA 1Z2NX 4WXPA 1UKVY 1P7CA 1A71A 4GI5A 4MS3A 2HHLA 1AS0A 3L7NA 3W4IA 4Y0AA 1Y7PA 4A6PA 4DV3H 1TT7A 4KX5A 4M1QA 4MGEA 1BJKA 1VA4A 1U1IA 4Q03A 3UGQA 1JYSA 1XKTA 2D1YA 1HNWB 3CH6A 3SICE 1CEEA 1ZR2A 1UBCA 1PQYA 1ECFA 1EDOA 1RJWA 4Z7NB 4LQDA 4D9GA 4CQJA 4YX9A 1KEUA 4F4YA 2AU0A 2AFHB 2EEZA 2JFPA 4JQCA 1GPYA 5DULA 3COPA 4Q4HB 1U1DA 3CRNA 2CNUA 2IH5A 1YA8A 2XNKA 1CJKC 1L1EA 3M83A 4JI5B 2PQ2A 5CIWA 1XT6A 3CR3C 1Z75A 5A3SA 2AFIE 4YXWD 2VHTA 4AQDA 2RI0A 3VRHA 3R5SA 2EIYA 5K6AC 1OF1A 4B6EA 1QHIA 1ZSYA 5CD1A 3ZGXA 4E09A 4OD0A 4X90A 3RYTC 4ENWA 1PW5A 1QDEA 3KKMA 3D4LA 3G17A 2PK3A 5AKEA 4HEJA 4ZYWA 1Y8ZA 2HXYA 4OHWA 3ZBPA 4RZSA 2O8EA 1F2UA 2JEYA 1NXSA 1RBYA 3A2MA 2Q5JA 2FN4A 4FDVA 4GBMA 4JOSA 5HIKA 1S5PA 3QYFA 2ZGVA 3TQHA 3O3OB 3EAGA 3EH2A 3HKEA 3GTGA 4UPDA 3DMPA 2G9VA 3A06A 1J2TA 1JZQA 4IVPA 4GVLA 3P4YA 2DWCA 1JH9A 2V6FA 3EGDB 3AI3A 1RT9A 1TT5B 3E1GA 3GJ7A 2AQ4A 2MYNA 2QN1A 5AHRA 2QRGA 4JVMA 4JYZA 4N3GA 1U8XX 2ZRCA 1XZBA 2GHRA 4M4SA 4HDKB 1FJGH 3AV3A 1KY3A 1X1QA 2E5LB 3EPPA 3WFJA 1UBMS 1WUKS 2GN6A 2XF2A 8AT1A 5EWFA 3RTEA 5BSMA 3WNBA 4DIEA 4CLRA 1P2BA 1M1YE 4KBFA 4N9QA 1TQHA 3QUBA 3IOBA 1AQIA 1XXHB 4RKRA 5HX7A 1RAIA 1W1IA 2UZ3A 3DJYA 1A72A 4JJ6A 6AT1A 1XDWA 1PS0A 5HPYB 1KKMA 3QUTA 4RULA 2EP8A 2BR4A 3I72A 3EVDA 1NQUA 1QU3A 4R1NA 1D0VA 1UZLA 3FNIA 2R7LA 3U1TA 4ZYTA 3KJGA 3ZY5A 4Z0TA 1GAEO 4DLSA 1CYDA 4INAA 1MX1A 3TZCA 2R1TB 2XXAA 2X0IA 5LDGA 5JSZA 3OESA 2OO5C 5AIAA 3CRW1 3NH6A 4YT5A 1PL0A 2H2GA 1WOYA 3O8QB 2ZRBA 1QBGA 4KH0A 1KZ4A 4GF5A 4FDAA 2NYAA 4XVUA 5IULC 4IO1A 4IR7A 4LFAH 3L43A 5HZKA 1RD4A 5JS1A 1Z6TA 2FQYA 5I5YA 1P73A 4BNKA 4PVDA 1QNLA 3OKCA 4JSTA 5C81A 4EWLA 2AG0A 2ZVPX 1A88A 1RMTA 5AW2A 3PFFA 1JZTA 2VXCA 3QQ5A 2G07A 3RR2A 1FDSA 4K2HA 5DLGA 2I4RA 2PKYX 4Q3NA 421PA 3NGDA 2IUUA 2HLHA 1T0UA 2YW2A 3NWPA 1RI3A 4O08A 4LRTB 3M9WA 5FBRB 4RVSA 4L3WA 4OKIA 4LHXA 5HK8A 1F5SA 4RV5A 3ZE2B 5A3QA 4AO6A 3U39A 1U2GA 3HN7A 1D04A 6NULA 4RTPA 3PR3A 4HSGA 1E2HA 5IARA 3H2BA 5CX4A 5I5VA 3AHJA 1JIHA 1ZIYA 2V58A 2X2FA 1OGYA 1JHVA 2CXPA 2D8MA 4GR5A 2AN1A 2EFDB 3AK4A 1UBJS 1ZH0A 3QFCA 4PYQA 4GQIA 2YN2A 3OFJA 1O58A 4J29A 4LY9A 1W5TA 3AWIA 3SG0A 4YP9A 4BKRA 3A2KA 3N0XA 3QWHA 1CZLA 3HI6A 3A6JA 5JLAA 1UZNA 4CUZA 3H1AA 5JECA 3Q2OA 4TRJA 4CKXA 2HLPA 1RC0A 1EFHA 4MR8A 4F6RB 2JVIA 2QD1A 2X6TA 3DT8A 3E4CA 5H68A 1CDOA 4QO8A 2N9UA 3HCPA 4BE4A 1KY2A 1ZQ1A 2WM9B 1LRJA 3DHVA 1BGXT 3FTNA 4ARBA 3AP1A 3F0TA 4DLBA 2IBMA 1NF8A 4DJEC 4TTSA 1X7GA 2CVFA 4JNCA 3SR0A 3KKNA 4FE4A 4PQRA 4BGIA 3ZD7A 2Q3HA 4D1YA 2WE6A 3T7CA 4MTEA 4JI1B 4CMEA 1NDHA 4NICA 3MT8A 1UP4A 2O2HA 4UOZA 1PS9A 2C20A 4V3BA 4FHFA 1KMQA 4BVGA 3IT0A 4D81A 2WWTA 3ZKWA 3T7AA 4YJFB 4R3NA 4R31A 1C14A 3RVDA 2AZ4A 4I81A 3HA5A 3IT1A 3UBMA 2HIVA 2QS9A 3CEHA 1NXVA 4IJUA 3T5PA 2H11A 3K0BA 3GBSA 2IS4A 3BK1A 2B6HA 3BWXA 4FGJA 4F1KA 2ADOA 4NBSA 1VLJA 5HJEA 2I5PO 3NBXX 4IRKA 4OQYA 4FZ3A 1IMJA 3CZ5A 2WT4A 1WZNA 3O1LA 1VL8A 3BE6A 4E1BA 5F5XA 3CUSA 1GYPA 4IRXA 5LYYA 4UULA 4ZIRB 1F9EA 3FUUA 4RPCA 3UV7A 2WVGA 2QR5A 3FDXA 4RB3C 4WKNA 4LJ8A 3GGGA 1EH5A 4EJ6A 4JYAH 4JGIA 2OZLB 5KC9A 1UDCA 4JT8A 3J81k 1O3YA 3SC4A 4JV2A 5LKAA 3IDAA 2CCKA 4R9UC 4YV0A 4ZDIA 3HKBB 5FF9A 5K0FA 3BXHA 3R3HA 3CG0A 1Q92A 1SYXB 1DT5A 3EUFA 1WDTA 5ALEA 5KX5B 1KO5A 5EHZA 2C92A 1E9CA 3VMFA 7ABPA 1AX9A 3WAGA 4W8GA 2YQZA 2G5CA 4GRAA 2VQSA 2FPOA 3L4BC 5JWRA 3FWNA 2X58A 4NDAA 5K8JB 3VR3D 1HORA 1QIDA 5HXAA 4HTFA 1JLLA 3VUFA 4FIDA 2V3WA 4NAUA 1KK3A 3CN7A 2K7ZA 3RJMA 2EZ4A 1N2HA 4QTZA 5M5BA 2W98A 2XOXA 4FD3A 2AUMA 5KFRA 3KFXA 1QS0A 1ZCZA 1TM4E 4GXRA 3CLUD 4KP7A 4PCLA 3DO5A 4Z1MA 3A8TA 4BBPA 3G0HA 4QUHA 1WUHS 5A0FA 5K3EA 1J09A 2RHOA 4P4GA 1QF7A 3DPUA 2GD0A 4OA8A 4UE2A 1YR1A 4NIMA 3TCNA 3O8DA 4YP3A 4RF3A 4TTPA 3SBDA 1NJ8A 3BK2A 4OQ4A 2EYQA 1NSFA 2OSVA 5DX1A 3T9FA 4AICA 3VI4B 3TD2A 4GRDA 1MABA 3ZE6A 3LUCA 3ZW8A 1R4AA 2JD2A 5GVRA 2Z8ZA 4BJHB 4ROSA 4EDHA 4K9DA 1VKJA 1BS1A 1JDNA 3PR2B 1G7TA 5F23A 1J5PA 4M9XA 1Z37A 2I67A 4AZWA 1IHXA 3H2YA 4WLNA 1H1LA 1V16B 2O3UA 4K28A 1Y1PA 4B6RA 3QUCA 3Q3GE 1R27A 4HN9A 4CF6A 4M1TA 4RSGA 2HKIA 2C4HA 1EXVA 3AF5A 1YGPA 1NFRA 2R8JA 4YRFA 5ALTA 2B21A 3TMKA 5HRCA 4BVBA 2ZBFA 2A1HA 2JLSA 3KAPA 2J3IA 4M0PA 5A4AA 1QV7A 4JL6A 2WPDD 3GTOA 3WMEA 2UVRA 4KZKA 1WTAA 3ELDA 4NE2A 4QM7A 4BVKA 1RKXA 1ONNA 2FGKA 2V7QD 1M73E 4P81A 1Z17A 1SQGA 4KSCA 5DSTA 1Z2EA 4AX4A 5JAIA 3K0SA 4RABA 3ILYA 3NBUA 4JCOA 3IE2A 3PW0A 2F4NA 4MQFA 1FRQA 2RHTA 2QOEA 4J94A 4PRKA 4CCSA 1C0IA 2VDOB 4IX1A 2CT8A 3GJRA 2VTDA 4CR7A 3BFXA 4RLQA 4X5OA 4EYIB 3MF4A 4XWOA 2CNDA 1HNZB 4LF5H 3KL4A 2WUDA 2ZKLA 3TE7A 4HZIA 2SECE 3JD4A 2XBUA 4H6WA 7ADHA 1NVDA 4YH1A 3V4PB 4BPBA 3EQ9A 3CUTA 3V8PA 1FTYA 3TJZA 5LMCA 3DV9A 4PM4A 3UFXB 2P40A 2XWPA 3GYBA 1TK3A 2CLMB 3C5VA 3IO5A 4A8JC 5H59A 5B2EA 3HB9A 3L7JA 3U3RA 3R1IA 2ZRHA 1QTNA 4F7DA 1LDNA 3GGOA 2D06A 5D5HA 1NPYA 4OQXA 4EMSA 1S7CA 3IKMB 1XQ6A 4G1UC 4MCIA 2EQAA 2OYRA 3U4MA 3R8FA 1HE4A 1XDUA 5GJCA 1TVMA 3A1FA 3LL4A 4ETSA 1UFQA 3D02A 3CWQA 2Y1XA 4HUJA 5T6BA 4EW3A 4TWRA 4M88A 3T4UA 1KPIA 4M9ZA 1M10A 3JQDA 3Q2KA 1D5CA 1M6VB 3D3KA 3NX4A 2QL7A 2VPWA 2OLKA 2BZSA 3ZLBA 5AM4A 4Q00A 3QELA 2XRFA 3FUXA 3TAHA 3E05A 4KQMA 1YDEA 3SZRA 3KEQA 1CF2O 1N1DA 4C0QC 3MPOA 3Q4GA 4O7RA 4Q82A 3NANA 3GGSA 5J43A 3IQWA 2I6TA 4OP3A 4AL4A 3PVSA 2HY7A 1P4RA 4BEBA 1E2BA 2CDCA 2ECKA 4JS0A 2IJGX 2TMDA 5A5VA 1ZSNA 3PJRA 4L08A 2LW7A 1V6SA 2ZSKA 4G25A 2Q7XA 1PCXA 3JALB 1N7JA 3ROMA 4BUJA 4XCQA 1PJLA 5ECGC 2ZB4A 1I6UA 3PCXA 3FR7A 3HTXA 3O82A 2FFQA 1JS1X 4OJNA 4EFNA 2H48A 3DULA 5ALWA 1I6LA 2AEEA 3ZWWA 1WXQA 4WUVA 3ZIAD 2EIHA 5FBZA 3CPSA 4CVNA 4Y9SA 4LV8B 1J2RA 5IYZA 1RKVA 3ZWVA 1NNI1 3M33A 4RCZA 1O94C 3V4OA 3NWBA 4NVRA 1YS9A 1SWVA 3VSDA 1J9GA 5B37A 3QLEA 3G2KA 2X8BA 3WA6A 2WTMA 1SQ6A 3QWUA 2OR3A 1JR4A 4M89A 5JJLA 1TM7E 2VQ6A 2IXTA 1X1RA 3VOSA 3FSEA 3HOZG 3ZHUA 3C45A 4DA4A 2B5WA 1LLUA 4URUR 4C6RA 4EJSC 2R6AA 1Z2AA 4QTUB 1A5AB 1Y98A 3S24A 1AN7A 1E1CB 2Q0HA 2FP4B 2QRQA 1X15A 1U0OC 3KG2A 2D8AA 3VV2A 1N8NA 4HT3B 3V5NA 3CW2A 4ZI7F 2WHRA 4N8DA 3U44B 1B8NA 5SY9A 2WB1A 1LS1A 2UKDA 1SAYA 1WJGA 3HJBA 2Q5IA 3OLZA 4V0QA 4QXMA 4DQXA 4HQ6A 3K6JA 3DNMA 3BXFA 2EBHX 5ES4B 2BMWA 3FDFA 3DAAA 1ZGAA 1H3EA 1I2ZA 3THYB 1KEKA 1YKGA 1FS6A 3GIQA 1P4HA 1KUTA 3OQ6A 5E9AA 2QSJA 4LI0A 4D44A 5I7VA 3QY0A 4XUEA 4QEDA 1XYVA 2EGUA 3NC4A 5K0SA 2P6OA 2QY6A 4A2WA 4KXXA 3OQVA 3JQBA 3RU9A 4R7GA 3OEEA 2G06A 3RCBA 1V7ZA 2KS6A 3AVXA 1IY2A 2Q4BA 5FJ8G 3E7WA 3P2YA 5G1NA 4LXXA 4WOPA 3L8ZA 1TVCA 3DZCA 4Q02A 2RC6A 3PL5A 1U3CA 3MILA 4Y8VA 3VH3A 2C4UA 3EJWA 3F4KA 5KYUB 1I13A 1PNQA 2CD9A 2Y0SA 4FB5A 1P2DA 1J25A 4CLDA 5H1YA 2WJAA 1NJ1A 3QEMA 1H1TA 1EFVA 3AR2A 4J9LA 5BWBA 2I4MA 2IEAA 3C6ZA 2JHPA 5DASA 1T8SA 4LVNA 2OBXA 5EJAA 2FRDC 4DNFA 1NJFA 1NJSA 4OLFA 4ITVA 3AEXA 3H3VH 2XUJA 1BXGB 2ZIVB 4BNNA 1FX0A 2ZSJA 2HA6A 1PHPA 1OBHA 5KFVA 2VO1A 3SJ7A 4PR0A 3TDKA 2ZCJA 1DVRA 2P4SA 2WSSA 1VCNA 4DV4B 1YMVA 2WSLA 4LXIA 4R9VA 1V95A 5A9RA 1Z6YA 5B1EA 3FETA 1I7PA 1NVWQ 3IQXA 1N2SA 4PFKA 5BRAA 1L2TA 3VYVA 1C3OA 2H1OA 5JXJA 4YRTA 1G5IA 3PYXA 1Y6RA 2Z9DA 1UKYA 3GOQA 5LSAA 4X62H 1WD7A 3EZ9A 2NO1A 1GDHA 3OJOA 1PN3A 5BXYA 1EVIA 1Y8AA 1EZZA 2L18A 4TYPA 2WBLC 4ASUA 1HQKA 1G9SA 1JDTA 1VLZA 4PSCA 3WLEA 4K87A 1NYTA 2J59A 1QQTA 4HDNB 5C5EA 3KYBA 4HXEB 4JOCA 3DWGA 1RBQA 4P7FA 3OQNA 1K6MA 4ZRDA 3BULA 2OK8A 3BB4A 3IHKA 1JJAA 4Q44A 3F3YA 3VJLA 5L8VA 2Z1MA 5FNVF 4KQGA 3JWJA 5DLDA 2HNAA 2Z2KA 3HJNA 1NDQA 2O5VA 1VLMA 3A6KA 1FW6A 1YJBA 4KLRA 2JLWA 2XMBA 2A57A 2WD7B 4QPNA 2VWGA 2XYGA 4NABA 1NSYA 1CUFA 2P65A 1OWMA 3EQ6A 5FLXW 4O59O 2O07A 2UUBB 2OD2A 3VPDA 3IOMA 3HM9A 2EKLA 1J8MF 2B7CA 3GFTA 3CF2A 3D54D 1CUCA 3I8OA 5FI1B 4L15A 1UBOS 4I55B 5G3YA 3E9ZA 3MERA 2QVXX 4P32A 1V2HE 3OTQA 2IBTA 2M1ZA 2ZYUX 4GR4A 1T5OA 5EHIA 1Y3HA 4KRFA 3E22A 3K5HA 5BR4A 2GCOB 2DZDA 4ZI3A 1XCJA 4TZ0A 4RK6A 4MVJF 4G4IA 2GUGA 4UAGA 2Y0CA 4CGYA 4IXDA 2DUNA 2C5BA 4BWGA 3FF4A 5A7GA 5IEJA 1Z82A 5E2BA 3UA4A 2O2IA 1JBKA 3E1SA 1Q77A 1AKYA 1L5RA 4WE3A 1V8BA 2PH1A 3FPJA 1D1SA 4DQKA 3P20A 1FEZA 1UAYA 2VF2A 5CYGA 4K9KA 1IBKH 4M8KA 4WA7A 4FN5A 3Q3JB 1TKBA 3UK1A 2GWHA 3DR3A 1OYWA 3VR6D 3DUWA 4KUGA 4O4LB 2GN4A 1GTRA 1I6MA 2DBRA 3B8EA 2Q3LA 3MAGA 1YB1A 4FU0A 1G64A 4ZEXA 3LGXA 2PANA 5I8PA 4HEHA 3WK4A 1DO0A 1XTTA 3FDSA 2AUNA 2ONCA 2EFCB 2XV1A 2Q4EA 3GNSA 4JV1A 2K5UA 3KEOA 1ECPA 4E30A 4EHBA 1G5PA 3BA8A 1B33N 5BVHA 3Q6MA 3KJXA 4RTOA 4PPFA 4OX9B 2BKEA 1YQXA 4DXAA 2AEMA 2BHNA 2IFTA 2O23A 4POOA 3EDMA 5JY1A 2PS1A 4E21A 4NHOA 3KPJA 2F3UA 3EVZA 2Q1UA 3M1IA 4AZSA 4IQ4A 4RJ2A 3WQHA 3FWHA 5BR7A 2XE8A 3LULA 4INOA 2GK7A 5JT1A 1HC7A 1YIOA 3K0AA 1NLFA 1NTRA 3QVGB 1WIWA 2HIAA 3CN9A 4A23A 3HK2A 1KKLA 2W9BA 3WSVA 3EXEA 4M98A 4E5DA 3LKDA 3R5HA 4FEAA 4OGFA 2AHRA 1H5QA 5H70A 2DH5A 1YRWA 3O7MA 5A2QW 5FPOA 4YV1A 4LJYA 4UHEA 4FLFA 4OG2A 1J5EB 3DG9A 3O9MA 1RJGA 3QIAA 2ODPA 4LPSA 3AFHA 5DCYA 5G1OA 3X43A 5LPNA 2F3PA 4CMHA 3FVWA 3VM6A 5EUMA 1XZCA 4EYSA 4BNHA 5FWXA 1WEHA 4CT0A 3I3SR 2X3UA 2ABJA 1KDRA 1NVTA 3U4GA 1JDZA 3SU8A 1R7RA 3LFHA 1RLUA 4LF4H 5I9TA 4JXKA 4ZARA 1IK4A 5DHUA 3TINA 4DXHA 4E32A 5JCJD 1CE8B 2PMZE 2IYLD 2R66A 2FMAA 3FMAA 4TT8A 2XDYA 5EIFA 3AJDA 3RW9A 1YCHA 2FLKA 4DTIA 3LQFA 4KXUA 4CXMA 1DKNA 4F4JA 4LZLA 4ZCQA 5IWAB 3B78A 2UUAH 2ORVA 1SCQA 4HC4A 2JA8G 5DKFA 4RTSA 4I36A 4M7EA 2RGCA 3FJ1A 3D5EA 2J3DA 2VSFA 2CHVA 3N70A 3ZWXA 4QVIA 3B1JA 4I6GA 3NFRA 4N0MA 4PZ9A 2X1VA 3T9CA 1UWVA 2QUIA 4IGAA 3SC2A 3M6IA 3N74A 1DAEA 3OCVA 2GAFA 1VHQA 3B3FA 5ALOA 5JPDA 2D0PB 4AY5A 1SZDA 2JEOA 2WUWE 4RAQA 1IZ9A 4NR0A 3R3VA 4JJGA 3S44A 1C2TA 1HDZA 1QOZA 2NV2B 2FPIB 1CDDA 1L5HA 4G5HA 1H4SA 4RJJA 4L4XA 2Z8YM 2HA7A 1FDIA 3TQOA 2WWWA 3ZY4A 4F3CA 5CTJA 4YN3A 2BISA 4DDVA 4O7SA 1A9XA 1E4EB 2AN9A 5G0TA 2QP3A 5HBRB 5KYXB 2BOVA 3CLTC 4XRRA 4E15A 2GR9A 4X1IB 1MB4A 4ZKDA 3WLNA 4M9SA 2PKCA 3RS5A 1W6UA 4TKZA 2PH5A 2VPQA 1LFAA 1TVKB 1WB4A 1YR8A 2OWDA 4LZJA 4MI6A 5J1SB 2I7TA 4KLCA 2JLRA 2A9QA 1DNPA 1T15A 5K0LA 2E4VA 5EWLB 4ENQA 3HFRA 1V4NA 2YJTD 4V3CA 2QX6A 2P27A 5CAEA 4JSYA 1EAMA 4XSGA 2WABA 1WQ4A 1QMPA 1N33B 4JJZA 4RHXA 5M34A 2QYTA 1XGKA 2HWKA 2JNWA 4PXAA 3HBLA 1PWXA 3UH0A 4W8OA 4X7BA 1UM8A 1YU9A 1LC0A 1ZRMA 3IJPA 1K8RA 2PG3A 1A4XA 1AMOA 1KK1A 4JGGA 3ANSA 1NUSA 2H4JA 1JLRA 5DVZA 4U9IS 2DBQA 3T3HA 3QU2A 4ZI7B 5HQ3B 4U0JA 1Z5UA 3JYLA 2O3TA 1O6ZA 2R44A 2IY9A 4ND3A 1JALA 3JD3A 3RS4A 1YB2A 4GL2A 3I42A 5EJEA 3AF0A 4PZLA 1KOFA 2V7WA 3LHDA 2IYNA 2X1LA 4CV3A 3KJNA 3DOEA 3U7EB 2X5NA 5L53A 1YZGA 1N9ZA 1ZCAA 3V33A 3B1FA 2QPTA 1YMQA 3F4LA 3RK1A 3U40A 4OFZA 2WPNA 1T8WA 1S03G 4QLAA 1YBMA 3TLGA 1NL3A 2I1WA 3UJPA 3FWYA 1VKRA 1VZ2A 2C84A 3TAXA 3LY5A 4XDHA 1C7ZA 3VGJA 4H7DA 4K7JA 5KINB 1M33A 1SUBA 4TRRA 1WXEA 2ZLBA 2R0QC 3TXYA 1TJYA 1EA7A 3TQSA 1SM4A 5HFJA 3EGXB 4MJ7A 5D00A 4JXUA 2A1UB 4KCGA 4MUBA 4BN0A 2OGWA 2YKGA 5CIYA 2I3ZA 4TTAA 2D6FA 2AIRA 2NXCA 1GNVA 5IT9A 1SCIA 2OWOA 1U9JA 4AB1A 4XQGA 1UDBA 3ERCA 4NCJA 1GYQA 2M6LA 2BMFA 1L7EA 4EW1A 2MYPA 1YQWA 3FMVA 1DKLA 4KG7A 4P7BA 2QUBA 3NW9A 2YCLA 2Q29A 2X1MA 4A2BA 1YSCA 1N78A 5CA0F 1EINA 2B82A 3OQIA 4IXNA 1W5AA 3I5AA 1KMHA 5SICE 1QFXA 1LXCA 4XIGS 1C7IA 4LNUA 2VF7A 1D3AA 3IV9A 3RIEA 2C94A 4YCLA 4TM5A 3HVUA 3HYTA 2I2BA 3D7SA 1NY6A 3I83A 3WIDA 2G9RA 3HKZA 2ZW9A 1K4YA 4YAJA 1U65A 2ASJA 1HH4A 1E6UA 2ZJBA 4BNXA 3VVCA 4ENPA 1E7QA 4JI2B 4UTPA 1CHNA 4XJSA 5I7WA 1FU8A 4U6QA 2KJQA 3JQ7A 1PNOA 4KAXA 3OFKA 3VI3B 2NU8B 3LUFA 4PGFA 4L50A 2J32A 2R4UA 4QUJA 2NLOA 1HMPA 1RPTA 5HOQA 5C4GB 1Z0JA 4X8HA 3I9MA 2OVBA 1RM3A 1SKYE 5D1NA 5FNVB 4K1LA 3DBIA 3PR4A 5GV8A 2QU8A 3IMCA 4BXOA 2X9NA 3S2EA 4II2A 2OCIA 3IUEA 1DDOA 3LECA 4LJ9A 4FWTA 3RH0A 4HGNA 3UW3A 2R93G 2AFRA 3A1TA 3WWEA 5BSUA 3DHWC 4LAFA 6LDHA 1YJCA 2W7TA 2IU0A 4BKUA 4O3OA 3FNGA 3MB5A 3V8RA 4HAVA 3RRYA 2I6GA 2XXBA 4P93A 3ZLUA 1EGQA 3S2SA 3RIMA 2D5IA 5DBFA 1UQRA 1OWNA 4RGBA 4YASA 2VZEA 3D9QX 3DVSX 3W8FA 2HGWA 4R8UA 5ITZA 4E5VA 3DDZX 1UPBA 4B0OA 2DUUA 2H1WA 1YJAA 2HIMA 3E9MA 4IY1A 1WXGA 3HLTA 4IJWA 1P62B 2VQEB 4YUAA 5CM9C 4BMSA 2XTZA 2P2LA 3RUCA 4DSUA 4HQFA 3M1AA 1XCOA 1VGVA 1WXFA 3TNLA 3TLXA 1HZZA 3REQB 3QOYA 2A0FA 4CJXA 4YPVA 3R3ZA 1WXWA 5K0ZA 1TEVA 3H5OA 2FZGA 4M8LA 1WSDA 5ILQA 3O75A 3P9KA 1PJSA 3HC7A 4X1OA 4FOOA 3LY7A 4ZOCA 3CNNA 4BQEA 2PYZA 3RE1A 3W2EA 1C1XA 2JGJA 1PK7A 1JMVA 2FRVA 2BW0A 3ZLTA 2ECFA 5CA1F 2A8YA 5F7OA 1PJQA 2WFLB 1X8XA 4MYTA 3DLIA 2HT6A 4LTNA 4KXLA 3IPCA 3ORSA 4IFBA 3EJ6A 4O7NA 1JB1A 5AOAA 5EKSA 3T3EA 5BV0A 2B9VA 3OQOA 4ZO9A 4YV2A 1GZ5A 2V4RA 2HQ1A 2X0JA 5ERYA 2VK1A 4KYIB 4WI1A 2WNSA 4E6EA 2CE7A 4J0KA 1FNCA 3WAKA 4FI3C 4UKDA 1RPZA 5JYEA 4H6VA 3DV0B 4WQMA 5IF3A 4YJGA 4QGBA 2Q3MA 3U7RA 3KYHC 4EAAA 5FTJA 2B1IA 3F98A 5BYJA 3SX2A 2EX0A 1HF3A 4AJIA 4JY7A 2P4UA 1D2HA 4D9KA 4IOJA 2A9VA 2QPAA 4J0CA 3F2IA 1JHAA 4I1UA 2VNKA 3CXUA 1TZCA 3CVJA 3L7CA 1NASA 3RC9A 3EISA 2GLTA 4M1OA 1I01A 4YRZA 3RARA 1C5KA 5JXHA 3ANTA 4YR3A 4AS3A 3A3PA 2SNIE 4F7WA 3B9RA 3X1DA 1C30A 2L82A 4BY7G 4LXUA 3B3GA 3R9IA 2BTQA 5K0NA 1MQSA 3TF5A 1YL6A 3H5WA 2F1JA 4J1TC 3V6KA 1BHQ1 1YDMA 4BO6A 2GFIA 1ZMBA 3RB6A 3ETGA 4C08A 1HNXH 4TV8B 1Z62A 1ICIA 4O4JF 3T5TA 5FBLB 4I5FA 1EM8B 1G5TA 3FGNA 3NJRA 3LT1A 3FSRA 3R5JA 4JB8A 1E3DA 4IF6A 2UYCA 1F0PA 4BB0A 1U8ZA 5A4IS 4Q7QA 4OQZA 2F8LA 5EI5A 5JJ5A 2CW7A 3OFVA 5K8LA 5CRIA 1YQUA 1X87A 4JLNA 1FQWA 1MFZA 1W88A 4CM8A 1CUEA 2BEWB 4DR2B 3ZHQA 3C16C 3ZW9A 1PSWA 4TTIA 3ZCTA 4D6YA 3JQRA 3FM9A 1I50A 1H6CA 2Z08A 4CIAA 2PH7A 1EWTA 2D4AA 1WZEA 2WSIA 3AF2A 4L7VA 5JD3A 4P5PA 2GTHA 2BSQA 4UFOA 2C3PA 1SCJA 2Y68A 4S2UA 3COVA 3L4EA 3RDPA 1E96A 1ZD3A 3MQ4A 5FB3A 1UOEA 5FOTA 4MLCA 2A67A 2LKDA 3EGIA 1B2LA 5J9FA 4FZVA 1JSZA 2ETXA 3LCUA 3TMYA 3IUYA 4KN5A 3TNDA 3G1WA 3G0OA 2A88A 1RZUA 3RUIA 4J2TA 2QAIA 4MXDA 2VWQA 3ZU3A 4QFMA 3ICWA 4YIKA 2Y0BA 3N8GA 1LDGA 3HP4A 3WDSA 4Z6KA 2BGRA 4OUDA 4YUXA 3LUDA 5EEGA 2HVQA 5G0SA 3MIIA 4FX5A 4ZAYA 3WGMA 1XQ1A 2YVQA 3ROXA 1DDGA 5HJ2A 4CM5A 5FCDA 5KNCD 2PLAA 1SBHA 3H1EA 2ZS7A 2ZJ5A 2BFFB 1D9XA 2MINB 4IDFA 2P9BA 4MS1A 2GBLC 3EVTA 4ZHSA 4LJ6A 5KDOA 4D7AA 1QG2A 3JYPA 3NC1C 5AVSA 1HTBA 1N9GA 4BIMA 1U7DA 4YC7A 3NEYA 3FFXA 3WLQA 4F2HA 3MJVA 1FRVA 4NZPA 1Y4ZA 5DW3A 3MWMA 1VL1A 1DAHA 1RZVA 3VVBA 3BH0A 2HBQA 2WSBA 3JQ9A 4BNLA 4EQZA 4F3NA 4JUZA 4PONA 3TRJA 5DNAA 4LSGA 3EF0A 3JX9A 2J6SA 1T4CA 1AB6A 5GZ6A 5IK2D 3ROPA 1DS6A 5EHXA 2PZBA 3NETA 2FQWA 3DE0X 4GLLA 3IMKA 3L77A 3UAOA 4URZR 1RAHA 3R7FA 5LBIA 3ILHA 4UEJA 4WDQA 2CD7A 3DE3X 1OC4A 1PJAA 1YR3A 4RZ3A 1VE6A 1VG8A 2J4FA 3AR5A 2I91A 4NV1A 5HBGA 2UVDA 2H51A 1GZ4A 1XMOH 4E13A 3CO5A 2NU7A 2J9ZB 4A1FA 3WLLA 2ZYDA 2COGA 4NJOA 4BQNA 1MMFB 3SPXA 3R7BA 1KHTA 4IQGA 1XQ9A 2PN1A 3HKDA 4B3MH 3IAHA 4C0LA 4ZOQI 1OFUA 3EIOA 2GZDA 2JIBA 1SC6A 5IDVA 5KKCA 5C1BA 2O06A 2QLLA 5HTKA 1VMKA 2FMXA 3T41A 1WW3A 1KA9H 3OWXA 3R76A 1JDSA 2OCKA 3B2QA 4V0ME 1OIXA 3ZV5A 4FHEA 3HKCB 1U94A 4QUBA 5DNDA 4L9WA 4G89A 4KWEA 5AUOB 3N6VA 2NU9A 3G79A 1ECLA 2P9EA 3CE9A 1U81A 1Z39A 3E0XA 1IBLB 4BZPA 3QTTA 4ZP1A 4G5RA 2H2DA 3WL6A 1RYDA 3BIFA 1Q12A 1JJVA 3G23A 3KWJA 3BQNB 1JDUA 4FYXA 4L9AA 3KB2A 4LH6A 5JROA 4YROA 2RGAA 5CB0A 3DTTA 4DVGA 5AUNB 1KVUA 4CCWA 1I0IA 2DHCA 1EVKA 3P45A 2CJFA 3GFRA 2AC2A 1N3BA 3PVXA 3OZUA 4MB2A 2JW5A 3W5JA 2VL7A 3PLRA 3GH3A 3NKLA 3NYRA 3EEIA 2C2XA 3AKEA 1SXJA 4NBUA 1ZK3A 2IL1A 1S9FA 1LJUA 2REQA 3CLSC 3X1JA 4KRGA 4MRMB 4B34A 5EWMB 2V45A 5J5VA 4F45A 2EKDA 3WOVA 3SSNA 2O5EA 3STYA 3S6JA 1QRRA 2C59A 4GE0A 1ZMOA 4XGKA 2RBEA 2Y0PA 3ILVA 3C3DA 1R8JA 1Q50A 1H94A 2A4MA 2F3RA 5CA0B 7REQA 1A0GA 4XVCA 2WG2A 3UMYA 3MBIA 3PEWA 4FM9A 3LIPA 4CKWB 5ALDA 1K75A 3MWFA 3ROGA 1FSZA 1GL9B 2F17A 5FUBA 3K0HA 3WX0A 1C7JA 3KZNA 1IY1A 5DLQC 4GX5A 3PNPA 3OTHA 1I1KA 4JFRA 4JFAA 1J56A 3RI3A 3RBAA 3KSZO 1XXLA 1EX9A 4QRIA 5EJ4A 4QYMA 3ABIA 4E6NA 4QGAA 5LIPA 3CVXA 1X9GA 2HWYA 3KZVA 1AMNA 1V9LA 4AZ0B 2QVGA 2YWVA 2OHVA 4URVR 5IUNC 1RR6A 1W48A 4ER3A 1E9VA 4J9PA 1BOOA 1GKLA 3A58B 1I94H 3WXMA 4GPBA 1T8PA 5ALYA 3HRIA 5HRUA 3K0FB 5JFOA 4QRHA 4FYJA 3AI1A 1BCRA 3IR5A 3ZV6A 2PX6A 3N2LA 1PQUA 2NVOA 1K5GA 4MWDA 4GI7A 3B48A 3NV9A 4CLOB 3OFSA 4I9HA 3JYNA 3AZPA 5IM4F 2QIOA 4U2GA 3A10A 5CW1A 5F9MA 2CFIA 4BWSC 2EG5A 1AJEA 2ES4A 3FCCA 3SI8A 1J2YA 1Z8FA 2VK2A 2PBLA 1UK9A 5H8WA 5J3JA 3BD9A 4PG5A 3TD6A 4O5OA 3TOCA 2HCJB 3CUWA 1PFKA 4PFJA 2R7ZG 3INRA 4TWBA 5AOVA 1I3CA 2HLDD 3AF3A 1M8FA 3E5NA 4N7MA 4RCVA 1P75A 1YA6A 5J2UF 1Z13A 3TXAA 1ZRHA 4HFRA 1QU2A 3ZCQA 4HCJA 3RB4A 1CKNB 2Q7DA 1OXTA 2OKCA 2ID9A 3E70C 1C41A 3IR7A 4DNXA 2QROA 3HRHA 4KMSA 4W5WA 2HK9A 4O4HF 4RETA 4Q6BA 3V9PA 5A5GA 3FKSA 3QW2A 1Y33E 4LN1A 1UKCA 4JU8A 4WXYB 3E7DA 1RTTA 4OI2A 1DJQA 1Z4JA 2OH2A 2GBGA 3JZIA 1B3RA 2HDOA 5IMSA 4NKRA 4NOKA 4RO0A 1K8QA 4X8MA 3U9TA 3PQ7A 3LYUA 3FKQA 4PVCA 2ZRDA 3T9AA 3EZ7A 2ILVA 3B3AA 5KHLB 3ZE7A 2CB0A 1M9NA 2GJAA 3P9ZA 4W7SA 2ODAA 5JDIC 3NI2A 4MW5A 4WY2A 3H9GA 4DRYA 1CQJA 3GLHB 4TVKA 3CVYA 1IEXA 1DC3A 2KM1A 5JNSA 1DZ3A 2FZ4A 4A93G 4I55F 5DWQA 2XA1A 2X0DA 1II8B 2YMQA 3ZHZA 5CA1B 4HBGA 2VF8A 2FWJA 3FHCB 3IULA 1Z38A 3USES 2QF7A 2CXOA 2NZUG 4F04A 5I9BA 1NMZA 2ATVA 1V1JA 2WKRA 3UA3A 2EQ5A 4QOHA 4IKPA 4LFBB 1M1NA 1ULAA 2GJ8A 1N2IA 4EI9A 1FFGA 2WF9A 1NONA 4RZRA 3DVAA 4BV2A 1G8HA 3GTMA 3H9QA 1KDVA 4WJKB 2PRYA 3WIOA 1E9AA 3ZU6A 1GPJA 5B1YA 3N39C 3AYXB 2YRFA 4BDSA 4OBEA 1ZKMA 3GLGB 4CMGA 1VRCA 1AKNA 2B4AA 2QVCA 3UHPA 4OLHA 1WHTA 5L4SA 3WYFA 4O4LF 1G8GA 1KZ1A 3PXGA 4EW2A 2YBDA 4XB1A 2CHQA 2CVHA 3AHGA 2J0EA 4B0PA 1GU0A 3VU3A 4GKAA 2QTAA 1CBUA 2EL9A 5ALJA 4NXNH 5B3AA 1FUIA 3N42B 4RFLA 5AI8A 3WL8A 4FNGA 1U28C 1G3MA 3SQLA 4OLJA 4D98A 2DHDA 1G8JA 3P1JA 1U7OA 2HNKA 3NO4A 1YR7A 2NZYA 4A1OA 3I9V6 4DABA 5CITA 3R9KA 4Y2JA 1AD2A 1RMQA 4PSAA 4PBCA 3I9OA 4P84A 5ALPA 3HA2A 3BVPA 1M8JA 3L05A 4O4JB 4ND8B 2QZJA 1U7PA 1P0MA 2E3JA 3KBOA 2RHHA 4OXNA 4D8TA 1CUJA 1LDYA 2AZTA 5DK4A 1X8LA 3SYKA 4LUCA 3D81A 3PJDA 2BP7B 2C03A 5THKA 5BRNA 1ZM4A 3D7RA 2GPSA 4U7JA 3B51X 2J3MA 4RB0A 5C46F 3LLCA 3X1MA 3V2HA 4FGRA 4R01A 2O6LA 1E60A 3EF1A 1B0ZA 1RYZA 5DHTA 1KNQA 1YB7A 3M4ZA 3IELA 5KI6A 4KR7A 3E9NA 2OV2A 2XLCA 3L3BA 3AHCA 3W5OA 2EYUA 1QAMA 2R96A 1VE7A 2ZJ4A 4HDQB 3IQDB 2Z58A 3C8UA 2N1MA 5K01A 4TQSA 3SZ3A 1EK0A 3GTPA 4KGXA 4CODB 4MYRA 4RESA 3P27A 1DMSA 4QTTB 3TRDA 2EKPA 3LLMA 2B83A 4B43A 3HI4A 3PXDA 4O7ZA 3ZGZA 1X1CA 3R5FA 2B63G 2AJCA 2AX4A 1AMUA 4EO7A 3IKLA 3T4EA 3EPGA 4O4IA 4MRVA 1WPQA 1YQTA 1YQQA 4G5XA 1R2QA 3NQ41 2YHIB 1F6BA 1VBNA 3I6QA 4B3DA 3MRTA 3CNOA 4EJMA 4ZHQF 2CDBA 2CNKA 3NHPA 3ENWA 5KT6A 2O52A 2R4QA 2LIVA 4PV7A 4DVJA 1AKMA 4G5YA 1T25A 5A9TA 1JFLA 2BH2A 4XZ3A 1TMGE 2GPTA 4W1RA 2PAFA 4C3ZA 4JKYA 4DIUA 4KSBA 2V74B 3EMDA 3VR0A 3M4IA 4AYBE 2YFKA 4ZGWA 2W6OA 4RVUA 5B30A 1T4DA 3COZA 4YCBA 2D1FA 2QUJA 2O6HA 3UJ7A 4AW9A 1CHDA 3HCEA 2XYRA 4PO8A 2DAAA 5J58A 4GKJB 1E2UA 3SP1A 1Y7IA 4ZKEA 5K0TA 1D2EA 2BELA 4IG9A 3Q9UA 3ZK7A 4FLMA 2K4MA 3GEHA 3K0CC 4JXZA 2D13A 3LF1A 2RKBA 2ORED 3H17A 3WLHA 2PCLA 4DJTA 2FWMX 1C0EA 2I3DA 3UTDA 1IXKA 1U5AA 1E2QA 1EVLA 5G41A 3RB3A 1YF3A 5JAMA 4JNKA 4DMGA 2XMGA 4RVNA 4CL0A 1GSAA 2XNSA 4UCSA 1GVNB 1F6DA 2AXNA 2PY6A 1E1DA 3JSNA 2XDQB 1LF5A 4ZEWA 3JZFA 4FFVA 4NC9A 2BGWA 4O1HA 2O8CB 1XA3A 1MB0A 1M2JA 2J87A 2QYSA 2CHUA 5JD5A 5FR9A 3HOYG 2EGHA 4K8OA 1JEDA 1E3MA 1XNRB 2V1XA 4IYJA 4AMYA 4FCWA 1L7NA 4PZ6A 1P7ZA 5JZOA 2Y92A 4JKIA 1DJMA 5LUBA 1CJSA 2ZYWX 3DE5X 2ST1A 4MINA 5F78A 1NBMA 4N54A 3QYJA 4RV4A 2BEVB 2HOQA 5DN6A 4X65H 3D6FA 3COWA 1SZCA 3DEZA 3OPYA 1T43A 4B76A 3R7AA 3KDAA 1QHNA 3T9EA 4IHJF 5FADA 4GZ3A 5JRZA 5B3KA 2ZULA 1GA1A 2EVWX 3LC2O 4LGCA 4TS1A 3CUVA 1ZDMA 2PSFA 5I7HA 3RTCA 1ZN9A 4BKPA 4LCJA 4MQ6A 5E9JA 4HKTA 2D0OB 2JHFA 4LISA 1A4IA 1U2QA 1R0BA 5FPYA 1JQ5A 3W2HA 5CB4F 2XAAA 1I2BA 3N3AC 1A1SA 2ZBGA 4Y1EA 4Q8EA 1ZCJA 3L7YA 3WBKA 4C2UA 2PDAA 1RTKA 1GGEA 3KXDA 2NUAB 4I6JA 1GZUA 2EHDA 3NIGB 4YRDA 3OBIA 4MCHA 3SNOA 1G1AA 3DBRA 4DBVO 2QBYA 2O2JA 2CKMA 2FKAA 1MT0A 3AQIA 3N59A 4X1YA 3ICQB 2PFSA 3DTYA 1MKYA 1KH2A 3W6PA 2I33A 4ER6A 4Q18A 3FPCA 3K4PA 4B3RB 2HQSA 2WF7A 2GEJA 1RRFA 1QGDA 4K6CA 2GASA 3C6XA 2BI7A 3M9MB 1T0HB 4TWAA 2G1AA 5BN3B 1UZUA 5TNXA 1QQ5A 3CLHA 3GTKA 2ONZA 4LJAA 3ORRA 3ETJA 1TW3A 1C8KA 3JAMW 2HPHA 1M2NA 4Q0YA 1XVLA 1IOZA 4MW0A 2AG5A 2W2PA 3CUYA 1T2DA 2LXNA 1SNYA 1BROA 5KJFA 1E2MA 3IB3A 5EQTA 3MA0A 3BKWA 1YTUA 2YRXA 3AM3A 1GKYA 1TYBE 5D3QA 3PW4A 5TS3A 2FK2A 3ISVA 3I0ZA 1M76A 3VZRA 4ODIA 1I4WA 3RJTA 2HCFA 3ZE1B 3H5LA 2VHJA 3MS4A 2J5KA 2ODBA 1T36A 2C8LA 1JEJA 4BCBA 4AWXA 2BGIA 1Q5PA 1XMSA 4KJZA 8OHMA 4PX5A 2ZTSA 2HQOA 3NHLA 3K73O 5J2UB 2V6IA 2YNMD 1KJZA 1SB8A 1N9KA 2HHHH 4UUPA 4JEHA 3W1BA 4CKEA 2W00A 2J9XB 4DDKA 3E2PA 2H5JA 1AXEA 1RCFA 4XA8A 1PL6A 2ZBDA 1IZ8A 1QHEA 4AULA 4O4HB 2BEUB 3KLPX 4ZJYA 1NXPA 4L6AA 3E35A 4IO0A 3N58A 4TT3A 2G8NA 4YR0A 2WFAA 3NBQA 3S1AA 3ONFA 2JIRA 2QNRA 4KTTE 1DL5A 3ELBA 1GU7A 4I5IA 3FBWA 3WKCA 3BWBA 4X6YA 2JFWA 3F8WA 3I45A 3MJ4A 1P2FA 2OGUA 2ZRNA 1YZKA 3EGOA 1MTZA 5AVRA 4YDSA 4EPTA 1ISSA 4IEIA 3I9FA 1XP5A 2R62A 4X20A 2NO9A 4RQBA 2EW1A 5KSYA 3I4FA 1IN7A 4DLAA 4H1WA 2JI7A 3GIIA 2OQVA 1SUAA 3USZA 4NP6A 2FLNA 1RLIA 2ZM6B 4NPHA 1MC4A 3RGWS 3KJFA 3GBVA 1SCDA 1WA5A 3VZBA 1L4HA 3AL3A 3UHFA 3KELA 5DSXA 1NX9A 4WXMA 4X64H 3HO8A 3UJDA 1HK7A 4HDMB 2H54A 5EPOA 4PRLA 1ZM3A 1VE9A 5ENVA 4JLWA 4RKYA 4A3LG 4WZAA 2ZKIA 1PZGA 2PS0A 3NRCA 3SJZA 3RC2A 5MDHA 4HXGA 1GN8A 3SM9A 7GPBA 3H16A 2RK4A 3GGJA 2O8DB 2IPXA 3K1YA 3NGLA 3OHSX 1J1ZA 2B2NA 2GJ9A 3GA0A 3SS8A 1JL3A 4M1MA 3TI9A 1K7EB 5AM0A 1Q0ZA 2FSVA 4HXYA 1ND6A 5ALIA 3INYA 1S2LA 5MF6A 5BQ5A 2CGEA 4Z4HA 3A11A 4MVWA 3B9BA 4PWQA 4OXIA 1HL3A 5DI9A 1DCKA 4E11A 2JGAA 2ZUFA 4QWBA 2FWNA 4JB3A 5JYBA 1GZVA 2HRQA 3H1GA 1Y1TA 2E5WA 3G5MA 3LOQA 1Q1EA 1RAAA 4CN8A 3MZ0A 5E7QA 3PITA 2PLWA 2XUAA 2C7OA 2PGDA 3GFFA 1E99A 2YFYA 2HA2A 4A3CG 2VTBA 2ISSD 3FZNA 3D4OA 2VPXA 3V8VA 2HK7A 4DV3B 5E7JA 3GXBA 2YWXA 5BNIA 5KG5A 3F9RA 1CUUA 5IVHA 1ZD5A 5JAUA 4KFSA 4MVJD 1QVAA 2BM9A 4XM2A 2QTWB 3WGKA 1XD9A 3G0CA 1CUGA 5E3HA 4ISBA 3WNVA 5JYCA 2ZJ2A 1VLHA 4V39A 4RK5A 4X44A 1NI4A 1RRVA 3FTFA 3NAMA 5LOVA 3SYLA 2BKVA 2IP4A 1UXHA 3PFWO 1MH9A 4EG3A 1UMBB 4PTLA 2E4YA 3ENKA 1M2HA 2JGEA 1O8BA 4LK3A 3UOWA 2HPZA 2VDWB 4AJ2A 2RH4A 4P3OA 5J4HA 1XKQA 3C14C 3QVXA 4V0LA 1T5HX 2XB6A 4GI2A 1NUUA 1ZD8A 2BM8A 1XDNA 3U3MA 5AVXA 4AKIA 2ERXA 4F3KA 5IH3A 3QNMA 2NPFA 4GM4A 2P2ZA 4QWMA 1JWLA 4Q66C 2QRUA 4K3UA 1IHOA 4TV8F 4RVDA 1D0SA 1YQDA 3MINA 1E66A 1FDRA 2GD1O 1XLTC 1K3UB 1OXBB 2VOJA 4RTMA 1P33A 4HVCA 5A6SB 1X39A 5BWOA 2QUHA 1Q0SA 2LCQA 5I48A 4Z4IA 3KQQA 3CONA 3RJ0A 4KQHA 5LWQA 4PLHA 3VR5H 1CJTC 3EX7C 4OAOA 3IX7A 2XIJA 5EIAA 2BUCA 1DINA 2ATEA 1R8QA 4YMSA 4RK0A 1XAJA 1DC7A 2QD5A 1BU5A 4QOIA 5BMOA 3ZI7A 4LDAA 1V4VA 4ZHQB 3KQOA 2CLHB 1W36B 1DFHA 3ZYZA 3ZH2A 2GZ1A 1ZM2A 5TGZA 4O7WA 3VJKA 1OOEA 2QRJA 5AW0A 3DVRX 3RBZA 2OTCA 2ZIGA 4N0PA 1B6GA 1AK2A 1ITZA 4NXMB 2BBSA 2C7QA 4KFUA 4RJIA 1F2VA 4MLZA 2Z83A 5F9HA 4W5NA 2A1IA 4HH0A 4QT0A 3DFIA 3ADDA 1TZMA 2XB9A 3W78A 1CWUA 5CT8A 4MWGA 3QOWA 2GN1A 4RTQA 1T9KA 5EAIA 2M98A 5EA2A 3I6BA 3T1NA 2O8FB 1SU6A 3BIXA 1K6EA 2B78A 4LGVA 1RRMA 3G88A 4MKXA 4N8EA 2YU9A 1GQQA 1CZNA 5IVKA 3E03A 2WD8A 3AXTA 3OUZA 5AWFC 2VSXA 3KO8A 3S68A 3L8CA 4YGXB 2IV7A 1LQ2A 5HILA 1RWKA 3KZMA 2DY0A 3L6UA 1BEUB 4HTAA 2WLTA 4Q47A 4YBZB 3D59A 3ONDA 4NH0A 4ZT4A 4PLPA 4R3UC 2J33A 3R3JA 4UTZA 3ZU4A 4ZCTA 3LQQA 3H8JA 5E6RA 3LHKA 2YASA 2WHPA 4P4SB 4PLGA 3O2JA 1TGVA 2PJZA 5KG4A 3ZVMA 2I2XB 3O21A 2P7HA 3SLGA 4QW9A 4R8MA 1I1OA 2A59A 3PKZA 3RYHA 4Y2XA 1L7AA 3DH0A 1DIGA 3TB4A 2OB2A 3EBLA 5LQRA 1Y5IA 3WJ2A 4PG6A 2JJQA 4ZQEA 4OFWA 5LXTF 4KQFA 3KHSA 1QGOA 4G1MB 2H92A 4YA6A 4K5QA 1YO6A 3LIIA 5EYPB 2EV9A 2MSKA 2IHKA 4R2MA 4M7RA 4TUYA 1MEEA 4YJ3A 1FP7A 2V8BA 4PWYA 1H2FA 5J4LA 3RFFA 2PL9A 4X61A 2RGUA 1QHHB 4HX2A 3K1AB 2WZQA 2Q9UA 3P4UA 1CVRA 1MPTA 3O4HA 1XI2A 3MMXA 5DGHA 4J1SA 2ARKA 3QEAZ 5AJHA 4WCDA 4M8IA 1LVGA 4MP6A 4BFYA 2UXDB 4D99A 4G0XA 4OHUA 4EZIA 3UJ8A 4IHJB 1BVHA 3ROTA 5IJAA 2CLCX 2ZZMA 4IM7A 3L4BA 1Y0BA 2QORA 3U7IA 5DI3B 4HDAA 2Y27A 5TT1A 4ABYA 5HCNA 3TFWA 3GF4A 3F7NA 1YRBA 1YR2A 2HBYA 3UAXA 4GBGA 1FMTA 3CSWA 3JATA 4W9RA 4MR7B 1CEXA 5CB4B 2BHRA 3DDOA 1DHRA 3JPYA 1I80A 4RNNA 1OKKD 2DM6A 2HRCA 3R5XA 1ZUNB 1D03A 1XR3A 1L4UA 1Q7EA 4YI3A 1MHPA 1QMGA 3QHPA 3FB4A 4TZ6A 5REQB 1HT0A 3FNHA 3G6XA 5B1HA 2A14A 1DADA 2YC4C 2JLVA 2B99A 3RVQA 3B52X 4NS4A 1G5HA 2UYGA 1RP7A 1D6SA 4RAOA 2KE5A 5KVQA 1ULTA 1G3IA 1RLOA 4RKWA 5WRFA 3AJ9A 3OY2A 4FONA 2J46A 4PTYA 3R8XA 1YCFA 5I4KA 1KC3A 4BMYA 4EUEA 4CBVA 4EB6B 1OLXB 1UKEA 1TMKA 5AD1A 4F3YA 4RIIA 4DAEA 4M55A 4WCFA 1H22A 4C3UA 1MC1A 2LBPA 3WYEA 1XA0A 4AUEA 4TMXA 3MW8A 5EZ6B 4RUKA 4CMKA 2JAPA 3NXSA 2YIDA 4WZBE 3G13A 4OQLA 3SHWA 5B6JA 3H5RA 5ALFA 2JGDB 3G2MA 1S8AA 1GR0A 3LM8A 3R9XB 4OA5A 3KEFA 4B4KA 2FSIA 3GAFA 1OB5A 4XR4A 4DFDA 1GAWA 4H1TA 2X0SA 4EYEA 1A8HA 2WG1A 4Z3DA 2QRVA 2R84A 2Z2IA 5LLSA 3ZTWA 4ZXPA 4M2LA 1EXDA 3FDJA 5FFMA 1O77A 3QLVA 5FR1A 4CQMB 5JO0A 1WVGA 1U2RA 2DR3A 3KKOA 4UBKA 1XF9A 3PDHA 1TADA 2NQ2C 2HIGA 2V59A 1L3BA 2BKAA 2PWPA 2F90A 3RIZA 1OY1A 1UOOA 2PFKA 4G0MA 3UMMA 5EDWA 2ZVDA 2G04A 3N2GA 1LQUA 2XA9A 3CEAA 2A3RA 1BE6A 3SQWA 2DPMA 1PUJA 3A25A 2HQBA 4HAZA 4JYAB 4BUCA 4BO7A 4IVQA 4FB4A 5B4TA 2J6IA 3B9PA 5K1ZA 1DKQA 3E8SA 1QTQA 3UB2A 2PX4A 3ELUA 4PR3A 1SUDA 4ZOLF 1GPH1 4OBBA 1U4OA 1S02A 1WMSA 2E18A 4JASB 3RSOA 3IKTA 1WDLA 2H9YA 1I3LA 3Q9LA 4ZVTA 1EYZA 4C6TB 1SCUB 4S35A 1PVDA 2HRRA 4YAFA 2HZBA 3WICA 1B1CA 2QMYA 3UATA 3M1YA 4LZZA 4A8JA 3T5KA 3CJTA 2EW2A 1TM5E 1MRZA 3EN0A 2JF0A 3W0LB 5DTEA 4W82A 2J3HA 2J0SA 3FDZB 4RVHA 1YXMA 3DXXA 5DJ5A 2R6GA 2WVHA 5E3IA 4ADSG 4UQPA 2C9YA 2WFZA 3DMGA 2CBZA 2Y1FA 3KRTA 2JIMA 2VHCA 2IEIA 3IAXA 4LMYA 2DERA 2ZRJA 2WTFA 4IRDA 3EVBA 3ON5A 4N18A 4CQNA 2P9JA 4QNNA 5HKKD 1VIMA 2K6GA 3SJUA 1BA2A 4C43A 5KTKA 2ZQZA 3PCTA 3DLHA 2WIBA 4H7PA 5BUZA 2GXUA 2FPGB 2P2GA 2JLYA 3AIMA 3HZOA 4CFYA 2RE8A 3PD0A 5FAKA 4GKVA 4DV1H 3BRWD 3U7QB 1H3FA 2XX3A 3BX1A 3GXOA 4BFWA 2C2DA 4ZT2A 3DBLA 1PT5A 3KQPA 4CC6A 4Q4AB 4RZXA 1TF5A 2VH1A 1L7OA 2OESA 3RSSA 2PKEA 4MCJA 4EY5A 4C04A 1HRKA 1U9IA 1QH9A 1NMQA 1ZJZA 2R8XA 3UMSA 1AZLA 4GLFA 4HNRA 4R4JA 3JYHA 3AIKA 3Q3EA 1PJTA 2IPLA 1OZFA 3EK2A 1IIBA 1M6NA 2P9GA 2EKZA 5KJ1A 2OE2A 2IYYA 4C07A 4FNAA 3RYCB 1T5LA 1U8CB 2ET6A 1BIFA 5B2FA 3VSCA 4JI6H 2JLBA 3CW8X 4JUDX 4BLVA 4YIHA 1PGJA 4R8VA 4UJ5A 4D6PA 1GL7A 4AFNA 4MS4A 3HNPA 1BE8A 1O95D 4HBZA 1SUFA 4YRMA 3DKRA 2XKKA 3QVTA 3CPEA 1IXYA 2B1RA 3TRKA 4A3JG 4OP2A 4QSMA 3IB6A 3OCXA 4QBGB 5DYIA 2WRZA 4BV8A 2EDAA 2I3AA 5KOJA 4P9NA 3CX7A 4IPTA 3LZDA 2ZT8A 3W7VA 2C8KA 2IYFA 3IUQA 1V8PA 4LDQA 2A78A 4MV4A 3A3YA 4Q9LA 3D3NA 1SJ9A 5AVOA 3SEAA 2Z02A 1P5RA 5IP5A 1AKVA 3O3NB 1NVFA 2AYYA 2I03A 4IL5A 1HEUA 1UMCB 3HJGA 3S5UA 4QJ3A 1KSFX 4DR7H 1SHTX 1FYEA 3LRTA 2P30A 1Z6GA 4ZTBA 4LF9H 1E6WA 1KYTA 2GBFA 1I7QB 2EOAA 2GZ2A 3ZUPA 5BPFA 3FFAA 2DVMA 3UJNA 4TXNA 3C5EA 3SXPA 1W8DA 2P3SA 3UICA 5GWXA 3H1PA 5BYAA 1JXLA 1CR6A 4QBTA 1FYWA 4BP9A 3WGVA 4RW0A 3PZPA 4E07A 4EX6A 3HB4X 1IIRA 5FUYA 3ET4A 4IH4A 1YZHA 3T5AA 1QYDA 1S0OA 1K66A 4OMFG 2D0DA 4DADA 3DYBA 2R1ZA 1FQOA 1KJ9A 1L1FA 4Q16A 1SVIA 1NVVQ 3H3JA 2ODNA 1GU1A 3IBCA 3QEKA 4L3VA 1W85B 3R8CA 1ILEA 3KHHA 4L75A 2CXNA 2JGRA 1VSQA 5K3OA 4U4AA 3WGGA 3BDIA 4RDHA 1BD3A 2NUTB 4I50F 3GLFB 2JL1A 4MEAA 5E2IA 4XI9A 4NCIA 2FGJA 4YUZA 5KJ6A 3R40A 3K05A 5KYTA 3FI9A 1UC9A 2OBMA 1OVGA 1OBGA 1MOZA 4L2IB 3UJHA 2C9MA 3GJ0A 4L76A 2ZXUA 4YRQA 2W0MA 1HDEA 4FW8A 3GP8A 3T06B 1QV9A 4A5OA 4C0SA 4KGZA 1GGNA 3LQ1A 1A5SB 4MVJP 3O8CA 5E0KB 2QDXA 3NKVA 1PSDA 5I45A 1IXZA 4URWR 3LA6A 3KLNA 3QPVA 4UVIA 2QRKA 3TFQA 3ZZNA 3IHWA 4OTZA 1E1RA 1IK6A 3RAGA 2VDUE 2IYVA 5L51A 1Y8CA 1R5JA 1JFVA 5LLDA 2O8BA 2QAGC 1XTVA 4LXYA 3KSRA 2HTEA 1D7AA 4ND4A 4GL4A 3VKVA 4BLPA 2Y3IA 4ABTA 2GO7A 3M6UA 1LU9A 1UC4B 2PT6A 2J31A 1NAIA 3G5LA 5B5SA 3U3KA 1UXKA 3PRYA 1EU1A 3R6GA 5PNTA