2PVSA

Structure of human pancreatic lipase related protein 2 mutant n336q
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
452
structure length
435
Chain Sequence
KEVCYGQLGCFSDEKPWAGTLQRPVKLLPWSPEDIDTRFLLYTNENPNNFQLITGTEPDTIEASNFQLDRKTRFIIHGFLDKAEDSWPSDMCKKMFEVEKVNCICVDWRHGSRAMYTQAVQNIRVVGAETAFLIQALSTQLGYSLEDVHVIGHSLGAHTAAEAGRRLGGRVGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGFGMSQKVGHLDFFPNGGKEMPGCKEGIGGFVSCNHLRSFEYYSSSVLNPDGFLGYPCASYDEFQESKCFPCPAEGCPKMGHYADQFKGKTSAVEQTFFLNTGESGQFTSWRYKVSVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNVGKIQKVKFLWNKNLSEPKLGASQITVQSGEDGTEYNFCSSDTVEENVLQSLYPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of human pancreatic lipase-related protein 2 with the lid in an open conformation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Pancreatic lipase-related protein 2
total genus 125
structure length 435
sequence length 452
chains with identical sequence B
ec nomenclature ec 3.1.1.26: Galactolipase.
pdb deposition date 2007-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00151 Lipase Lipase
A PF01477 PLAT PLAT/LH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.60.20 Mainly Beta Sandwich Lipoxygenase-1 PLAT/LH2 domain 2pvsA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pvsA01
3IBTA 5ALHA 3W04A 1BEEA 3G9XA 2CB9A 1QIFA 5SYMA 4EY8A 2PX6A 5K3CA 5E4JA 1RRLA 2YASA 1ETHA 1OILA 5FV4A 5ALIA 2D5LA 3C87A 1EXWA 2JGKA 3HACA 1GPLA 3ESBA 5ALPA 1ZIXA 2XUIA 2V96A 5A62A 1GGVA 4WY5A 4EY4A 3R3WA 1R3DA 3LP5A 5C81A 1XZIA 5IVKA 4KAFA 4EY6A 1G5FA 2PU7A 4KRXA 1TCCA 5JD5A 5K3DA 1XZBA 4C4ZA 5LZ7A 1WCYA 1GYGA 5D7BA 3WKAA 3TRDA 4FFVA 3PF9A 3DKKA 2ROQA 3DJYA 4QNNA 2Z8XA 4G8CA 1TQHA 2VAXA 1SCIA 4E14A 3AINA 4A5SA 1ACLA 3HSSA 2XQFA 3L1JA 2PPLA 3WL6A 1J06A 2XMBA 4X00A 3FYTA 3H17A 1UXOA 2BGRA 2O2HA 2JGJA 2HHAA 2HA4A 1DQYA 3VVLA 4QWWA 1X2BA 2WU4A 1IUPA 3PFCA 4Y2YA 1XZJA 3FNBA 1IVYA 3WKCA 4BP8A 1XLWA 1YSCA 1LGYA 4B81A 2XI4A 1EVQA 2EEPA 3R41A 3I2GA 4AN1A 2OAGA 4LHEA 4FMPA 1XQXA 3F98A 4KAJA 3D2CA 2YYSA 3P2MA 4P08A 4AO8A 4MEAA 4AQDA 1XZEA 1R88A 7YASA 3VISA 5JAOA 3STYA 4FFWA 3K6KA 2CKMA 4RGYA 1ACJA 3C8DA 2CMFA 2RGUA 3EBLA 3CCBA 1BROA 3HJUA 2Y6UA 3WZLA 3PUHA 4I19A 1G66A 2ECFA 2QJRA 3PICA 1GZ7A 4OB7A 3O4JA 4W63A 2XDWA 3C6XA 1D07A 3CN7A 3ZI7A 3BWXA 5CTAA 2WILA 1QFMA 3SX4A 3FCYA 3QYJA 4K6GA 4NREA 1MAAA 2G4LA 1Q84A 2WJ6A 5ESRA 4H7KA 5EHNA 1KU6A 3HYSA 5HZGA 1KHOA 3HC7A 1EH5A 1CUSA 2QOEA 1CUCA 1Q0ZA 4NMWA 1EB8A 4DYHA 3V1LA 1LNHA 1SC9A 1EHYA 4L72A 2G5TA 2QS9A 5IVIA 3IUNA 3ESAA 4BTVA 1I6WA 1QFSA 1QO7A 2XMSA 1ZD5A 4FDMA 5ISMA 1W6RA 4MWTA 1SCQA 1WOMA 3EQ7A 1ZOIA 1ORWA 5EIHA 2PU5A 4CG3A 1YS1X 3GUUA 2ZJ7A 5ALZA 1QIHA 4G4GA 1LPBB 1G42A 2JEZA 3KXPA 3ZLVA 2X8BA 2P0MA 4B0OA 1MTZA 1XROA 1VZ3A 5AIAA 2VTVA 2O7RA 1K5PA 3Q8WA 4LKOA 1CUEA 5ALGA 1TIBA 2ZVDA 1A8QA 3VJLA 3CWZB 2VJBA 5AO9A 1YCDA 3DYIA 3EF3A 4G1FA 2C5FA 5EFZA 2QVBA 4AX4A 3ESCA 2BFNA 1T2NA 3NWOA 4HXGA 1ODCA 4FWBA 4GI1A 5EHQA 3PFBA 4DNPA 4G8BA 4X94A 3STXA 3K2IA 5FPPA 2WFMA 5JATA 2QUBA 4Y2PA 4L0CA 4WY8A 3WJ1A 4BCDA 5ALUA 3L1IA 3WL5A 1DU4A 2PSFA 4FHZA 3AUKA 5K3BA 3EIOA 4FBLA 3HLKA 1E66A 4PNZA 5A6VA 1P0PA 4J0HA 5ALTA 4U2BA 2DCMA 5LZ2A 4P93A 3I6ZA 5CURA 2IX9A 2R11A 2HU5A 1UWCA 1CUWA 4ETWA 4QE3A 4RPCA 2WJ4A 3WK9A 3V48A 4XJVA 5ALOA 2H7XA 3W9BA 5KWIA 4UHBA 3D5EA 1DX6A 3MVEA 3PI6A 1QOZA 2WFLB 2OLEA 4X92A 2WIKA 4OU5A 1QIEA 4MYSA 3SC2A 3WK8A 1RP1A 3DCNA 5D3ZA 4L3WA 5HFAA 3DDUA 3GZJA 2HFJA 1MNAA 2VSQA 3G0GA 4TGLA 4N8EA 5HK9A 5EHZA 2HA5A 4HXEB 3R3YA 1JJBA 4M0MA 1FGMA 4W1PA 4BB0A 2BUBA 1RWQA 5HQ3A 5JYCA 3FG1A 4AMYA 2OCIA 1EK1A 4Q1VA 1XZGA 4BDTA 1N8QA 2Z8ZA 1QIIA 3TEJA 1MNQA 3STTA 4CG2A 4ZV9A 3RARA 2JGIA 5AM1A 3NOXA 5AM5A 2K2QB 4AZ3A 4EUSA 1RRHA 4MWSA 4DM7A 4ZRDA 2V9ZA 5CH5A 3H2KA 3H18A 4AO6A 2XQIA 4UBNA 3WWDA 1QONA 1IZ7A 4INZA 4YPVA 1TCBA 3A6ZA 3HZOA 3H2HA 3CXUA 3OURA 5AKIA 3DL4A 1CQZA 1XRQA 2I78A 5FLKA 4GEGA 1OXMA 4Y2TA 5A2GA 2FUKA 2WHPA 1QIGA 1W75A 1FGRA 3IVMA 4QDUA 4BDSA 4WJLA 3W06A 1DX4A 4Q3KA 1XZDA 3G9TA 1PFQA 3BNDA 3BNEA 2FNQA 2OGZA 1YA4A 5CT9A 1XQYA 3LS2A 4U2GA 5HF9A 4BYMA 5KREA 5E4TA 4BP9A 5AK4A 4BAUA 4NS4A 3WA7A 4U2FA 4DMKA 4WCVA 1CUXA 4OU4A 3KWFA 1WPRA 1CUDA 2WU3A 3W9UA 3K9BA 4HS9A 4K6HA 1J07A 1R9NA 3STWA 2LIPA 1WHTA 4FOLA 1YAJA 5FXMA 3VKFA 4B82A 2WG1A 4XWGA 5IVHA 5AKJA 3STVA 2AJLI 1KU0A 2Y6VA 4F60A 3BL8A 1E8MA 3S2ZA 4X3CA 4KE9A 4UFPA 1XRPA 3IULA 5JASA 4C4YA 5JAHA 2YH2A 4HTAA 4GW3A 4UHHA 1FFEA 4YK7A 3WA6A 3IDAA 2QUAA 4C89A 1QTIA 1K6EA 1EA5A 1XZHA 2DHEA 3C70A 1CIJA 3DD5A 1GPNA 3V1KA 1QE3A 3ANSA 3BJRA 5ALYA 3U1TA 1XZKA 5JIBA 5ALEA 4H7DA 4G5XA 5AKEA 1GT6A 4KR0A 1CRLA 3ICWA 3IUMA 1QJ4A 1CUZA 5DTIA 5ALFA 2HM7A 2ORYA 3RKSA 1AURA 1P0MA 4QDXA 4OYLA 4W1RA 3C6BA 3R0VA 1LOXA 3MUOA 3WK7A 2GBCA 1H2XA 5K3AA 5T4BA 3E0XA 4KEAA 2RHWA 1ODTC 3QH4A 4ARBA 2HA6A 4H7IA 3FSGD 2PM8A 1BCSA 2WSLA 5K3FA 4XVCA 3IB3A 1M33A 1ZI9A 4MJ3A 5T4HA 2OGSA 3V1NA 3OM8A 1H2YA 3DS8A 3BNBA 3RK4A 1TCAA 3ZPXA 1G4HA 5AKGA 3FLEA 4G9GA 1GQSA 2JBWA 3A2MA 2J4CA 4MYDA 2XMZA 3H2GA 1MJ5A 4JYPA 3AZOA 3ICVA 2ZSIA 1Y7HA 3IUQA 4JYMA 1E8DA 1W1IA 1XZAA 1R9MA 2W22A 2RHTA 2RI6A 3A2LA 4OCZA 1HBJA 1Y7IA 4J0JA 5DNVA 4ARAA 2WXUA 1ZJ5A 2B4KA 4FNGA 3WMRA 4S0XA 4XX1A 2CZQA 4DNOA 1JJIA 2O7VA 3H1BA 3ILSA 3V99A 4J7AA 2O2GA 4E11A 3C5VA 5K3EA 3T52A 4U2CA 3W2TA 3OPMA 4FLMA 4EB0A 2XMGA 5DTJA 2OCLA 2QRUA 2W6CX 4BBZA 4LYEA 4G4JA 1ZGBA 1TK3A 2OAEA 3ZLTA 4E46A 1ZD2P 1JMYA 4Y2JA 3TJMA 4H0CA 4E15A 2I03A 2PSDA 5HF8A 3I6MA 4Q34A 5DJ5A 1UZAA 2ACKA 3PUIA 2JEYA 1FFCA 4JNCA 2G5PA 2HU7A 2WIDA 2XMRA 4D9JA 3C8HA 2CJPA 1GKKA 2XQKA 4X6YA 3FG4A 3QBJA 2Z5GA 5DLPA 5KBYA 4X7BA 4AXBA 4CCYB 4OYYA 1QIJA 3BIWA 3N2ZB 2XLBA 3M81A 5E4YA 1O6FA 1DTEA 3F97A 3G0DA 2HDWA 5A7FA 4DTCA 2HA7A 5AI9A 1LPAB 1MPXA 3F67A 3IIIA 3G0IA 4Y9SA 2JIDA 3N0TA 2GYVA 1QGED 3GELA 4AMZA 4NZZA 5JZ9A 1VZ2A 4QDZA 2C0PA 3VXKA 3WYNA 1GQRA 5FOQA 4DNQA 4CI9A 3I2FA 5C7YA 2XB6A 5LKRA 4X97A 2VJDA 1ZJ4A 3QM1A 5AM0A 1VA5A 4LXHA 4EY7A 5CXUA 3MUNA 4Y2VA 2AJBA 3QMVA 2J4FA 4K6KA 1BU8A 3OC0A 1HPLA 3JYHA 4B6GA 1A8UA 3SK0A 2AJCA 4I3FA 3HEAA 4GXNA 3D2AA 5AKYA 3H19A 4B7ZA 4H7FA 1QLWA 3UUFA 1CUHA 2XT0A 1A7UA 2CUTA 4GWLA 4WHAA 1GPKA 2J3DA 3LIIA 3H2IA 2H1IA 2QTBA 4ZV7A 3G0CA 4KE6A 5AM4A 4B9EA 5EEOA 1BCRA 4GBGA 1J1IA 5DNUA 3HXKA 3E3AA 4O08A 2XUJA 3I2KA 2X5XA 2AXEA 2HRRA 2SBLA 4Y2QA 3C45A 2OCKA 5T4FA 2FJPA 4DIUA 1F0PA 1C7IA 2GZRA 4KE7A 2VATA 4FLFA 4G9EA 5LZ5A 1N1MA 1XLUA 5HK8A 1UK8A 1H23A 4GHWA 2QJWA 2DFPA 1U65A 3JW8A 4F5ZA 2EDCA 1W4LA 4B84A 2ES4A 1BN7A 4PO3X 3G9ZA 4IO0A 4BVJA 5J3JA 4B83A 1LPMA 1XQWA 1JJFA 5FUMA 1XFDA 4BAZA 1HKHA 3UMJA 1QO9A 4Y2XA 2GBIA 2WTMA 3I6YA 3I1YA 3EQ8A 1ZIYA 1DWPA 2V97A 3FVTA 3H0CA 1FGQA 1CVLA 1DT5A 2QT9A 1EINA 1MU0A 2ACEA 3WKEA 2WUFA 2VA9A 2XE4A 3G9UA 1YS2X 5JADA 2VJAA 2HADA 3FSGA 5EHXA 1UOQA 3U0VA 1H22A 1S8OA 4K5QA 4WFIA 2DR0A 4UBIA 4V2IA 4DMCA 2ZSHA 2XLCA 2HFKA 4HVTA 3WKBA 4QZVA 5AKZA 4QA9A 5CT6A 1ZICA 3R3XA 2X76A 4H77A 2B9VA 4QDTA 3SWWA 3WI7A 1E8NA 3KOOA 2GBFA 4QLOA 1JMKC 1SFRA 4Y2UA 3LIPA 4EHBA 3OTQA 1L7AA 1FFDA 3C6ZA 5AI5A 3W05A 4BC1A 2VF2A 2WY6A 1UKCA 1XRNA 4WFOA 1CFJA 1FFBA 2VEOA 5CT4A 2WXTA 5ALDA 5JARA 3O8YA 1EX9A 1UK6A 3YASA 2XUFA 1FGTA 1VXOA 3KSRA 1XRLA 3AIMA 3VDXA 2QMQA 5LP1A 3S8YA 1FFAA 1N8SA 3QITA 4Y2SA 3G8YA 4N5IX 5FKJA 4BE9A 5IH7A 2WUDA 2ZYSA 1DQZA 4X71A 1A88A 1CA1A 2ZYRA 5JALA 1NU8A 1XKLA 4FNMA 3L1HA 1XKTA 1FGOA 5F4ZA 4GLBA 3WZMA 5DNWA 4AB1A 1LBTA 2HA0A 4BVLA 3BDVA 2WFLA 2VQ6A 3FAKA 3WJ2A 1BRTA 4FBMA 1X70A 4KJXA 4LYDA 2P8SA 3FYUC 1CUIA 5DYTA 4BZWA 1EVEA 3D7RA 3WK4A 1WB6A 5FRDA 4JEIA 4AZ0A 2QKYA 2OXEA 2BUAA 4UBKA 3O95A 3KD2A 1DWOA 2QXTA 4X6UA 2QM0A 2XUQA 1IUOA 3A2NA 1T4MA 3FBWA 4IQ4A 5BWCA 1TKRA 2PUHA 4ZGBA 2B20A 4KYVA 1TRHA 1CLEA 1AUOA 5ALSA 2OGTA 4TPKA 5EI5A 1JNQA 3PE6A 3O9MA 1L7RA 4C6HA 1CQWA 2AJDA 4BCCA 5AI0A 3MGAA 4HAIA 5AM2A 3PZWA 5HKAA 1Y4KA 1YA8A 2WKWA 2HA2A 4BC0A 5JZBA 5A7HA 4J3JA 4C01A 5CRIA 5IKXA 3DNMA 3DEAA 4IH4A 1CUAA 5AKHA 3STUA 4K2AA 5HQ3B 2XUOA 2ONCA 3NUZA 4BRZA 3WKDA 1AQLA 1LPNA 1PJAA 4HZGA 1WB5A 2C4HA 4X85A 5ALMA 2I3DA 3B12A 1UOPA 3D59A 3GROA 5AKKA 4U2DA 2FX5A 2XUAA 3DKRA 4TVKA 2IUJA 1R50A 3T4UA 2Y2VA 3I1IA 3O0DA 3B3QA 3WL8A 1YASA 2BUCA 3FLBA 1LNSA 4UFOA 2IITA 2QZPA 1P0IA 4AN0A 4W9RA 3I2JA 5FDFA 3FVRA 2BGNA 3AJAA 2ZYIA 1ZI8A 2HL6A 2Y1KA 5ALJA 1THGA 3ED1A 3QPCA 1E89A 2HU8A 1FSSA 3E1GA 2JGFA 2H7YA 1W76A 4X90A 1ODSA 1ISPA 3GA7A 1GKLA 5AIBA 4PF1A 4L9AA 3FWHA 1JU3A 3QMWA 4OB6A 3LCRA 1BS9A 2GZSA 2H9YA 5AM3A 3E4DA 3O4IA 5HFNA 1LPSA 4ROTA 3DLTA 3IURA 4X93A 2XUPA 1DT3A 4YASA 2PSHA 5CT5A 1LLFA 2QR5A 2WG0A 3GBSA 3RM3A 1ZD4A 4M0EA 4QWMA 2WHRA 4WDRA 3WQHA 4I4CA 5LKAA 3M83A 1HLGA 2HA3A 1JFRA 5HF6A 5A7GA 1RYYA 4Y7DA 2VJCA 4EZIA 3AIOA 2Z3ZA 4OD0A 3I2IA 2WHQA 4UBOA 2DSNA 4F21A 4X6XA 2AJ8A 1LZKA 3H04A 4B9AA 4AO7A 3QVMA 4ZWNA 4DMFA 4KAAA 3ZV7A 4QDOA 4JUIA 2JGLA 5DYYA 3M82A 4EBBA 1YB7A 4KRYA 5CW2A 1EDEA 1JT2A 3DYVA 3ESDA 2BAGA 4MQMA 4H18A 1HU9A 1B6GA 4BCBA 3H1AA 1CPYA 4PSDA 5ALKA 2VT6A 1HDEA 5SYNA 3VF1A 3WIOA 2DQYA 3V92A 2WLSA 1VJ5A 1CUUA 5LZ8A 1VLQA 3GFFA 3HRHA 5I8PA 5DYWA 1WPXA 3G7NA 2RIPA 1AGYA 3C5WP 4DSAA 2WHPB 4CCYA 4MQLA 2RONA 1EI9A 4W1QA 2QXUA 1CUFA 3QPDA 3WK6A 4J0KA 5JANA 2V98A 4DMHA 1HQDA 5IVDA 3BXPA 3FYUA 2UZ0A 2PSEA 5H3HA 1UK9A 2OG1A 5AKLA 3FLAA 4CFSA 1P0QA 3KDAA 1OLPA 2XMCA 3O4GA 4KACA 1XZLA 2H7CA 1IK3A 5CH3A 1BN6A 5JAUA 1ZGCA 1AKNA 4UBJA 4HRXA 3JWEA 4NVRA 2WFZA 1AX9A 1NX9A 4H35A 4ZXFA 1K8QA 4IHAA 3AZPA 5JZSA 1GXSA 3IUJA 1XZMA 1VA4A 2WIJA 2EDAA 5E2IA 3HI4A 1UKAA 4A16A 5A71A 4J03A 2IUKA 4HXFB 3A70A 1AZWA 1SCKA 3D2BA 5EGNA 5HKBA 3LLCA 4BE4A 3OG9A 4HRYA 4OUKX 4B0PA 1JKMA 4UBLA 1QIMA 2CEKA 4YX9A 3CN9A 4QWTA 1UK7A 5ALWA 5T4EA 1BE0A 3I28A 5HF5A 3ANTA 3VJKA 3X3HA 1H2WA 2GBGA 5AHXA 2NW6A 1CEXA 2WIFA 2XMDA 2PBLA 5ALNA 2Y2UA 4GECA 4OPMA 4UHCA 3M3DA 3BJMA 1Y37A 4C4XA 4UBMA 1EB9A 1MX1A 1XLVA 1MO2A 3VJMA 3TGLA 2BJHA 4CIAA 2C58A 4EA6A 1LPOA 4PQEA 4A23A 4C87A 5AOBA 3EQ9A 5CXXA 2Q0XA 1QTRA 2OQVA 2J3QA 4Q05A 3UUEA 2IIVA 1H2ZA 4F0JA 5LZ9A 1LBSA 3DOIA 1XZCA 1WM1A 4PSUA 1YR2A 1W52X 1NO3A 5JD4A 2VAVA 1YAHA 1MAHA 4CG1A 3G02A 4MEBA 3D0KA 4ITVA 3B5EA 2JGMA 1F6WA 5AK3A 3AILA 1VKHA 1XQVA 1CUYA 1F0NA 4J0CA 4UFNA 4P9NA 2XUHA 2PVSA 1C4XA 5BWBA 1PV1A 3R3UA 5FP0A 4CCWA 1IUNA 1F8UA 1F8NA 2GYUA 1N5RA 2XUGA 5LIPA 5LZ4A 1NU6A 2R8BA 1OCEA 1A8SA 3WIBA 5AK6A 2HRQA 1ZD3A 5CH8A 3WWPA 4B85A 5K3FB 4LXIA 2WQZA 1QZ3A 3NGMA 3BDIA 2O2IA 1DWQA 1QIDA 1UKBA 1J2EA 3FG3A 4J0IA 1LZLA 5I9IA 4JH0A 1Q83A 3I2HA 2OQIA 1VOTA 3WWEA 3VVMA 1CV2A 2WG2A 4RE6A 4DGQA 1VE7A 1UT6A 1FJ2A 4N8DA 4PV7A 1CUJA 1XZFA 2ZJFA 5ALVA 3G0BA 3PDCA 1THTA 4DSZA 2OCGA 3D4LA 1WHSA 1USWA 5AOCA 1WB4A 4N5HX 5AK5A 2WUEA 2DHDA 3WYDA 4LIPD 5DWDA 5HCUA 4X91A 4QEKA 1JU4A 1CUGA 3QMMA 4ZI5A 2XQGA 3ZLUA 6YASA 2WM2A 3Q0TA 1U4NA 5JAPA 5AICA 3FCXA 3R3ZA 3V98A 2YXPX 3R40A 4UHDA 4BATA 1ROVA 1Q0RA 1Z68A 1UFOA 4UHEA 3FOBA 1SOMA 4IH9A 3ZWQA 5C8XA 1E5TA 4UHFA 1B41A 4DLNA 4X95A 1HL7A 1E3QA 3DL7A 4RE5A 3CCCA 2DHCA 4BVKA 4QLAA 3RLIA 5D6OA 3QZUA 2JF0A 1QMDA 5AI6A 2ZJ6A 2ZYHA 5BOVA 4WDQA 3F8SA 4J0GA 3C6YA 5EIEA 2C0QA 4GDMA 5LYYA 2JGEA 1YGEA 3WL7A 4P92A 4DNFA 3H2JA 4RNCA 2XUKA 1XRRA 5AH0A 2CBGA 3O9VA 4EY5A 4W1SA 4H7JA 4M0FA 3F9CA 2PUJA 1AC5A 1K4YA 5AP9A 1VXRA 5D3KA 1CUBA 1MX9A 3O4HA 4PSCA 1R1DA 4OSEA 1MN6A 2PKYX 3BF8A 5I7UA 4B80A 1K63A 4ZREA 1QM6A 5ALRA 3BE8A 3HABA 4Z49A 2Z3WA 5K5EA 1EK2A 3R3VA 3PF8A 3KWJA 4Q3LA 3DQZA 5AKXA 1UOOA 3F96A 4BRSA 1ORVA 3FYUB 1MT3A 3OOSA 2I3ZA 4MXDA 3WLAA 2XQJA 1X2EA 3BNCA 3V9AA 1CUVA 4H7EA 4OB8A 3DOHA 2GYWA 5BV7A 2DQZA 2HIHA 2WTNA 5ALQA 5EIAA 3AFIA 1LPPA 4C88A 2WJ3A 4IH1A 1ZI6A 1AMNA 1C7JA 1XRMA 1CR6A 2E3JA 2G63A 4G8DA 3BIXA 4Q82A 4FKBA 1VE6A 2WIGA 4LXGA 2PSJA 2FJ0A 1KEZA 2VT7A 4Y2RA 1O6GA 3WWOA 5CT8A 4U2EA 4BZZA 1IZ8A 4Q3OA 4UPDA 2BCEA 1BEZA 4J0DA 1YB6A 2BKLA 1IMJA 4KE8A 4N8SA 1U8EA 1QIKA 3WK5A 5AI4A 4H7HA 5ALXA 1JI3A 3BF7A 5FPQA 2XMQA 2C7BA 2B61A 5JD6A 2RAUA 3WWCA 3AIKA 1L7QA 3V1MA 2WUGA 5AOAA 4UUQA 5CBKA 4XIIA 5YASA 4WFJA 2XUDA 4FTWA 4BTLA 5AJHA 3IA2A 5KWJA 3C43A 4BAGA 4CIBA 5CMLA 1MX5A 3D3NA 1DINA 3AZQA 3QPAA 2PL5A 2OPHA 5LLSA 1TAHA 4G4IA 4WFKA 5C8ZA 1EDDA 1EDBA 1N5MA 2D0DA 1R4ZA 5ALLA 2C5GA 4PW0A 4FLEA 1U2EA 5AI8A 5C8VA
chains in the Genus database with same CATH superfamily
3IBTA 2OFWA 3P4UA 3N53A 2I1VB 2OG2A 2W6IA 4LECA 5DCYA 3W04A 2LW7A 3FF1A 3UMGA 3ZVMA 1BEEA 4OA5A 1J8YF 1KMNA 4UJ5A 3AP2A 1M2NA 2CB9A 5CM9C 3OX2A 5SYMA 3DBHB 3NT4A 4N7RA 4XWOA 3JQDA 1JRLA 4J4BA 5K3CA 2VHQA 3SE7A 1CNMA 1T9AA 1CVRA 1P1RA 4AJEA 1RRLA 1ETHA 3U4CA 1NF8A 1W5AA 2YIMA 1A82A 4ZVQA 3SZGA 4WECA 5EZ5A 5FV4A 4UOEA 3DE0X 4MLZA 3UYKA 2D5LA 4DIMA 3UENA 2JGKA 5CFRA 2I1WA 4ZZ2A 3PQ6A 3IJRA 1GPLA 1ZIXA 2QSUA 2EW2A 2ZCJA 1LDEA 1H2FA 4KWHA 1RBMA 4M1QA 1RRMA 1ETUA 1NFQA 2V7XA 3DWIA 4KQCA 3N2GA 2P9GA 1NYQA 1VL6A 5JBNA 1OH8A 2PA0A 3R3WA 3HDJA 1C9JA 5HILA 5BV1A 1XWIA 1AUVA 1H94A 1O96A 5C81A 1XMVA 3IKVA 4NWIA 4M3NA 2WOJA 3TKYA 2H4ZA 5DPMA 4MMZB 1Y4UA 1SU4A 4INOA 5K3DA 4C2UA 3ECCA 3QF4A 4UREA 1N77A 1IDN1 2YMPA 2PEYA 2PGAA 2WHXA 3BXXA 3JPWA 1CY1A 3GY0A 4XSGA 3TQCA 3WKAA 3PF9A 2BFOA 4Z4FA 4B6EA 1T1IA 3N2KA 2ICAA 4EAAA 3D1LA 1JEOA 1Y1TA 3PGXA 4UM5A 1GR0A 4Y0VA 4HNVA 5I6DA 5FLXA 4WK0B 4KPYA 3FDIA 1XTIA 1VM6A 1YD7A 3A3PA 1OZHA 1ACLA 1KO7A 1WW3A 2XA2A 2XQFA 3L1JA 4O02B 4X3OA 5FBKA 2PGJA 1D2CA 4ERNA 3CUEF 1ZBDA 3NVDA 5GY7A 1Q6YA 1WVGA 4X00A 2CXNA 2EBUA 2XB2A 5KOJB 1E77A 1WQ4A 3F4LA 2B7BA 3IOBA 4HH4A 5B1IA 1WW2A 3FYTA 2QN1A 1L5QA 3GXBA 3H17A 1ZYUA 4OHZA 4ZYUA 3VYUB 3D3KA 3MWLA 2Q45A 1N6OA 2XHHA 3PQ5A 4PNHA 5BRAA 1VP3A 2DYKA 3FROA 2JGJA 1KRWA 2HA4A 3SBOA 2ZBGA 3IAM1 4BKQA 2HUPA 3PQ8A 2F3SA 4KXXA 4R81A 3ER9A 2PANA 4R71A 2WU4A 1IUPA 4CM4A 2AUTA 2D2XA 4RNDB 5DWQA 5ESWA 4D0RA 4EWLA 1KMHB 2PEZA 3MMNA 1IVYA 1KAQA 3O83A 3FVWA 3ECAA 4RF2A 4V0SA 5FULA 4LJ8A 2CLSA 3UPDA 1VP9A 3FSRA 5JYEA 2ID7A 1YSCA 1FMJA 3W6ZA 3HDGA 1KL7A 3GRAA 3AEQA 2C4MA 2CLFB 1QRTA 1Q3KA 3S29A 5K0EA 1NULA 1V1RB 5DGCA 1MA0A 3B9RA 2OAGA 2Q3JA 1TW3A 3ABQB 1P7VA 3DOFA 4L16A 4Z54A 1SGWA 1XQXA 1MV5A 5FT9A 2HOQA 5SZHB 1S1CA 2YYSA 2XDAA 3MRXA 5AJWA 3E61A 4N0EA 3UT5B 2CGEA 4P32A 2F1HA 3EA0A 4FMBB 4BGUA 4J1TA 4P4NA 5LDHA 2X9VA 3OJEA 4ARZA 1SVMA 3GO4A 1XZEA 1ZMXA 5G4LA 4I4TB 1UJCA 3STYA 4C14A 4FFWA 1GZVA 2REOA 4OXQA 4Z3DA 5JXWA 1X9GA 4DFDA 2HMTA 4L07A 4AP9A 4OREX 4RGYA 1X1EA 3C8DA 2CMFA 2GAFA 3ABZA 3GJ8A 2FW0A 3EBLA 1WG8A 4GE0A 4WNCA 2Y6UA 5T6BA 3WZLA 2W93A 2ASVA 3I9KA 1U0GA 4BMPB 2UVPA 1GUAA 1Y3BE 1LX6A 4QGHA 5FBQB 3ZK8A 4KGZA 3EMBA 2X2FA 1CP3A 4RKWA 3F4BA 4KGXA 2HIAA 3PYMA 1TGYA 4OB7A 4W63A 1SXIA 2W4QA 1D07A 3NDBB 2ZZMA 1ORHA 4FU0A 1PO7A 1SCAA 2WILA 1QFMA 3H3XA 4KIGA 1E3SA 4DT1A 4WIAA 3M5CA 1P2VA 3CPEA 2Z56A 5TQ2B 2OZLA 4F3YA 3O8DA 1Y1LA 5E4FA 1NKSA 3GJ7A 3LZ6A 3PIDA 3AWDA 4TL6A 3CSUA 4JODA 5EHNA 4HUTA 1YDHA 2EZ8A 2HB6A 2H1CA 3W7AA 4BL5A 4LFAB 4CEJA 4D80A 3DDNA 3QK7A 5LP6C 3GJXC 2GJKA 3HC7A 4UDYX 2QOEA 3D4BA 4HDSA 3DPSA 3WQQA 2EFCB 4JLOA 4LHZA 4NMWA 4KVZA 1ULHA 3UWPA 2FN4A 2LKCA 4V1CB 1PDOA 3V8VA 5HRAA 3SM3A 5JHHB 1R0BA 1BKDR 3P2OA 4JZKA 1EB8A 5TMDA 2RGNA 3V1LA 5FBWB 1SC9A 5HOQA 3A8TA 1G3RA 2FPIB 2G5TA 2Z57A 2GXQA 4OBXA 3RYCB 1T3TA 1Y8QA 5DTRA 3NHRA 1JFSA 4TV9B 2BJVA 4BBPA 1UBNA 3NMUF 3FZNA 2PZJA 3RBVA 2Q2VA 1I6WA 3HN6A 1XMPA 4GRIA 4KQHA 4NPCA 1MQ8B 1KDYA 3SAJA 4ETIA 4PZDA 3RFTA 1JQ5A 3BGVA 3IXLA 1VIYA 5FR1A 4FDMA 2QYTA 4MWTA 5IUKC 1DC7A 5DRTA 1GRVA 3RC9A 3P0RA 4D6YA 3LTNC 1M67A 1TM4E 2V7GA 3EQ7A 1CZLA 1KETA 3CPHA 3LVFO 4Z53A 1IZ9A 1ORWA 2FY8A 1NZDA 2RKOA 4FKMA 1Q0LA 2WJAA 4GP7A 5EIHA 3LK6A 4E94A 2VDQB 1N2CA 4AKHA 1A4XA 1VG1A 2H1FA 3QWAA 2X2OA 3AVUA 4N0DA 4FT2A 3OT1A 3ZY6A 1EAYA 4FFLA 3FFTA 4KQ6A 3QIAA 3AHGA 3NDJA 3ZLVA 2C9CA 3NIBA 2AWOA 3OQHA 3H9JA 4JJAA 2CLIB 5GM1A 4UE2A 3AC0A 2X8BA 5CLGA 5IT9A 2EZUA 4Q3BA 1C0IA 1EUDA 5FOWA 1XROA 2GNAA 1G8GA 2ZJ2A 5LJIA 5AIAA 1UBFA 1HC7A 1IYZA 5DF1A 2IDKA 4LKOA 3RS4A 1HX7A 5JFGA 3Q1LA 1RJGA 3KKKA 4V0NA 4E2YA 5K03A 2H18A 4FCVA 2X6QA 4OLJA 2ZVDA 2FUG1 3ZW7A 4MPPA 5JNSA 1N6NA 3I34X 2IU3A 3L9WA 1I6MA 5HS6A 3NV9A 4M6WB 2VJBA 3LF2A 4QSHA 5DZSA 1LEHA 1MORA 4R68A 4O5AA 2YRFA 3ER8A 1OZFA 2W6OA 3KOZA 1O94C 5JRJA 4IUBS 1YH3A 1DKMA 2FFHA 3K0BA 5DHQA 5FPHA 2Z30A 4OQXA 4M22A 2C5FA 3CTMA 2LGJA 4LPSA 2ZT6A 1PR1A 5I7EA 3PNMA 1J8FA 3RODA 2WP0A 2CHFA 3PWKA 2O7SA 2FN7A 3M7IA 2V6JA 1OH7A 1QCDA 4QTZA 3MXTA 5FPSA 3NWOA 1ODCA 1UINA 2CN1A 5EHQA 1PJ3A 1VKZA 4NKRA 1AY0A 3NHKA 3PFBA 3DZKA 2QVZX 2PCJA 4XWYA 4DNPA 3RAEC 3THXA 3ADCA 3K2IA 3ZE8A 3FNQA 2WFMA 4JBGA 3VGPA 3C8UA 3H87A 1M6EX 3ICPA 4Z2AA 3DKPA 4B8YA 4K86A 4P86A 3PWTA 1JE1A 1WMDA 1HDOA 1NRJB 4HN2A 5DHUA 1P6QA 2QJFA 3BVPA 3LH5A 1KYZA 5TT0A 1JLHA 2WJGA 3EIQA 2MCFA 3EPLA 1USIA 4BJ1A 4F5WA 1QHGA 5PNTA 5CGZA 1KE2A 2H4WA 4EITA 5FFNA 3AUKA 2PRJA 5BR1A 1Y42X 1PU2A 3UICA 3TQFA 4F4IA 3AH8A 4H6WA 4LYYA 1CLUA 4ZYXA 1YFLA 3F5FA 4A0SA 4HI0E 4U7HA 4WOJA 4WUVA 3B2NA 3I4CA 4N65A 1SKBA 1Q1BA 4XPIB 2Q5OA 1E66A 4FI3C 2J9RA 3E23A 4PNZA 1P0PA 4UCWA 5A6VA 4Z0NA 3KPJA 4J0HA 3QLVC 3MBIA 4TTIA 2PO7A 4RMHA 3F1LA 2QX6A 1S6YA 2ADOA 1QHEA 4KH0A 5JJ5A 3W8RA 4I14A 4CYMA 1EM8B 2PUWA 3AM3A 2IX9A 1RMTA 2HU5A 3M6AA 2ZK7A 2XNKA 3BFVA 3KZXA 3B51X 2FWMX 3LSTA 2E0IA 1QE5A 4K26A 3KSMA 4QE3A 4XD7A 3IPLA 3QSGA 5FQNA 2PA3A 4IO1A 4Q4LA 3T9AA 5CB6A 4J8PA 3WGVA 4JYAB 4TTPA 3H5RA 3VSDA 5CFNA 5I9BA 4HDCA 4ZI2A 3KRTA 3RHZA 4A73A 3GLHB 3V48A 4RAOA 3ZHBA 2VPYA 1PTJC 4J91A 4DLRA 2ONZA 2JFNA 3RKUA 5ALOA 1Y4DE 2L0XA 4UEOA 5B3AA 1PBTA 1JR4A 2P69A 5BN4B 4C7XA 4Q4JA 2BWJA 5JS1A 1V7PC 4XDZA 4RIGA 2J48A 3HDYA 4B74A 1XYGA 1JAYA 1FU7A 1U80A 2AQHA 4BVFA 2OKGA 3EH1A 5I9SA 5ADHA 3TUIC 1C9MA 2GWRA 4FN4A 4X92A 2UAGA 3WWZA 1CDZA 2WIKA 3IT3A 1J2JA 1GOTA 1TKAA 4KN5A 1L5MA 4EHNA 1CERA 2ODNA 1CETA 1ZC3A 2FPUA 3BGDA 3SEAA 3UK7A 4EPYA 3HWRA 4GWGA 4RSGA 3DDUA 4DLBA 2VPWA 1V4NA 4JQSA 1YMVA 3EXEB 3RV3A 3DB1A 4UE3S 3F74A 2Y1LA 3HM9A 2WD7B 1EWQA 2DFLA 2C8LA 3G5MA 3Q3CA 1YZYA 1UP4A 2VTEA 3HZRA 3WIVA 3KVYA 1INLA 3DDSA 2HA5A 3OPXA 4QGAA 4FZ3A 3T3EA 4HXEB 3R3YA 4DVGA 4F46A 3PEFA 1DO0A 4G23A 4GT1A 3ZVRA 3KFXA 1D4ZA 5MFPA 2NU6B 1KOGA 2HK6A 1ZA2A 4M49A 1UAYA 5DSTA 1K8YB 3K2QA 2CCGA 1KY5A 1JBQA 1YIAA 4QXQA 1V8PA 1VJ1A 4JP8A 3CUWA 3BK2A 4QNRA 3HZHA 4D57A 2HF2A 1ZONA 1EK1A 4LKRA 1UDRA 3BWCA 3NTXA 4XDYA 3ADOA 2YJNA 2AB0A 4Q1VA 1CYDA 2IBTA 4ZCPA 1BFUA 1VI5A 1E1CA 2G80A 5DM2A 2OBXA 3NC4A 1AKTA 4NMXB 5JH7F 1WDMA 1YR3A 2QG4A 3O4VA 2ZXUA 2JLXA 1JXMA 3HFGA 4QFCA 3GDHA 3FSJX 1E2QA 4XCXA 5DGTA 3RARA 3ZHXA 1L8XA 1T5HX 3QNWA 3MIZA 4ENTA 3W8NA 2HK8A 3SE0A 1R0WA 1SKYB 2WIAA 1Z6XA 3CLUD 4QUJA 5AM5A 3L4JA 3LCMA 2Q2WA 1UBEA 4C0QC 1U3UA 5AVWA 1RM4A 2GFHA 3X44A 4EUSA 2G5CA 3L84A 1R0YA 2BBWA 3P32A 3GWGA 3NHPA 3W2FA 2VQFB 4MW5A 3PQEA 2FFAA 5EC8A 2GSWA 2WDPA 3H18A 1VPDA 3R6GA 2A0UA 2EJCA 5TDHA 1GZ5A 2HCRA 2X19A 4IJ6A 4AO6A 5EJEA 1XAIA 4KZKA 1WDKA 4B7CA 3T5BA 5B4TA 5I3CA 5KX5A 3FI0A 2L82A 5KKCA 1XL0A 2JARA 4PZAA 4LWOA 1IZ7A 1GAJA 5TV2A 1GG2A 1LVUA 4HEA1 5CP8A 4C7MA 4K88A 5HVNA 3KLNA 3AL0C 1DAFA 5JQGF 3IEVA 4Y3UA 3I39X 3A05A 1Y33E 3KXDA 3HZOA 2VF5X 3C48A 3H2HA 4OQDA 1L5LA 3CXUA 4CMJA 3BYZA 2ZTSA 5GV8A 5AVYA 1W44A 2GTIA 3G2HA 3MMPA 3U31A 3DHVA 1YR8A 3LBIA 4A03A 4HTFB 1CQZA 4BY9E 1DAOA 2IYOA 4KR9A 2LZ0A 3HWX1 1D7AA 1JG4A 1W48A 4IDOA 4N0PA 1U2GA 3U37A 4HAOA 3DEHA 3PVSA 3OE5A 4MPTA 3WOHA 4UOZA 1ZM4A 2YOGA 3EXHA 5A2GA 4D0LB 1CRWG 3M1IA 3FM9A 2QP3A 2E1RA 2FUKA 2WHPA 1QIGA 4NNJA 5JAZA 4DF3A 1Y3FE 2H4JA 2ZDHA 4OM8A 5M7EA 3BAZA 1VKJA 3OQIB 1S0UA 4HMPA 3ZX4A 5HIAA 4DLPA 1W8IA 4WJLA 1U2GC 3W06A 1NBEA 5E6RB 1S2LA 4Q3KA 3MHPA 4RF4A 5J2TA 1Z35A 5KYKA 1KGSA 1XZDA 5IAGA 1BCRB 3GLFB 3G9TA 3AUJB 3T7CA 1EQUA 1PFQA 1VLHA 4K6FA 1BA3A 3KJGA 5DLDA 4YRRA 3COYA 1BWSA 5DK6A 1SVIA 5A0FA 2E6UX 4HNQA 2VHEA 4FYMA 9LDBA 1SH7A 1VMDA 3TZ6A 3OJXA 3SSAA 2ZT7A 4REMA 5D3MA 1XQYA 3UHFA 2B4TO 3IAAA 3VPSA 3RUHA 3ETHA 1AGRA 5EE9A 3ZZTA 3COVA 4IKPA 4MTLA 4BYMA 2Q6LA 3LUCA 1HG1A 3WIEA 5JBQA 2ABWA 5KQGA 2AMLA 3A1VA 4Z9BA 3SC6A 1R8JA 1Z06A 4BV8A 4O4IB 1RR6A 4WADA 4N5DA 2DJ5A 5AK4A 4DLSA 4BAUA 4AY2A 3WQBA 4YYEA 3HKCB 1K97A 3G5UA 1HE3A 3L82B 4WCVA 5G02A 1XOIA 5C5EA 2F8TA 3KWFA 1BAPA 3ORYA 4DCMA 1T4CB 2WU3A 4NAUA 4IFEA 1HE5A 4DV7B 3I4FA 4EG8A 2X58A 1SEVA 4DANA 4HS9A 2JVJA 1H4VB 3AV3A 3GJ5A 4TZKA 1P4RA 2HTEA 4I3FA 3TR5A 3VR6D 1R66A 4OMCA 4ZU6X 1E5XA 2Q07A 5EE0A 3VR2D 3SR0A 2P9FA 4PYMA 4UUMA 4G0VA 1PGJA 1PW7A 2LIPA 1WXHA 4RHYA 2XVMA 3IERA 4Q24A 4RKFA 4X7RA 4C4RA 1XK6A 4BLPA 2ECPA 2XFDA 1G2QA 2CBZA 4Q9JA 4XWGA 4D9IA 3LVQE 1LUAA 3AB3A 4D4LA 3EWAA 3VJRA 3H1PA 4IOJA 1PS0A 4HEJA 3FUTA 2VDLB 3DTVA 4HFJA 5HCIA 3UJDA 1UIMA 2AFIB 2P6UA 3FPAA 2QMUA 1G8JA 3GX1A 3G2PA 2WF8A 1PR2A 5AHRA 3ZE9A 3T3NA 2VDMB 4RVHA 4LDPA 2B78A 5IJXA 3S2ZA 1T10A 4YDRA 2AH5A 2AOTB 4JASB 3N8NA 2PH5A 1SPBS 2HRCA 3G2NA 4RXTA 4BV2A 4DTIA 4PSKA 3JY6A 3H0EA 3IULA 5IN5A 1MH9A 1GHTA 2FDCA 2YH2A 1KK2A 4GG1A 5IKEA 4XEUA 4UHHA 1FFEA 1OLXA 2BEKA 3WA6A 4YDHB 5AJVB 4KWCA 5B58C 1PNTA 1KJ9A 2JGAA 3WHPA 4D8TA 2CL0X 2D5CA 4LZPA 2QUAA 1PZGA 1XTJA 4EQ6A 5H3LA 5ITSA 1AKVA 2CLOB 1QHYA 2JLSA 4C89A 4C9BA 5FNVB 1Y7LA 1W0KA 3RU7A 1XZHA 1CIJA 3PPVA 3EPJA 1MR3F 5MGNA 3DD5A 2ZROA 2D7JA 3EUFA 4ZO4A 4KITB 2BGKA 2AWNA 2R44A 2FLKA 3BERA 2V9PA 3U1TA 4DZTA 1VJ0A 3OKCA 3VZRA 1JH9A 1NSYA 1ITZA 1TUEA 1ISSA 2NZWA 3BXGA 1MXHA 2BDUA 1ZUD1 2HSWA 6Q21A 2ZRIA 2WWRA 2BHNA 1NRIA 3Q98A 1KSFX 5FL3A 3ZWVA 1GT6A 3SR3A 1SCJA 4QEZA 2C1ZA 3KOXA 2IXTA 4PZ9A 3LC2O 1WCIB 1XXLA 3BMXA 1STOA 1TU0A 3CNQS 4HB4A 5FBLB 5KYYA 4Q1CA 3RYCA 4RDCA 3V1TC 3ICWA 1XL1A 3JQBC 4R16A 1KIAA 4YEDA 5L3VA 4YAIA 1WMFA 4L0QA 3NGLA 1B0ZA 2IRWA 4LV5B 5ALFA 4KFRA 6CHYA 1NI3A 2ORYA 5IYZA 2H2IA 5I3ZA 1YTUA 2NSHA 5KTKA 3A9SA 3R0VA 3K0FB 1DI0A 3KB2A 2IWRA 4GMKA 1LOXA 2WVAA 4BFTA 4I08A 1E4YA 1P81A 2XSZA 3WK7A 4D6XA 4J7XA 2GBCA 3UJ8A 2Z09A 2CBXA 4BLSA 3RUCA 2X1LA 3E0XA 2DLNA 2PH3A 4KEAA 4NJMA 1GGNA 1ODTC 3QH4A 4OFXA 2O48X 4ARBA 16PKA 3EYAA 2HA6A 4MK4A 1YRBA 3C97A 3EC7A 4WN9A 5JSZB 3RSHA 3NWJA 4R3UC 3MQ4A 4ZGWA 4JC0A 1SMKA 3AX6A 4RVFA 1CEYA 5M5BA 4M1OA 4ZQHA 3LY5A 2OBFA 4K2HA 1XA4A 2PHZA 1IULA 1ZK4A 1FNMA 2Y1OA 2W8ZA 3IB3A 4RVGA 1Z0DA 3IDZA 3SG0A 2BEUB 1ES9A 1CBUA 3BSSA 4MJ3A 4P53A 2VP4A 5T4HA 3PXDA 4MSUA 3WSWA 4F5YA 3HNPA 3ZZMA 1WUTA 3CPJB 4I2NA 2AOWA 1SBIA 2DE0X 2GVNA 4UMVA 4CMIB 1D6NA 2VK8A 5C18A 3GQBB 4JLPA 1QM5A 4NYJR 1W34A 5F2EA 5IHXA 2ODEA 1D4OA 5HE9A 3DS8A 4PU0A 4QNMA 1XZPA 4GRAA 1SKQA 5EWLA 4RW0A 2Q50A 4BQNA 1A9SA 2OCDA 4O63O 1Y7PA 4L6AA 3FLEA 3ODPA 1TTTA 2JBWA 4GZ3A 5D5HA 3OBIA 3ETJA 1PEYA 2K2WA 2RHGB 5FA6A 1H2AS 2XMZA 4AZWA 4ZO7A 1DIOB 1O77A 1MJ5A 2J9FA 3D5QA 2QG9A 3O94A 4CL2A 4CEIB 3R6LA 3K4PA 2GD2A 2LCQA 2BM0A 3RVQA 3AZOA 4HQ0A 3OF5A 5B53A 1T5DX 1E69A 3ICVA 4KYUA 5CEEA 1U1DA 5JVDF 3KZNA 5JTTA 1ZVKA 1IWOA 3IUQA 3K0EA 5CG1A 5K0CA 3Q10A 4ZVKA 3RJ5A 3SLRA 3HJHA 4QLBA 3SQXA 1YL7A 2UYYA 2O8EB 4AK9A 1BE6A 1JBKA 3NORA 3AEXA 4IIXA 5BWLA 1HEIA 2AEEA 2GZMA 2I7CA 2Y99A 3EXFB 4P3OA 5IFLA 1OT3A 4X1KB 2J7PD 5DFAA 1RC0A 2DPGA 1UWLA 3KEGA 3Q0EA 4FXOA 1J56A 2OILA 1UMCA 1Y7IA 4C07A 4UM9B 4YRCA 8ABPA 1KI9A 2FMXA 3HU3A 1U7XA 4TMFA 3LQ4A 1C8LA 2F3QA 1YZFA 2CZQA 2XEXA 4OVKA 4S0XA 4XX1A 2UV8A 1JJIA 3ILSA 5IBQA 2O2GA 3N6RA 4G26A 3R7AA 1PR3A 1IOZA 1KAHA 2X41A 5IZCA 1RKVA 2O2CA 4JLUA 4MYCA 4U7PB 1YRWA 4FQ8A 5J40A 3SYRA 3UXMA 4EGJA 2XNJA 4RDIA 4K9PA 1B8OA 3ES9A 3FPBA 2HYIC 4FP9A 3IEKA 4YBZA 5K2MA 4E5UA 3W2TA 1EWKA 1P3DA 5HUHA 2VDPB 3ZS9A 5JLJA 1L5VA 1R6BX 2JRCA 3MAJA 1EXVA 1AO3A 2QLJA 3R0IA 2GXSA 2YMMA 2R6HA 3KQVA 1Z34A 1SQGA 2KS6A 5DHPA 2NV6A 3D8NA 3IILA 3PITA 1MIHA 3BS4A 1EVKA 4R1NA 2QRUA 2Q4DA 5AJYA 2IKQA 2J5RA 4DA7A 3DKVA 1RU3A 1VGVA 2OAEA 3FHJA 4Y6SA 3ZLTA 3ZJTA 3B52X 1FZTA 3WNQA 1GQQA 4JI7B 5DIFA 1ZD2P 1E92A 2XYHA 2JHFA 3GLHA 3LTEA 4LC0A 5H80A 1F5SA 2WAXA 3NYQA 3TPFA 4XA8A 4YQFA 1M7GA 3A0RB 1V96A 1DG3A 5C53B 4LRYA 4E15A 3QVVA 4NE9A 1GKIA 3C74A 1L5WA 3FRHA 3ZV5A 1ZWKA 4H08A 4JDUA 3IP9A 2A9FA 2PSDA 1UEJA 3NIWA 2OB1A 3LPDA 3I6MA 1B74A 2VO1A 3JQFC 4CGYA 3VC1A 1UZAA 1YS6A 2ZYDA 4XLTA 5G0VA 1KO1A 1T6XA 1UOEA 3CUVA 3BJIC 2JIZD 5EXEA 4EO9A 4JYBA 4AY3A 5DLEA 1RLOA 1BGXT 2EIHA 4NBRA 2WIDA 4RY8A 4Y7CA 3MCTA 3NBFA 3S28A 1TPZA 1QYDA 3C3JA 2DQ4A 1V7CA 3JQ8A 4CVNA 2PGLA 2NXEA 3OE7D 1LS6A 1VG8A 4BZXA 1OFGA 1RKXA 5GP1A 5I9NA 3UPTA 3W3ZB 2XQKA 1RXYA 3DV0A 1GILA 2VCHA 2VUUA 4KQ9A 1GAXA 2PG3A 1NFRA 1M2HA 4ZI7A 1AZLA 4NMLA 4X6YA 3JZAA 4MLDA 3QNMA 3WYFA 1NG9A 3B1XA 2JKVA 2O6HA 3IJEB 3PFKA 3TL3A 3AHCA 2RK4A 3B38A 1A4UA 3ONNA 3HNRA 3P0JA 4QTTB 5KBYA 3ZU6A 4ETMA 2V0NA 3M34A 3PKIA 5BV2P 3EB9A 3R9XB 1MQAA 5C0OE 3BJZA 4B71A 4EMTA 3FBTA 3GJZA 1CNEA 4HNRA 4RXUA 3PUVA 3SIRA 4AXBA 5FWXB 3KOWA 3CWZA 4DM3A 4WWHA 1QIJA 3TRHA 1CVIA 1NVBA 2GD0A 2RBGA 2WHYA 3BIWA 1YHZA 2FN3A 3E70C 4L4XA 2XLBA 4L73A 2G77B 4XEHA 3NPMA 1PT8A 3DZGA 4BB5A 3HGQA 1C3EA 3D9QX 2HDWA 1E18A 3I5MA 1RWBA 3F90A 4MO2A 5D86A 4MS1B 2HA7A 3ZVKA 4KQ1A 1U8ZA 2SCUA 5MDHA 1LPAB 2JLUA 4AUMA 4BO8A 2REQA 2WAOA 5BSVA 3TQSA 4CHTA 3KQNA 3W9SA 1MPXA 1KI6B 1DKUA 5ERXA 5K05A 1JFFA 3VPXA 2A84A 3UWOA 1NWHA 3N0TA 1Z33A 1PL7A 4TS9A 1QGED 4QFDA 4CKBB 5HYVA 5CA1F 1NXWA 4AMZA 2IEAA 2OD2A 1WMSA 1X8XA 3NONA 3TIVA 2CJYA 2FR0A 3IBGA 5KKNB 4BTEA 3VXKA 2A86A 1D03A 3U7QA 2NU7A 2QM7A 3CUYA 1F5NA 1E0AA 2ZWMA 1SHZA 4L1KA 3ZDZB 5K9ZA 5FOQA 4M9UA 2DT5A 3MCWA 2VRWA 2V6FA 3WLHA 4DNQA 4NXMB 5CVJA 4IMPA 3H3FA 5EE5B 1PWHA 1GNQA 2GAIA 4OXYA 3R9XA 2NYAA 4MVJF 3KLPX 4X97A 1DBWA 5MN5A 1ZJ4A 3AETB 4GI5A 2Q7XA 2R5FA 2RAPA 1I3CA 3UAWA 2ZPUA 1NATA 1VA5A 4GQBA 5IAJA 3WHLA 4MNTA 3SKXA 1S2OA 3HK2A 1PS9A 1KYTA 2PNFA 3JWJA 4D46A 4GFDA 3TLAA 4OQZA 3USES 3ZE2B 3V55A 4B87A 1GSAA 3S2FA 2HZ7A 1W35A 2AL7A 3HPRA 2WAMA 4K6KA 4W7IA 5KX5F 3T4XA 4A0RA 3L0ZA 3RFXA 3DEIA 3JYHA 2KWIA 4B6SA 4MVJH 4QOEA 4ENSA 4GXNA 1FLDA 1CY2A 2FYTA 5BNZA 5DK4A 3QOWA 2IPNA 3FAZA 3OZXA 3DBRA 3QPWA 2M1ZA 4JDPA 5H4HA 3ZDDA 2H63A 2AOUB 2RJOA 1HT3A 1Z3IX 3AEUA 4RIEA 3FDJA 1P2SA 2CUTA 4GWLA 4WHAA 4MI9A 4HL6A 4P4UA 3D7KA 3EIHA 1WBBA 4JOBA 4QFMA 2HN9A 3I52A 5ES4B 1UBHS 2CLMB 3VVBA 3FPHA 1XEXA 2EAUA 3QLUA 3N7TA 3CW8X 4E03A 2HMAA 3CG4A 3GDFA 2QNGA 3KZMA 4KK4A 1SU8A 4EEXA 1E9BA 2IS2A 1MAWA 2RHCA 2QTBA 1C30B 3D3EA 4ZV7A 3WMEA 3TTSA 2HX1A 2ZTUA 3TZBA 5IS2A 2F48A 3MWDA 3ZIAD 4FHFA 5EKDA 2J5BA 1L7BA 3DWFA 3EW9A 2QLFA 4MQ4A 1DPFA 4B9EA 2FW1A 5EEOA 1IQPA 1SWWA 3VGJA 2IDZA 2MSEB 4LQ4A 3WGJA 4LVOA 2QK4A 5TS2A 3HXKA 4JP1A 2PJZA 2TYSB 4MW4A 4P3YA 5JDCC 3QOXA 3NNNA 2XR1A 4GOJA 3FB4A 4XCQA 1IHUA 1F0KA 2OZKA 4C4AA 4R8MA 4MWBA 5A9SA 2OCXA 4LVNA 1G9SA 4O08A 3ZOKA 3GLFE 2NUTA 1RKQA 4G56A 4BLUA 1A9ZA 3JQAD 4D4GA 4L3VA 4D26A 1A3CA 1L1RA 2X5XA 4R69A 1NTRA 4C0LA 5A03A 1XHEA 1UR5A 2SBLA 1A9XB 4JLMA 2DKOA 1MW8X 4CTJA 2OCKA 2VQEB 2H2AA 2FJPA 1F0PA 1RYZA 3OHSX 1D5CA 1C7IA 1QS0B 5IJAA 2AS0A 4KE7A 3PFIA 2EL7A 2H9IA 3RC8A 3VTZA 2VHTA 2B4RO 5G4KB 4G9EA 1M2JA 2GZHA 5KUTA 4QJ5A 3HB5X 4TS1A 4RTMA 4YRZA 2H4HA 4I6GA 5LZ5A 1EZ1A 1XLUA 1A4IA 4DDUA 2XYGA 3E2IA 2PD3A 3SQOA 4GKKB 1G8HA 2JH3A 2DFPA 3CLUC 2P9HA 2YHUA 1V0JA 3QE0A 2X9NA 1VHQA 1W4LA 2RCNA 4GNRA 2ES4A 4YVFA 3HYTA 1V3QE 2P65A 1IN8A 2YMLA 4OBEA 4PO3X 2ZM6B 1QSGA 5FOVA 3RAFC 3O6VA 3AB7A 4KUGA 3LUJA 4WNIA 4B76A 5B64A 1VCHA 2P3LA 2V65A 4A36A 1MAUA 1X0XA 1M8FA 2QUZA 3TDMA 1LBQA 1K7YA 4BAZA 1C7EA 2XCIA 3OTHA 1SHJA 2JIOA 4FWIB 3UMJA 1UDXA 2HO4A 2WTMA 2YHSA 1EJ2A 2XIQA 4LI0A 4F06A 2FOIA 4FNOA 1WDLA 4MW7A 3N2LA 1VL8A 4WA8A 1DWPA 2KPOA 3VV3A 4C03A 1JEQB 4YAKA 4HPWA 2PWPA 3INYA 1RBQA 1VLMA 4WKPA 1GM5A 3PD0A 3ER6A 1V8DA 2AYYA 2V03A 3QVKA 3OPNA 1C8KA 2QTZA 3RVBA 2XE4A 4RMGA 4OKNA 2OLKA 2BZSA 1FUYB 1S01A 3WMFA 1XP5A 1NQTA 4DLXA 3FSGA 4RDHA 1RXWA 3HYRA 1ID8A 4Q3NA 3BRSA 4DQLA 2CHVA 1T2VA 1H22A 1TIPA 4WFIA 3SQNA 2MSLA 2N42A 5JSQA 1MOZA 1DEXA 4FYIA 5ENZA 2R6DA 3VNSA 2VT3A 1E6EA 1E9EA 1FMLA 4LGYA 3U3RA 2I5PO 1U2TA 3B48A 4BB6A 3WKBA 1IJEA 2FE1A 3IBSA 3LUBA 2CNLA 1NUHA 1P4JA 2FN8A 3SZLA 5B2EA 2DTEA 4GS5A 3EIXA 3L7DA 5CT6A 2PUFA 1FX1A 1DOHA 2WJYA 3KSZO 5LP6B 4KMMA 1JHYA 2X76A 3ZDQA 3HRKA 4QVIA 1AVTA 2ZBPA 4LF6B 4ZVMA 3LBAA 3OSZA 3PXXA 4PPYA 3SWWA 1IXZA 4RCVA 3DWEX 3OIGA 3MPOA 4CLHA 5JYBA 2XGJA 3BD8A 3RH0A 1B2LA 2QJTA 2VXCA 4Q7KA 4Y2UA 2H2FA 3LOUA 1KE1A 1G8AA 4NCJA 2BP7B 2Z9DA 4BQQA 4I5FA 5IJWA 3C6ZA 3Q3VA 1ZSNA 4DLTA 3TFQA 5IZ4A 4AJKA 3H84A 3CR8A 4MRPA 2LWIA 3GGPA 4GKVA 2VF2A 3A6PC 1NBOA 2PO5A 1UKCA 5BQOA 1YR7A 1RABA 1XKXA 1M5UA 3AF1A 3H2ZA 3K2EA 3HKCA 4KDRA 1ESEA 4KFSA 3L6BA 3PC3A 1FFBA 3T7IA 4IDQA 1Q91A 1YDFA 1TLTA 1Z6AA 1ZH6A 3KQTA 2M98A 3OHMA 2YV1A 3KPYA 4NZNA 5DHRA 3ZQ6A 1JP7A 4HAVA 3IELA 5JARA 1CDOA 4Q9DA 1EJ6A 4NE7A 1OAOA 2DH6A 3DHNA 3L6RA 1P7WA 3FFBA 5EPEA 3DMFA 3RVSA 3PE4A 5CXQA 2E1PA 1UK6A 2XUFA 3KHTA 3RVMA 1VXOA 2HMSA 3MLBA 4W82A 3OZIA 3MELA 4QXRA 1RKBA 3VDXA 3R0ZA 9MHTA 2JB9A 5EXSA 3IOCA 4TYPA 5LP1A 4HDRB 4KO8A 4MLPA 1UWVA 1B0AA 3QXSA 1FFAA 4ND8A 5LUBA 3TO5A 1RJ9B 3QITA 5HEKA 5HKOA 1LTQA 1AB6A 1SU6A 2HLHA 4GO1A 4BQPA 3I5XA 3DO6A 4OL9A 1NSTA 4R7TA 1YR6A 1S8AA 2JD0A 2Q3LA 3A9RA 4OH7A 2Z6AA 4P7GA 2WUDA 4YWJA 4E3ZA 3U1BA 3AJDA 1F12A 3WLMA 1CRPA 4IHJB 4NJEB 2SKEA 3DBVO 4EKDA 5A3QA 2PJRA 3L7IA 1J1UA 4MS3B 4PGAA 1EDOA 1WXFA 3V33A 4ESHA 5KWVA 1A88A 1CA1A 1GSHA 5IXYA 2R8EA 5AW5A 3WLEA 3B70A 3RUPA 2FMKA 1OGIA 1SUBA 1T0PA 4E88A 4HVLA 1E63A 3H83A 5IN4A 1ODIA 1LLCA 1TA4A 2W2OA 4UUNA 4UZSA 1O96B 1EYZA 1YU6A 2FG6C 3W2GA 2Q1SA 4HQRA 2WJJA 1P9WA 4CM4B 2XD4A 3SVTA 1H85A 4UNIA 4CEHB 1XLTC 1ZS9A 4B4UA 1XN1A 2G8LA 2P3OA 3IAS6 3OWOA 2YR0A 4GOND 3E5RA 4IVRA 4YJ2F 3WB2A 3M6XA 4AB1A 2E49A 4DXAA 2GPSA 2V45A 4YAWA 4GPTA 1AMOA 4O4LF 4AIIA 3JQGA 3WJ2A 4OJYA 2C0CA 1DMSA 1P17A 2IUSA 2W98A 3AR6A 3DMRA 3G2MA 3IOYA 1D8AA 3RTEA 4KJXA 3QX8A 5DXAA 3H6KA 2O3SA 1UKYA 3U3XA 1Y1SA 1P9LA 2ATCA 2F3TA 2P8SA 1YDEA 4YI3A 1FIUA 2W2LA 1KEPA 1DKOA 1CJBA 2O52A 5DYTA 4ZAYA 4NK5A 1EVEA 5KNCD 3ELYA 4EYGA 3D7RA 3WLIA 2ISQA 3TRIA 1LTHR 4Y67A 4CTMA 4JEIA 3D8RA 2ANBA 4URVR 2ZM5A 1KBZA 5D2CA 2OXEA 2BUAA 3IAUA 3O95A 4UBKA 2FMFA 5EZQA 5IPFA 2B1GA 1UXIA 1UQUA 4X6UA 4TS3A 1DIAA 1YRLA 1JA9A 3USCS 3GWZA 1CXZA 2ZSEA 3A2NA 1ZM9A 3GEIA 3Q3JB 4UXIA 4IQ4A 1LKZA 1EXDA 1FYXA 2RI1A 4WSOA 3KR2A 3CO5A 4EQZA 1KFBB 4JXJA 3TPCA 3U9SA 1YRYE 4QYIA 2B20A 4MARA 5EZSA 2AK2A 1TVCA 1AXGA 1J49A 2A3RA 1QZXA 4MVWA 1CLEA 2CVPA 3IDOA 3TX2A 2L2QA 3A4VA 1N3IA 1XVVA 4FIDA 4KC0A 4N7MA 3KU1A 3WNZA 2EYQA 3ZX5A 4AM8A 4DJTA 2H31A 1CR0A 3NM5A 4KSCA 2SECE 3F5SA 2B1IA 2J3EA 3QXHA 1W36B 2K5UA 2A9PA 3EHEA 1KQPA 4P81A 4TWJA 5B57C 2AR0A 2VJNA 5FI3A 1MXFA 4S1TA 4QJIA 5AI0A 4PTZA 4HAIA 2EERA 2WSMA 3B1ZA 5AM2A 1M2WA 4YP1A 4ZVOA 5HKAA 2H9AA 1GTZA 1W87A 1WWKA 3HDTA 4JT2A 1C41A 1LBEA 3GRUA 4YP7A 4BVAA 4YMTA 3QVTA 2XMPA 5A7HA 3I0MA 4MQFA 2GO7A 2AF4C 3LOPA 5IKXA 2GTPA 3HB4X 2DECA 5AKHA 1I7PA 1USKA 1S89A 1YS9A 2W58A 2JVIA 4FGJA 1XQ6A 4GOMD 4K2AA 5HFJA 4YRSA 4H3VA 1C3OB 4KQXA 4BFSA 1J99A 1IOVA 2C3YA 4NR0A 3WKDA 4BRZA 1KDVA 2P7IA 2Y66A 4Z2YA 4NARA 4LTNA 3VPFA 4XX0A 1ZM7A 2FWNA 1A95A 3WNCA 4BMZA 1SKMA 2I3DA 3THRA 3B1FA 3DV2A 5AWFC 4ER7A 1QRRA 5LD2B 3D59A 4TWRA 3WOVA 3N59A 3IB6A 1Q0SA 1FC0A 4WL0A 2FSIA 4AROA 5C1BA 4WESB 4BUJA 5GIPE 3QHQA 5H16A 1Y6FA 4KB5A 1TEZA 1JA1A 2XUAA 1Y4ZA 3PFNA 3LDHA 3SFTA 4ILKA 1EA7A 4R40A 1AA9A 2J0SA 2EG9A 5LA6B 1R50A 4G5OA 4F97A 2Y2VA 1QMPA 1QXSA 1J7KA 3D6FA 3BIOA 1U9IC 3B3QA 1V5EA 1BH6A 4WBNB 5C9ZA 2DUMA 2QAIA 2Z4TA 3D6UA 4I4IA 1T9GS 4S3MA 4R9VA 3RSLA 3OQVA 4CIXA 1AQNA 1KFJB 3P0FA 4ZCRA 2IITA 4N3GA 3SDBA 4ZJUA 1NT2A 5HZHA 3A9CA 1P0IA 4Q21A 1VPLA 3SHVA 3ZR4B 3F6YA 3NBKA 2P27A 5BMVA 4OTZA 4ZEOA 5JROA 4AN0A 1MO4A 3TE6A 1Z82A 2HNAA 3B89A 2DY0A 3I2JA 3GH3A 2R25B 3MNFA 3DE6X 5AJXA 5KQLA 4I36A 1O0BA 1FXSA 4UVDA 2WPDD 3G85A 1SZCA 2XEDA 3P9RA 1NWCA 4GMHA 2D59A 4K9SA 5HRUA 1R6TA 3SEQA 4EM6A 3HJTA 4HBGA 1B8NA 3BH0A 3FPEA 4UHKA 3CZAA 4Q9IA 5K0JA 1GZHB 1QGAA 1NN3A 1ZI8A 3QXGA 2HK7A 4XUEA 2Y05A 3EMVA 3HRIA 4FCWA 4IGIA 4ENWA 1CZHA 4DPKA 1AN9A 1TQ6A 1FSSA 2HU8A 2D4HA 4I9GA 4NPAA 1JLLA 5DEIA 2OYCA 1U2SA 2WY2D 3NDPA 5DLYA 3V8MA 3P9XA 1GTMA 3LY8A 4PBRA 3V3TA 1I7DA 1MOQA 3JQ9C 4QXPA 1ZH4A 2W6ID 2AXPA 2YC2C 3GA7A 4OGLA 3TXYA 2B1RA 2VSYA 1ILEA 1T3GA 2FR1A 1C50A 3I6BA 2VSXA 4G0YA 1PT9A 1W0CA 1DPGA 1DXOA 1JFFB 3UOWA 1C7ZA 4D98A 3ABOB 5DI9A 2IXDA 3DDZX 3W6UA 3FWHA 3KL2A 1YV9A 4DDHA 5C8DA 3KETA 1YQQA 2A5YB 2HJWA 5FI1B 3QMWA 4OB6A 1T9GR 1KOJA 2UXDB 3LCRA 5AJTA 4B4WA 2H9YA 2JFFA 5AM3A 4AF7A 3TVTA 5J23A 1OREA 2YY5A 5JNWA 1RXIA 3GPIA 3GRKA 5EEGA 1UBLS 3O4IA 2HRBA 3RS0A 1SUWA 1J0CA 1MT0A 1EFVB 4HY3A 4QICA 1VJDA 4A5OA 2AC7A 3BAFA 5LB2A 2CFIA 3T35A 4ARCA 1KDTA 2IZZA 1Z8NA 4ROTA 3O3OB 3TSOA 5B7PA 2W71A 1EX6A 1DT3A 1T2DA 5KU7A 3AETA 4LDZA 3U56A 1NA5A 3HB0A 3EJWA 5CT5A 1LLFA 2QR5A 5JMPA 3X0DA 2WG0A 5G0TA 1IBMB 1PR6A 2DX7A 4FSXA 4IKOA 4YAOA 3UA4A 2PYDA 3FBGA 1TVKB 3HE3A 1LK7A 1ZD4A 3QU4A 1BMQA 2C2XA 4EP1A 5B12A 2AC2A 4M0EA 1IBKB 4RTRA 1XZQA 3G0OA 3T6KA 1PJTA 4QG3A 1JVSA 4KIJA 3NM4A 4G1CA 3QHAA 4I4LA 3GFTA 1MC1A 4RK4A 4I4CA 4WOBA 4D8UA 5LKAA 4HUQA 1K75A 1N3BA 3M83A 4F8YA 2H3HA 4X54A 4B6RA 1HLGA 2HH9A 2J6HA 2QPLA 5ICEA 2HA3A 5EKTA 2OHXA 4F2GA 3GNSA 5ECDA 1VPVA 5TF4A 2MSDB 3U81A 4OQQA 5JR3A 1V9CA 1FTWA 4OXRA 3S2YA 3DGEC 1JT9A 4FFNA 5KJFA 1MBZA 1IWBB 1J24A 1KI6A 2QVXX 2VHCA 4EZIA 5D1NA 4OD0A 1MENA 5IM4F 4KVGA 1Z7EA 2O59A 1ZWLA 1AHIA 2IGTA 1ZLXA 3AUSA 4DIKA 2FOLA 5BP7A 3RDPA 1U8XX 4MCHA 4DWJA 3BHMA 1SA0A 4X6XA 3U3DA 4ALKA 1Z83A 1LZKA 2J5XA 1GSOA 3DWGA 4B9AA 2VRBA 1LF5A 2I22A 1V11A 4NJOA 5H59A 4D8WA 4AO7A 3D43A 3IH5A 4D0SA 3QVMA 1QKIA 3NHWA 4FOPA 4GLLA 1WEKA 4UASA 4KAAA 1Q74A 4HFNA 3PR3A 2CE7A 4XTRA 1WKBA 3AJ8A 2ZPTX 4G5FA 1O94D 4JUIA 1R6AA 4N6OA 4D3YA 4L5AA 1QGZA 5F9MA 3TZKA 3K1JA 3UMFA 4AUKA 2V3CC 1WBJB 4BJHB 3AHJA 3DZDA 1YB7A 3SS9X 4I8XA 3VU8A 3ZGLA 2ERCA 5JCXA 4PC7A 4HYTA 1K3FA 5KVAA 1VCOA 3U4HA 6AT1A 4P54A 1N7GA 4PRLA 3M6MD 1UBKS 3DYVA 3ESDA 2BAGA 3I0NA 3PFHA 3KEOA 1HU9A 1U5BB 2BC9A 4MQMA 4EHLA 1NM5A 2VAMA 1RTKA 3T3MB 1UCFA 4M4SA 3ZE7A 1OWPA 3AR7A 3H1AA 3OETA 2MYPA 4BNZA 1P72A 1FL9A 4DIEA 3T15A 1RLIA 1D4FA 2FFJA 3JRWA 1GXSB 4HGQA 2VZEA 2O4UX 2CHQA 4TQ9A 5ESDA 4YJKA 4X66B 3A2KA 2Q8NA 2C9BA 3K9NA 3CNLA 3RR2A 4EABA 3DMYA 5B4UA 1GL6A 2SHKA 5JLAA 2C4KA 2DQYA 1NZFA 2QTVA 1TYBE 1VJ5A 2YWBA 5KI6A 1UEIA 4XVQA 5FPYA 1TZ2A 3JWPA 4A2PA 5A5EA 3AERA 3GFFA 1Z0ZA 4ND5A 1OFVA 5L3SA 5CUQA 1WPXA 3ZDRA 4KQWA 1S5PA 3G7NA 1EUZA 1ZGJA 2G28A 1LWOA 1Y4AE 4WN3A 4NZMA 5LQSA 5IMSA 4DUZB 4MQLA 2RONA 4LFBB 1E9SA 3KUDA 4P8RA 4DUGD 1N2HA 3OFKA 4CEIA 2K7ZA 3IKMB 3ZW8A 4RCZA 2GA8A 1HYHA 4R31A 3SZRA 1FX0A 5JANA 1GPAA 2KM1A 2BFEA 1K5HA 2KYRA 2WNSA 3CH5A 3OQBA 1HQCA 1HE2A 4HX5A 3ZH2A 3O03A 4CIWA 1UQRA 3V7FA 1UBCA 3FTNA 1QAMA 5KHLB 2WE7A 1Z2OX 2H52A 1W49A 3K16A 4KO2S 1SIUA 5ITZA 4TSFD 3RK1A 1V35A 2EJWA 4MUNA 4YXWD 4HRAA 3MWEB 2GILA 4RXMA 3OEED 3OQOA 3RF6A 4UEWA 5F3DA 4BFYA 1Q7BA 4FB5A 4KIWA 3VX3A 2UUOA 4ZCTA 2V8OA 4ND6A 4ZN6A 4LZZA 1UK9A 3CC8A 3CE6A 4HQLA 2CWWA 3VNQA 3PPXA 4CUJA 2DFTA 3R6TA 3NANA 3WGIA 1OLPA 3IR5A 2XMCA 3VBEA 3NW9A 1VFPA 5KQPA 3LKVA 4Z4GA 2F7SA 2ZRCA 2XDQA 3R7WB 3IBYA 3RVLA 1XZLA 5BSRA 3WDMA 3I1FA 3A6FA 1IK3A 1P5JA 4Y9RA 5IDVA 4LRQA 3W8DA 4DUGA 4RK1A 2QRPA 3H0KA 1FFHA 3LWNA 1UC9A 3VDQA 1U04A 3IMKA 1GQYA 4UBJA 3ZKWB 4A0HA 1WE2A 3JWEA 3EIEA 1DBSA 1PLLA 3E5MA 2C31A 4JMLA 1T8YA 3T9DA 2VL7A 4NVRA 3BXOA 2Q6KA 1VC2A 2WVJA 3O8QB 4GYKA 4HYYA 4YC7A 3A4NA 1DBVO 4Y98A 4ZXFA 5BQ5A 5ER9A 2VPPA 3WLPA 1MJNA 4IHAA 3AZPA 1EVIA 1Q14A 2I8AA 2FZVA 2GKOA 2OZVA 4PINA 4JKIA 4L9RA 3UJ9A 5L7TA 4PYNA 5CPBA 3D7MA 1EWTA 2RHDA 4LRWA 3JQFA 1HRKA 3FJOA 4JC4A 1VA4A 1F8FA 1P7YA 3RQIA 4Q5IA 2QTGA 3O1IC 3VU9A 3FCOA 5E2IA 2GN4A 3K1ZA 1IXRC 4OLFA 1UKAA 3NC0C 2R7AA 5EHGA 2JGDA 4B6FA 2FW8A 5A71A 1AV7A 2ZAOA 3AK4A 3CW2A 4KTVE 1TMKA 4KSBA 1V95A 3AHDA 1VSQA 3D8BA 4JP2A 4KWTA 4R4JA 3GGDA 1DRJA 2QNBA 4N39A 1I4LD 2P0YA 3AY3A 4HXFB 1Z4PX 3ABIA 4ZXPA 3FTFA 3C3YA 1EHIA 1YOVB 4WACA 3KKQA 4CQLA 5D8DA 4OBBA 1L7OA 4KWIA 1ATZA 1RPNA 4PQGA 3D1VA 2DGDA 3OG9A 2P9CA 5G3ZA 2CEKA 3LKDA 4V0KA 4RTLA 4TTSA 4MRVA 2PKEA 3P9SA 2Q5CA 4D96A 4DREA 4MP6A 1SRRA 3EY4A 1BGWA 4J7UA 2IPXA 3T0GA 3NDRA 3VVCA 1CD5A 3ISVA 1NASA 3B78A 4K05A 3P94A 4WKGA 1XU9A 3EZ9A 5D6NA 4ZD6A 3WNDA 3VJKA 4C6TB 1KJJA 4LWQA 2C2MA 2OBNA 1N5LA 3FOFC 4JI3B 2GBGA 3CLHA 1UEXC 4MI3A 1ZC4A 1CEXA 1GV1A 2HNBA 3WY9A 1GPWB 3HY6A 4BRUA 2WIFA 1VYVA 1U3FA 2OP1A 1L4HA 2DQSA 2KQUA 3NLLA 4UUPA 3LXRA 4PG5A 1R10A 1WXQA 4GBJA 3KQKA 1COZA 4YO8A 1WB9A 2XNCA 4C0SA 5I9LA 2BSAA 1IAVA 2OHIA 2Z08A 1JHXA 3B6EA 4GZ6A 3K32A 1ZCBA 1OYOA 4B2PA 2VTBA 2A1IA 3M3DA 5F21A 2ENUA 3KLBA 1GU0A 3BJMA 3IEUA 3HU5A 5E95A 4M1TA 4UW9A 4L4ZA 3TZEA 5JC1A 2B2CA 1EB9A 2AMJA 2OWEA 1BS2A 2C2GA 2BI4A 4WHMA 1I7QB 2C5HA 3EFEA 1IEXA 3PQCA 4II3A 4CFYA 5GJVC 2Q5LA 3V1YA 2NP7A 1KOFA 1S2GA 1LVGA 2VDOB 1FJXA 2DWOA 3AVPA 3HKEB 4NRDA 1EVJA 5EWJA 2W00A 2YVUA 3EA4A 1DUVG 1ESDA 3CF4A 4QBKA 1QP0A 1U4OA 3WRWA 1DXYA 2O20A 3EQZA 2IU4A 1RQXA 4RYLA 3T1VA 3KSDO 2XY4A 1SG0A 4B48A 1V6AA 5LQMA 3ENZA 1AO0A 4CCAA 1XA3A 3UJ7A 1JBEA 1GTG1 1P7ZA 3C3MA 1RIFA 1T0UA 3DVQX 3G88A 3GZ4A 2GCOA 2W4MA 1A9PA 5GZ6A 1KDZA 4BQOA 5AOBA 3ZVNA 3IEIA 1JEDA 2BFAA 1P0FA 5CXXA 2OQVA 4UCXA 1GKYA 2J3QA 2XITA 3MAGA 3JAKA 1E6WA 1PJ8A 4TWAA 2VI5A 5C7IO 4JR0A 1L8LA 3RC2A 5LYJF 3FHTA 3ZY4A 1PLJA 5LZ9A 2X1MA 1NIPA 2EHDA 4F92B 5KSZA 3DOIA 5COAA 1XCOA 3BULA 3C7TA 5F5NA 4MINA 4BFZA 2X77A 1YR2A 3C5HA 1FS4A 4KKXB 3THXB 2CMKA 2H1HA 3IOEA 3MIIA 4O25A 1Z2CA 5DV9A 3GUHA 4Z86A 4R0MA 1V9LA 4I81A 1C81A 4J16A 4RPGA 3SXPA 1DL5A 5B1EA 2B8EA 4MEBA 4WUTA 3VNRA 4K28A 2PT9A 2Y27A 4H1UA 3ANNA 4GUAA 1UH5A 4YMHA 4L6CA 3LCJA 1E3LA 2JGMA 1Y5NA 4CV3A 3VKGA 1HURA 4I9FA 3OCYA 2HHJA 4H3HB 2IP2A 2XCTB 3HSYA 4CQJA 4MW0A 3BZWA 1CUYA 3VR1A 3RVDA 4P22A 4UFNA 3GD7A 2EW8A 2QD1A 3KQPA 3RT9A 3SBEA 3VR5A 5KTMA 1EJBA 2JFQA 1OHHA 4RACA 3QEAZ 4BX0A 3GRPA 4NU0A 2I6TA 1JYFA 5B1SA 2G9UA 4JSTA 4CCWA 1WY5A 1F8UA 2GYUA 2ZUEA 3ZHYA 5LZ4A 3KT0A 2CC2A 2CFCA 2R8BA 4DV1B 3OJFA 1OCEA 3SYNA 4EOGA 3AY7A 3IV9A 1YXMA 1HFKA 2H0QA 4K6CA 1C9EA 1RJDA 5KB3A 2HU2A 2I8LA 4I55B 5KYXA 1ZD3A 1ZCAA 4EJMA 2Q9CA 5K3FB 4ZYVA 4LXIA 1CS0B 4YRTA 4PO1A 2D5AA 3BDIA 4CLRB 2VXBA 3REGA 4ZMBA 4JB8A 1D6JA 2AKEA 9ABPA 1GPH1 2IYLD 4FZRA 4OKSA 1O3YA 3T7AA 1C0KA 4K03A 4LN1A 2BFDA 1LA2A 1K0FA 4PCUA 3ZNNA 1J2EA 3FG3A 1JEJA 1JJ7A 1R4NB 3OQNA 4MR9A 2A30A 1NURA 3PGJA 5DXFA 4JH0A 1PNVA 1BA2A 2IODA 1Q83A 2R8YA 4BVBA 4NG5A 1AGNA 5F12A 4IDAA 3CKMA 1L5YA 3ZOZA 1XHLA 3QKWA 1XGKA 1JX6A 4EMBA 2DBRA 4F9FA 1KVRA 2B3DA 2WG2A 1AM4D 4JB0A 3S3TA 3JVEA 4B7UA 5LXTA 1Y8ZA 4RE6A 4DGQA 2JHCA 2F1IA 2PX2A 2NO5A 2AMVA 2ZSKA 5LWHA 3AP3A 3QENA 1F2VA 1OAOC 4RK6A 4ZT6A 2R8RA 2C03A 2ZI7A 3FTEA 2WMOB 1UC8A 4TV8B 1GNTA 2XYVA 6PFKA 3NFYA 1RQGA 1A2KC 4LOLA 3G5AA 2YWXA 2OCGA 4TT3D 5EIWA 5F2OA 4DSZA 5EP3A 1M9NA 4PWZA 3UFXA 1U6JA 1FNDA 1WHSA 2CDNA 2VZ9A 1UL1X 1Z37A 1OXUA 4H1HA 4J6EA 4P5EA 5FPKA 5K6AC 3Q4GA 2DPMA 4MRRA 1VRCA 4Y6OA 5EINA 2DHDA 2IZ5A 4B3BA 3GFRA 4FHGA 3SJAA 4EECA 2YFYA 4YLGA 2VYVD 5HCUA 2XZOA 2UZAA 3BFKA 1E0DA 3A1FA 3SIPA 1ZSYA 2J9XB 2JH9A 4KFUA 4LG1A 5EP2A 4Q7MB 1RYNA 2E4AA 2ZU0C 1U31A 4YROA 4E5YA 4GR5A 3AXSA 3AF6A 3R7FA 1KA9H 1M8JA 2ZREA 5INTA 1LLUA 2CSXA 4LYJA 4WOKA 2IP4A 3ZLUA 2WM2A 3FUUA 4TLLB 5JAPA 3IX7A 2DMRA 2XOXA 2CXPA 2X3UA 3O92A 4K9RA 4ZVVA 1F1JA 3M1AA 3AFNA 2BT4A 3V98A 3L3BA 2BR4A 4LOKA 2YXPX 3EQ2A 5ERGB 1FXWA 4EZEA 4ZJZA 1ISGA 3G5LA 1UPFA 3MRSA 4UATA 4UHDA 4J3NA 5BN3A 4UZFA 5KMGB 4AZTA 1U4SA 2BFCA 2NLOA 3GJ3A 4LWZA 1GGMA 3FOBA 2AMFA 1ZK2A 3TB4A 2G5GX 4L7QA 2PQ2A 3AJRA 2XTNA 1VL5A 4FR0A 1YVUA 3U62A 3FMOB 1NOIA 3CGWA 2Q5HA 5C3UA 2ZBQA 3OCUA 1B41A 2EZTA 1T5IA 2XNHA 4DLNA 2VYVA 3P9ZA 1DV2A 1QMGA 2ZQZA 4L5IA 5C4MA 1RRCA 2NUAB 1YBFA 4TQAA 1JAZA 2OMKA 2QENA 4BMYA 2BEVA 3S2UA 1EVLA 4MHSA 3LNCA 3L7MA 1QK3A 1G16A 4UJ3A 1PYDA 5EJ2A 2Y9PB 3QPUA 1Z5PA 4URUR 3OZCA 4M8KA 3PZRA 4A91A 4EELA 2JF0A 5KU1A 3QU2A 2P6MA 3RF7A 3GJYA 5IT0A 2VK1A 4E2WA 3AIIA 5F7OA 2I91A 1S3GA 4K9NA 2W42A 3F8SA 4J0GA 2I3AA 2D5BA 1SXJC 2C0QA 4GDMA 4LMAA 4J9UE 4NYIQ 2W6ZA 3E1SA 5GVSA 4PX5A 2OEPA 2JFYA 4ME6A 2I9KA 5IMBA 3WL7A 3KHUA 4ABYA 3UFBA 2JW5A 3FOAA 4RNCA 2XUKA 3WHIA 4A0GA 2BCGY 3BTVA 2VIIA 1XRRA 2A67A 5E9AA 1PYGA 3ZXSA 1PEDA 1CY4A 1PJCA 4EY5A 4HNTA 1BHQ1 3FOWA 3DTVD 1W5FA 2A9OA 3EZLA 3R5HA 4IHKA 3RFUA 1VHJA 4N76A 4BO6A 2ZB4A 3ZBQA 1I2ZA 1D2HA 3I3OA 5FTNA 2C3PA 3F5DA 3V7WA 1K4YA 5AP9A 3L92A 4I8DA 2FHSA 3D6TB 1CUBA 1YFKA 4K9QA 5I4IA 5K3OA 5G41A 5KQRA 4DRXA 2ZTLA 4Z0HO 2INGX 1MN6A 3BRWA 5I7UA 4PVCA 1SUDA 5T64A 2VJYA 3KJIA 1QRUA 4PGHA 5F1OA 3VZCA 4JOCA 5IDYA 2CJWA 3LUPA 2BSQA 2E82A 3EISA 3WLQA 1UC4B 2IHJA 2F1KA 4S1OA 3GPLA 3H7IA 4PC6A 1RXUA 1T1EA 3MOGA 4UMDA 3TDKA 3RVOA 3ZIDA 5KJCA 1S4QA 1WLYA 4HT3B 1PBNA 3PF8A 3UEOA 2PAAA 1XHFA 4Q3LA 4RA6A 1QV7A 3DQZA 4XLZA 3S1SA 3EVFA 1W5EA 4G0NA 1CY7A 1NVEA 4AW9A 1JEYA 1GPBA 3LLSA 3KSAC 2BMFA 3SCZA 1KJZA 2PMBA 1ORVA 3EA5A 1P1HA 3QIVA 2FPWA 2YN4A 5I5EA 5COQA 4LOAA 2I3ZA 1OZGA 3IXQA 4KDCA 4RPLA 3WLAA 3DJFA 2ZITA 3N5KA 5AUOB 2AN4A 2HCTA 2C7PA 1UFRA 4HZIA 5TC4A 3HNOA 1CR1A 4C3VA 4P38A 4CCSA 4D9BA 3TFOA 2ZRAA 4IWNA 2IV7A 3CR3C 4UMEA 3QQPA 3R5KA 2Q62A 4JIGA 1DKQA 2IJGX 2GYWA 3R6DA 2PT7A 4G4SO 4XFKA 1G8YA 3ET5A 1SKAA 3TW6A 4FM9A 4PX3A 2H29A 1GG5A 1Z3CA 3KU4A 2NUBA 2G40A 1HRDA 2O1WA 2CDRA 3PQFA 3RT7A 1KO8A 3OIVA 1Z28A 2JBHA 2QN8A 3PR2B 4R2WA 1I1OA 4RJJA 1PVDA 4YO7A 1SXGA 4M0PA 4POOA 1S02A 3WRXA 3ADPA 4Z7JA 1C7JA 4PO9A 2GA9A 3JR3A 1X86B 1ILWA 1ZY2A 3CCFA 1Z39A 4OK3A 3E3LA 1NP6A 1ZL2A 1F1BA 1GDDA 1II8B 3HFSA 2GJ8A 1XRMA 2PR2A 2E3JA 4G8DA 1O08A 1Q5PA 3W78A 4DLWA 4G63A 2G6BA 3PL5A 5HJ2A 4Q82A 2PKRA 2WBLC 3KZVA 5DNCA 4ZDKA 3OZGA 3J81A 4PR3A 4FKBA 2MSNA 1TGVA 2WIGA 4BN4A 2FJ0A 3UJNA 1YOBA 3ASZA 1RCFA 2VT7A 1QB7A 3CLVA 3IYLW 2A0YA 3LYHA 4Y2RA 2YXDA 1A9OA 3JPYA 1QH1A 3GJTA 1V41E 1NLZA 3JATA 4NENB 4B2YA 4F9TA 5CT8A 2Z6VA 3E7DA 4BZZA 3VPCA 1JDBC 2QG6A 1NJFA 1QPGA 3T1YB 1QC5A 2BH9A 4UPDA 4H4CA