2PVSA

Structure of human pancreatic lipase related protein 2 mutant n336q
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
452
structure length
435
Chain Sequence
KEVCYGQLGCFSDEKPWAGTLQRPVKLLPWSPEDIDTRFLLYTNENPNNFQLITGTEPDTIEASNFQLDRKTRFIIHGFLDKAEDSWPSDMCKKMFEVEKVNCICVDWRHGSRAMYTQAVQNIRVVGAETAFLIQALSTQLGYSLEDVHVIGHSLGAHTAAEAGRRLGGRVGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGFGMSQKVGHLDFFPNGGKEMPGCKEGIGGFVSCNHLRSFEYYSSSVLNPDGFLGYPCASYDEFQESKCFPCPAEGCPKMGHYADQFKGKTSAVEQTFFLNTGESGQFTSWRYKVSVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNVGKIQKVKFLWNKNLSEPKLGASQITVQSGEDGTEYNFCSSDTVEENVLQSLYPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of human pancreatic lipase-related protein 2 with the lid in an open conformation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Pancreatic lipase-related protein 2
total genus 125
structure length 435
sequence length 452
chains with identical sequence B
ec nomenclature ec 3.1.1.26: Galactolipase.
pdb deposition date 2007-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00151 Lipase Lipase
A PF01477 PLAT PLAT/LH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.60.20 Mainly Beta Sandwich Lipoxygenase-1 PLAT/LH2 domain 2pvsA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pvsA01
3C45A 3W04A 5JAHA 4WFKA 2YXPX 1T2NA 3E3AA 1J07A 2C7BA 4HZGA 3H2JA 1USWA 4K6KA 1FFCA 4UBOA 2WUEA 1MNAA 1ZOIA 3IVMA 2DHDA 1E66A 2QR5A 1IUNA 2CJPA 5AKYA 4UBMA 3HXKA 4H7EA 4UBLA 5D3KA 4UFOA 3O4JA 3PFCA 1W1IA 2HA4A 2WJ4A 3Q8WA 2B9VA 1F8UA 1TCBA 1ODCA 2XQIA 4KAJA 3VVLA 1M33A 1QOZA 4OB7A 4UHCA 3BWXA 5CW2A 1CUBA 5T4FA 5IH7A 2WSLA 5IVDA 3ESDA 5JANA 4WFIA 1JJBA 5JZSA 2XMBA 5LP1A 5CBKA 2WKWA 5CT9A 1Q84A 2EDAA 3WWCA 2WXUA 1E3QA 1VA4A 2WUDA 4B83A 5AOAA 5JD6A 4H77A 4MXDA 4L72A 4FFVA 4DGQA 3WI7A 2JGFA 5AK6A 2OGTA 2O7RA 5HCUA 4O08A 3O0DA 1ORVA 2WIJA 1P0PA 1LPNA 2QJWA 4EY5A 4N8EA 5AM4A 2YYSA 5ALQA 1EH5A 3ICWA 4FMPA 5ESRA 3O4IA 3BJRA 3H2GA 4J0JA 1WB6A 1B41A 4Q82A 1ZD4A 3QVMA 2X76A 5ALKA 3MVEA 4AO7A 4C4XA 1E8DA 2DQYA 1MT3A 3G0BA 1R9MA 1EA5A 4OYLA 2XB6A 3E4DA 3IDAA 5T4HA 3VVMA 3AZOA 4X85A 3QH4A 4X71A 4DSZA 1E8NA 1EHYA 3E1GA 5ALRA 5AOCA 4FLMA 5ALJA 5AKGA 2HRQA 3O9VA 1FGMA 4G8BA 4WDRA 4B9EA 3WMRA 1WPXA 3WL7A 4CIAA 2VT7A 4AZ0A 4B84A 3RARA 3FOBA 3TEJA 4GWLA 2VJDA 3ESBA 2SBLA 5DYYA 2DHEA 5AP9A 4QA9A 3F9CA 3R3XA 4XIIA 5FKJA 3VXKA 3WWOA 4AZ3A 4L0CA 2WIKA 4PF1A 5CT5A 3VISA 5A7FA 4C88A 3HRHA 5BWCA 2FX5A 3V98A 3FCXA 4QEKA 2XUPA 3C70A 7YASA 2BFNA 5IVHA 1Z68A 1VKHA 1FFBA 1HQDA 1QIHA 1YA8A 3O4HA 5AKIA 4GW3A 3R41A 3IUNA 1CUHA 5AI6A 3W05A 1CUAA 2OAGA 1XLVA 3F98A 1SC9A 2C0QA 5EHXA 3F97A 4AMZA 3UUFA 4BATA 4B85A 4KRXA 5ISMA 3BIWA 5EHQA 3Q0TA 3AILA 4BP8A 1EVQA 2BGRA 3FG4A 2OLEA 4BVKA 2XUFA 3R3YA 5LIPA 4PV7A 1LZLA 5HF8A 3K6KA 1MX9A 1VOTA 1ZI6A 4IH4A 3WK7A 4UBNA 1WOMA 1EDDA 4KAFA 1CUWA 3SWWA 2CKMA 3KWFA 2XQFA 4Y2SA 2V97A 5DTIA 2X5XA 5DNUA 4AO6A 3LCRA 3GA7A 1ISPA 4PSDA 5CXXA 2XI4A 4BP9A 2K2QB 1QGED 4Q3LA 1C7IA 4UUQA 1Y37A 1UK8A 2I3ZA 3FYUC 3BDIA 5LZ5A 5FLKA 5AK5A 5C81A 4Q05A 1QZ3A 3A6ZA 1Y7IA 2V98A 5ALEA 4UHBA 1JMYA 4K5QA 5ALIA 2J4CA 5EHNA 1EDBA 1CEXA 2PBLA 2AJDA 4OD0A 2XUIA 2QS9A 5DNWA 4B0OA 3C6YA 2XLCA 4FLEA 4BCBA 2DHCA 2E3JA 2H7XA 3G9TA 2OGSA 2XQGA 1N8SA 3QZUA 1CUIA 4B6GA 3SK0A 2O2HA 4DNFA 2OCIA 4LXHA 3N2ZB 4G1FA 4EA6A 1LPAB 3IB3A 1PV1A 5K3EA 3HSSA 1H23A 1QIIA 1JMKC 1X2EA 3ESCA 1HL7A 3M3DA 1ZJ5A 5AM0A 1O6GA 2JIDA 1A7UA 1CUUA 2BKLA 3IUMA 4KJXA 3I2KA 3IURA 1WB4A 2RONA 3L1HA 3FG1A 2V96A 5ALUA 1GT6A 4UBKA 5JATA 1JJIA 2VTVA 3G0DA 1UFOA 3H1AA 4HRYA 4Q1VA 2Y6VA 4PSCA 4TPKA 1UWCA 4H7HA 2J4FA 2LIPA 1QO7A 2ZYSA 4A5SA 4GECA 4G9GA 4Q3KA 1CUYA 4ETWA 3V1KA 1JKMA 1CUXA 3FBWA 5K3CA 2WLSA 3BNDA 4S0XA 3PF9A 4BYMA 1ZICA 1XKLA 5BOVA 2X8BA 3V9AA 4EZIA 3QPDA 1AKNA 1DU4A 2WG2A 3GBSA 3TJMA 3GZJA 1GKLA 1LBTA 1GKKA 3G9UA 5HKBA 5DNVA 3OTQA 4I19A 2ACKA 1BE0A 1QIKA 4XWGA 1UOOA 4X6UA 4FDMA 3STYA 1XZFA 3PUIA 5C8XA 1HBJA 1H2XA 1IK3A 3IBTA 2ECFA 2OCGA 5ALHA 5LKAA 1QJ4A 4ARBA 1CUEA 4AB1A 3HACA 2B4KA 4XVCA 3WA6A 2J3DA 1CV2A 2IIVA 3I2IA 1LOXA 2GYUA 3AINA 4J7AA 3WL6A 3WK9A 1VZ3A 2JGMA 2Y1KA 4X3CA 4DNPA 4QLOA 2EDCA 4UHEA 4IO0A 2PU7A 1DX4A 2R11A 1A8SA 5AI0A 1XZGA 4FBLA 1SOMA 2JBWA 4G8CA 4P93A 5AK4A 5FV4A 4AX4A 4BRZA 1AZWA 2GYWA 4OSEA 1MAHA 4U2CA 3C8DA 1YSCA 4DMCA 3PUHA 3FVRA 2P8SA 3I6MA 2WY6A 5ALPA 3STUA 3WZMA 3ZV7A 5K5EA 2IUJA 4MWTA 3D2AA 2BAGA 1NU8A 4W9RA 4HRXA 2HA3A 1U65A 4BZWA 2VJAA 5C7YA 4GBGA 4DTCA 1GPNA 1L7AA 2WU3A 5LKRA 2HA7A 2ROQA 2VATA 2C0PA 3RM3A 3G9XA 1BROA 4HAIA 3R3VA 2H9YA 3DS8A 1ACJA 3OOSA 5AIBA 3A70A 2OGZA 1QIMA 1UT6A 4BC0A 3G8YA 5C8VA 1QO9A 2WHQA 4G4JA 3WYDA 1NX9A 3EIOA 2VEOA 3WKEA 3STTA 3EBLA 4BTVA 1CQWA 2J3QA 4ITVA 2RIPA 1U8EA 5CH5A 3TGLA 2GZSA 2WU4A 3JWEA 4Y2PA 2GBCA 4HXFB 1A88A 4K6HA 2ES4A 4OB8A 1G4HA 1RP1A 3NGMA 4QE3A 4LXIA 4ZI5A 3P2MA 4ZV9A 1DINA 1U4NA 5ALYA 3HABA 3ILSA 4BB0A 2XUDA 3H2HA 5AJHA 2XMZA 4QNNA 3AJAA 3FSGD 4WDQA 2WILA 1CA1A 1N5RA 4FWBA 1THGA 4CG3A 5JIBA 2XUGA 4M0MA 1H2ZA 2OAEA 3S8YA 4QDOA 3H19A 4Z49A 4QWTA 2QMQA 2XMQA 3ZLUA 3QM1A 4UHHA 2JGEA 2GBGA 3LIPA 1XZDA 5CT8A 3ICVA 5ALZA 4YK7A 2JGLA 3DDUA 1ZGCA 5T4EA 1LZKA 4KE7A 4H7JA 4J0HA 2O7VA 4BE4A 5E4JA 3D0KA 1J1IA 4X6XA 5BV7A 4KE6A 1PFQA 4GEGA 1XRNA 3WL8A 2PPLA 2HM7A 1QTRA 4CG1A 2QUAA 3VJKA 4E15A 1UZAA 1YASA 5LZ2A 3BXPA 3C6XA 1CUFA 4GHWA 1BS9A 1UKBA 3HZOA 3IUQA 3D59A 4RGYA 3MUNA 1Q0RA 1FFEA 4J0CA 4J0KA 1G5FA 1CVLA 3WK8A 4AO8A 4ZXFA 4BVJA 3K2IA 2QXTA 1K8QA 1GQRA 3G0IA 3PFBA 4ARAA 4B7ZA 1DWPA 3RLIA 1OLPA 3CCCA 1LPMA 3R0VA 2XT0A 1FGTA 3FG3A 4QDXA 5JD4A 1RWQA 1Y4KA 5AI4A 3ANSA 4C01A 2IITA 1QFSA 4OU4A 5ALDA 1YGEA 1UKCA 4U2GA 2QJRA 5AH0A 3DOHA 2OG1A 1OCEA 2C5GA 4QWMA 5CURA 4YASA 2ZYRA 2WXTA 1TCAA 3KDAA 1MTZA 1Q0ZA 4BCCA 4BE9A 1EI9A 1EINA 1XROA 3FLAA 2XE4A 3A2MA 1EB8A 1N5MA 2VT6A 2WFLA 1LNHA 4HTAA 3SX4A 5HF5A 1CUDA 1HKHA 1XZCA 1WHSA 3WZLA 4HVTA 3DOIA 5AM5A 4K6GA 1XZMA 3MGAA 1ODSA 4M0FA 1CUSA 5HZGA 5JARA 1QIJA 4PSUA 4X7BA 5K3BA 2G5TA 4E46A 4INZA 3DJYA 2OCLA 3KOOA 2Z3ZA 1ZGBA 3LIIA 3B12A 2QOEA 1TAHA 1EK2A 1XZAA 2PUHA 2WFMA 1L7RA 4Y2QA 1QTIA 1XZLA 4QWWA 4W1SA 4EY6A 1XZIA 4WY8A 1MPXA 1VZ2A 2JGIA 1JFRA 1R4ZA 5AK3A 1RRHA 4WFOA 3OURA 3JYHA 3HLKA 1XZKA 5AI5A 1XZEA 5KWJA 1UXOA 1YCDA 1E89A 3C6BA 3KSRA 1UK9A 4DNOA 4B80A 2IX9A 5CT6A 1VXOA 1QIGA 2HU7A 1J06A 5T4BA 5K3FB 1UKAA 5FRDA 4E14A 1H2YA 4KYVA 4BZZA 1AX9A 1ZI9A 3T4UA 4Y2UA 2FNQA 2B61A 1X2BA 2PM8A 4N8DA 1IMJA 1QM6A 3G02A 5LZ4A 1CPYA 3BDVA 4NMWA 1ZIYA 3AZPA 2GBFA 1R9NA 3DKRA 4WHAA 2XUQA 4BAZA 5A7GA 5ALTA 1ZD3A 2XUJA 5CTAA 2AJ8A 3BNEA 4OCZA 3FCYA 3C8HA 1AGYA 3DQZA 3SC2A 4C89A 4UFNA 5JYCA 3D4LA 4JH0A 4L9AA 5KREA 2O2IA 4AMYA 5JZBA 3VKFA 5AKXA 4B82A 3W9BA 4YPVA 1N1MA 4IH1A 1LPSA 1EB9A 3O8YA 5AI8A 4LHEA 1SCIA 5E4YA 4KAAA 2AJCA 3FNBA 1XZHA 2WHPB 1F0NA 4E11A 3I2HA 3ED1A 2PKYX 5E4TA 5CH3A 3X3HA 4X6YA 2ZVDA 2GBIA 1YR2A 4RPCA 3BIXA 4UBJA 5AKKA 2PSJA 3ANTA 3DCNA 3AFIA 2WTNA 2DFPA 1QONA 3FYUA 2PL5A 1UOQA 3D3NA 1GPKA 2WFZA 3V99A 1FGOA 5JADA 5AKLA 1E5TA 2WG1A 5CXUA 3CN9A 2QUBA 4ZV7A 3DEAA 5EIAA 2BUCA 1H2WA 4FNMA 2VF2A 4MEBA 4P92A 4XX1A 5D3ZA 1YAJA 2QRUA 5AO9A 5A2GA 2QKYA 1K5PA 5DLPA 1XRMA 1DT3A 5AM3A 1MO2A 1BEZA 3ZI7A 3FAKA 5E2IA 2XQKA 2WUGA 2HA6A 5IKXA 5AM1A 5IVIA 4EHBA 5FP0A 1F6WA 2HDWA 1WB5A 4J03A 1NO3A 4PQEA 5JAUA 4KR0A 5KBYA 1MX5A 1DWOA 3WWDA 2QXUA 3R40A 1QFMA 2HADA 4V2IA 4ROTA 2XMSA 5AKJA 1XLUA 1XQVA 1IUPA 3VJLA 3WL5A 2I3DA 2JF0A 2FJPA 3GROA 1K63A 3H04A 2PSFA 4BVLA 3O95A 3DL4A 4JEIA 2H7CA 3ZWQA 3ESAA 3I1YA 1HU9A 1GGVA 1XQWA 4GLBA 4H0CA 1BRTA 2G5PA 4Y2VA 4UHFA 3D7RA 2XLBA 4JUIA 4M0EA 1TCCA 5H3HA 1HPLA 1MN6A 2ZYIA 4W1QA 3UMJA 1MAAA 1CUCA 2OQIA 3I6ZA 3D5EA 4OB6A 1YB6A 1S8OA 1C7JA 4N5IX 4UFPA 1AQLA 3OG9A 3EQ8A 4B0PA 3H1BA 2WFLB 1JU4A 1FFDA 2PVSA 4X93A 1LLFA 4N8SA 2WQZA 4ZREA 5I8PA 1ZD2P 1CUGA 4D9JA 3E0XA 1JU3A 5HF6A 1DT5A 1K6EA 1TRHA 3G0CA 4NVRA 2OXEA 3HEAA 1LGYA 2NW6A 3OC0A 4A23A 2FJ0A 1THTA 1YS1X 3STVA 5FOQA 3WJ2A 2VQ6A 4I3FA 3DYVA 4CCYB 2D5LA 2BCEA 4K2AA 2IUKA 4HXEB 4KE8A 5LLSA 5AKHA 5EFZA 2D0DA 3PI6A 2PX6A 1P0QA 1BCRA 3QYJA 1VLQA 1GXSA 1OXMA 1QIDA 1BN7A 5JD5A 3HJUA 3R3ZA 4FBMA 3D2CA 4CIBA 1XQYA 1EXWA 5AICA 4W1RA 5FPQA 3H17A 1GQSA 4G9EA 3DYIA 1Q83A 5LZ8A 4U2BA 3WYNA 1R50A 4QLAA 1CUZA 1JJFA 4AN1A 4EY8A 1ZD5A 2XMDA 3YASA 3V1LA 3AIMA 3N0TA 1TK3A 1G42A 1IZ8A 1A8UA 4AXBA 4EBBA 4NS4A 4CG2A 2QVBA 4RNCA 3PICA 5FDFA 5ALFA 3HC7A 4EY4A 5AHXA 1MJ5A 3H0CA 1XRQA 3IULA 5A62A 2WTMA 3I2GA 3L1JA 2XMGA 3KWJA 5BWBA 4X95A 1XRLA 5LZ7A 2Y6UA 2WIGA 2HA2A 5FUMA 4FLFA 4WCVA 2DQZA 3R3WA 4BC1A 2DSNA 2ZYHA 4J0GA 2WG0A 1YB7A 4DMFA 4QDTA 3BL8A 3EQ9A 2RI6A 3ZPXA 5AIAA 1RRLA 2Z5GA 3WKAA 3I1IA 3BF8A 1ORWA 5JAOA 4ZGBA 1CRLA 4F21A 5A7HA 2HHAA 1ZI8A 1YS2X 4P9NA 5HK8A 3STXA 1C4XA 3W2TA 3WK4A 2FUKA 2WHRA 3DD5A 4PO3X 5AKEA 4G4IA 3S2ZA 2VSQA 3WIOA 3CXUA 3F67A 4OU5A 5JZ9A 1CLEA 1UOPA 2HU8A 4N5HX 2Z3WA 4BRSA 2WM2A 4F60A 2W6CX 3BF7A 3QMVA 3C5WP 3U1TA 3UUEA 2ZSIA 2QT9A 1LNSA 5ALNA 3FYUB 4KEAA 3QITA 4YX9A 4DMHA 1HDEA 4JYPA 5ALMA 2CB9A 4FKBA 4HS9A 2HL6A 2CBGA 4W1PA 3WKBA 4X91A 1FGRA 2P0MA 4I4CA 4LIPD 3BNCA 3OPMA 3TRDA 1UK6A 4G8DA 2W22A 1XZJA 1QIEA 5KWIA 4Q34A 1XQXA 2G4LA 5DJ5A 5J3JA 1ACLA 2ORYA 4EUSA 3WQHA 2HFKA 4H7DA 1FFAA 5HF9A 1KU0A 5CRIA 5EEOA 1VXRA 2HIHA 4W63A 4Q3OA 3BNBA 4RE6A 1QIFA 1WM1A 1SFRA 1W75A 1KU6A 4EB0A 1R3DA 3JW8A 2ZJFA 4DIUA 1FGQA 2I03A 2CUTA 3LP5A 1AMNA 4UPDA 5AI9A 3WK6A 5A71A 2XUKA 4AQDA 2H1IA 1PJAA 2CEKA 2H7YA 5I9IA 1KEZA 5D7BA 4EY7A 2Y2UA 1P0IA 4MQMA 5IVKA 4KRYA 2C4HA 5AOBA 5DYWA 2Z8ZA 1H22A 4G4GA 1XRRA 4X97A 4Y2JA 3W06A 3A2NA 4LYEA 5JALA 1E8MA 3VJMA 5DTJA 4GDMA 4NZZA 3IA2A 3QMWA 1TQHA 4WFJA 4H18A 2Q0XA 4ZRDA 4CCWA 2HFJA 1R1DA 4H7KA 3PE6A 2XMRA 1OILA 2WIDA 5EIEA 1LPOA 5K3DA 3D2BA 4H35A 4TVKA 4WY5A 4C4YA 5HQ3B 5CMLA 3AZQA 5A6VA 3WKCA 3V1MA 1U2EA 4Y7DA 2HRRA 3VDXA 1JI3A 4IQ4A 2C5FA 2XMCA 5SYNA 4P08A 2XQJA 3DKKA 2CMFA 2WHPA 2OCKA 4Y9SA 1TIBA 3FLEA 2Z8XA 1EX9A 4Y2RA 1GPLA 2GYVA 3WK5A 4GXNA 3HYSA 2XDWA 1VA5A 1SCKA 2JGKA 5EIHA 5CH8A 4ZWNA 1VJ5A 1X70A 4MWSA 2PSDA 4J3JA 5F4ZA 1GZ7A 1FJ2A 4BAGA 2BUBA 3ZLTA 4DSAA 4B81A 1QLWA 3NWOA 4QDZA 3G0GA 3G7NA 1XLWA 5HFNA 5YASA 1WPRA 5JASA 3VF1A 2XUHA 1L7QA 3K9BA 4CCYA 5I7UA 1F8NA 4MYSA 1W76A 2YH2A 4MEAA 5SYMA 2VA9A 4HXGA 2ACEA 5ALSA 1IZ7A 3EF3A 1QMDA 3LLCA 2VAXA 3IIIA 3C43A 3WIBA 2HU5A 3W9UA 1DQZA 2AJBA 4IHAA 4Y2XA 1ETHA 3DLTA 3F96A 5FPPA 3KD2A 1A8QA 4BDSA 3DNMA 3MUOA 5FXMA 1CUVA 4QZVA 2CZQA 1LPBB 2BGNA 4B9AA 4F5ZA 3L1IA 1N8QA 3G9ZA 3ZLVA 2WUFA 2JGJA 4AN0A 4BTLA 5K3AA 1XFDA 1CR6A 4H7FA 1DWQA 3F8SA 1KHOA 4JNCA 4U2FA 2QM0A 3C5VA 1UK7A 1DX6A 2WJ3A 2AJLI 1WHTA 5ALWA 5LZ9A 2G63A 1XKTA 4H7IA 1D07A 4PW0A 3CN7A 3FVTA 2BJHA 4J0IA 4DM7A 3FLBA 4BDTA 5EHZA 4PNZA 4X92A 2GZRA 2AXEA 4IH9A 4MYDA 4FNGA 2R8BA 3H2IA 2PU5A 3GELA 4DNQA 1EDEA 1K4YA 2QTBA 3O9MA 4G5XA 3V92A 4DMKA 1ODTC 2RGUA 1JNQA 1NU6A 4BCDA 4FOLA 1LPPA 3M81A 3M83A 3I2JA 1TKRA 2I78A 4A16A 4NREA 3T52A 1IVYA 1AUOA 3KXPA 1F0PA 3RK4A 3WWEA 1CUJA 4WJLA 3AUKA 5HK9A 3H2KA 5ALLA 5ALXA 2ZSHA 3DL7A 3OM8A 1DQYA 3NUZA 4DLNA 4KE9A 4BAUA 3I2FA 2OPHA 3U0VA 2YASA 1VE6A 3C6ZA 4DYHA 3PF8A 1ZIXA 4UHDA 3WLAA 5LYYA 2DR0A 5HKAA 1I6WA 4FFWA 1BEEA 2C58A 2HA5A 4KACA 5ALGA 4CFSA 1B6GA 1XRPA 4XJVA 1W6RA 3BE8A 1WCYA 4RE5A 1MU0A 5K3FA 4F0JA 3BJMA 5EI5A 3RKSA 1IUOA 4UBIA 1R88A 3FWHA 4OYYA 2ONCA 3V1NA 3I6YA 2EEPA 3PZWA 2UZ0A 4X90A 3STWA 2PSEA 4MJ3A 1O6FA 1J2EA 2RAUA 3QBJA 1MNQA 4Y2YA 2JEYA 1BCSA 1HLGA 4L3WA 4FHZA 3V48A 1CFJA 2VJBA 2DCMA 2BUAA 2PSHA 2QZPA 1YA4A 4J0DA 1T4MA 2VJCA 1AC5A 3GFFA 4U2EA 5AM2A 5JAPA 2WIFA 3M82A 4GI1A 1CIJA 2RHWA 3B3QA 3H18A 1BU8A 1SCQA 5HQ3A 3CWZB 1CQZA 4C6HA 1EVEA 2XUOA 4LKOA 4X94A 1QE3A 1G66A 4U2DA 3QMMA 1YAHA 1P0MA 1XZBA 4OUKX 1W52X 3WA7A 2HA0A 4OPMA 5HFAA 3A2LA 3GUUA 1EK1A 5AKZA 1W4LA 3NOXA 4BBZA 1LBSA 1VE7A 5CT4A 4Y2TA 3CCBA 3O4GA 1Y7HA 3EQ7A 3WJ1A 1FSSA 2B20A 5DYTA 3FYTA 2ZJ6A 4C87A 3WWPA 1RYYA 5C8ZA 3IUJA 1MX1A 2JEZA 3QPCA 1BN6A 2WJ6A 1DTEA 3B5EA 3FSGA 4C4ZA 1GYGA 4QDUA 5EGNA 5DWDA 4CI9A 1ROVA 2XUAA 4FTWA 3AIOA 4MQLA 3I28A 4TGLA 2VAVA 1ZJ4A 4X00A 3QPAA 1JT2A 4LXGA 5ALVA 2V9ZA 4JYMA 3WKDA 6YASA 5ALOA 3PDCA 2RHTA 3LS2A 3AIKA 2PUJA 2Y2VA 3HI4A 4LYDA 2OQVA 1AURA 2O2GA 2ZJ7A 3R3UA 3C87A 5D6OA
chains in the Genus database with same CATH superfamily
4IXDA 3W04A 1AK1A 2X4IA 3B6JA 3EOBI 4C2UA 4DY6A 1KDZA 5BYBA 4UNQA 4JC8A 1SBZA 3DNPA 1UEJA 5E2AA 3WLRA 5DIFA 3FF1A 5B1HA 2G72A 3GJ8A 3GLTA 1J07A 1KJ9A 4AUKA 4MW0A 3EVDA 5PGMA 1II8A 1G7TA 4PHCA 3DT9A 3O8LA 4JITA 3SHVA 2ZZMA 3KR0A 1WZCA 3JQ9C 3P2EA 4NBUA 3IAM6 3NJ4A 4WQMA 4IGKA 4KXNA 5JVDB 4E22A 1MMFB 3R5XA 4IV5A 4L95C 1GL7A 2AFHE 2A59A 1MG0A 2AT1A 1MJGA 4N0QA 1E66A 2PX3A 1Q7CA 3V00A 3LW8A 4FCWA 5AKYA 3AI2A 3W7VA 3AKYA 4QUEA 1KYYA 1S4MA 1P9OA 4RY8A 3FLMA 4H7EA 3LP6A 4JUCA 1M8KA 3G17A 3I8SA 5D3KA 3JCZA 2WJZB 3O4JA 3H8SA 3QELB 4PLVA 3MAGA 4JQYA 4MUIA 3Q8WA 2VC2B 3CF4A 4GDFA 2B9VA 2DWPA 3IPCA 1F8UA 1NWHA 3CB4A 3S0JA 1SN7A 1OZFA 1VTKA 2EX1A 4DCVA 2LBPA 2R5WA 2W00A 5JR3A 2ZSEA 4A3SA 1Y1SA 4A26A 1SXJD 2X40A 1ODCA 3VAZA 1KDRA 3LVFO 1OD6A 4AJPA 5LP6B 1QOZA 4MDFA 2AE2A 3DCIA 1YRQA 2FOLA 3NAGA 1REQA 1WY7A 1L4KA 2OOKA 3MWEA 1BMDA 2JANA 2OGUA 1Y89A 3ZE2B 4JUAA 2YWFA 2NNLD 2FSIA 2RHMA 1GLGA 1TVEA 3NEAA 2WSLA 1LI5A 4U4AA 4UREA 1QYVA 2WMYA 1SCJA 5JANA 1DP4A 1RBYA 2GEDA 2SNIE 2X5KO 2BEUB 2FA9A 2XIQA 5H83A 3SP1A 4Q1EA 2GLTA 3WDLA 1JJBA 4BFUA 4F2WA 4RAQA 2H1OA 4MS3B 5CU7A 4KHPB 2NTEA 5LP1A 4MHOA 4ZANA 1NURA 1IPFA 2ZIGA 3JTMA 3L7MA 2PKQP 3PWKA 4UCWA 3MCZA 3ZNPA 1MDBA 4KXXA 4E6EA 4EY3A 2B8TA 3O91A 4F4CA 3REOA 3WWCA 1U5CA 1DDGA 2ZBDA 1T43A 1VSUA 4KTVE 1BD3A 4B83A 3K5PA 1Q5PA 4EF5A 2UZ3A 3RYHA 4EPVA 1K7YA 4LOAA 1L7EA 5I8ZA 2PUTA 1UADA 4OH7A 1WV1A 2CXSA 3KE8A 5C8YA 1X42A 3VR3A 4E08A 4PX5A 1NXTA 3WBJA 3ZTTA 5LWHA 2GILA 5AHOA 3N7UA 4V0KA 2OBNA 3BB4A 4B31A 3ESRA 1ZDMA 2YQ4A 3FRHA 2VNKA 1DFGA 2D0OB 3FUWA 4LS3A 1XXLA 3RAGA 3O0DA 4BMYA 2RFLA 2B6HA 3B3FA 3LUCA 1ORVA 3CEHA 2OK8A 4QTXA 3HJBA 1P0PA 3PXEA 1TTTA 2QJWA 3BILA 4G1CA 5CYOA 3W5JA 2JK1A 3QVXA 1QQBA 5AUQA 1XJCA 4IVRA 1R74A 1Z47A 2WKRA 4KFSA 3JY6A 5AM4A 5TGZA 5B6PA 5F9HA 2V7EA 4LF8B 1E64A 2LVBA 4FMPA 4JLSA 2VYFA 2HQRA 4HUTA 4DUPA 4OHBA 4TKMA 3BJRA 2QIPA 3H2GA 1WB6A 4WFQA 3SGLA 4OJKA 3C1OA 4EJ0A 4YY3B 1QNLA 5J1SB 4QVIA 1RLUA 2FG5A 1YMQA 1DG3A 3ZBTA 3F9RA 4BNHA 2Q1UA 1N4DA 1ULTA 2X76A 3LT4A 3TW0A 4JK3A 2B37A 4LE0A 5DPMA 1EU1A 3RIXA 3SZGA 1GZ3A 3K4HA 1Y5RA 2Y1LA 3VHLB 1RYDA 3LYUA 4YJKA 4C4XA 1Q1ZA 2CL0X 5LQRA 3AY7A 3HS3A 1IU9A 2IYNA 2LDBA 4BMXA 3N28A 4IHJB 4QGGA 5DDIP 5CA1B 4CZ2A 2UXBB 1T3HA 1XNHA 3JQ9A 4GMGA 2OO7A 2QTFA 1H05A 3QU4A 4KQ2A 4X60A 3FFWA 2J1LA 2X77A 5DMHA 3D3WB 4AY5A 1P3Y1 4GI3A 3AZOA 1PDWA 3OU2A 2GDJA 2YMQA 3BHJA 4A4DA 4OHUA 4U7JA 3TJRA 1V1RB 1N6IA 3OTIA 4NMMA 4EJSB 1NHGA 1GRVA 1UOEA 1ECGA 2J9GA 3PD1A 4FZRA 3QVOA 8AT1A 2DPLA 2GCOB 1IH8A 1JL3A 5AOCA 5LBIA 2EOAA 1AHIA 1RXSA 1UBKS 2ASVA 2JIZA 2Q4TA 3FNIA 5ALJA 2X1HA 5AKGA 5LM3A 1U99A 1N3BA 2JA1A 5HJ2A 3TIVA 5F5NA 2VDWA 3CVUA 3O9VA 4S1TA 2FN7A 1L9KA 5EP1A 4NEGA 4G8BA 2AYZA 2HO4A 4KQ9A 3QOFA 3VPXA 3EPJA 2KJQA 2AOUA 5H3LA 1RT9A 4B9EA 3OHMA 4AN4A 2PUCA 1NUAA 4BO2A 1FA9A 1XZQA 1Q0UA 4OMFG 3GPCA 4GOJA 4CIAA 1QRTA 2E89A 2VT7A 3DZDA 4P5PA 4NJMB 2X0JA 2YWEA 3C3KA 5FTLA 2YKGA 3U60B 2V5UA 2D4AA 3S7ZA 2IDMA 4XQGA 3TEJA 1JHAA 4U7HA 1TQDA 1VL8A 4KK4A 2ZIEA 2D1YA 3ESBA 5DYYA 2D6FA 3A26A 3NHPA 5A6SA 4O33A 1B74A 1L3IA 1WXQA 2DHEA 1ABBA 1BWQA 4MPTA 1Y3FE 3R3XA 4XIIA 3ZU4A 2E82A 2JHCA 4PF1A 1U9JA 5A7FA 3VISA 1WB9A 1KH2A 1KMIY 3BDAA 4L8GA 4GI7A 2B82A 4ND7A 1W88B 3MRXA 4MW9A 3C5EA 2P6RA 4OY3A 3FDIA 4CQMD 4W6QA 1Y82A 3TSOA 2FPIB 2GEJA 3H1GA 2PY6A 3ESZA 2PQ6A 3F5SA 5DHAA 5BVGB 2BC9A 2D59A 4EECA 4QEKA 1KMCA 3SZRA 3WNBA 721PA 5L3QB 2RE8A 1ZWKA 1A50B 4G0MA 1S5PA 4F7WA 2DY1A 3C70A 1C7QA 3P9PA 4IQ8A 1OIXA 4KQCA 5K6TA 3G1TA 4IMIB 1JILA 4DQLA 1W581 2ZWAA 3TOXA 1VKHA 3UMGA 1KRXA 3UQZA 4AROA 3U39A 3O21A 2UUBB 1JTVA 1QIHA 3AQIA 2XTAA 3QEMA 3O4HA 3GQBB 5AKIA 5IMSA 1Y6FA 3ZUPA 2Q6IA 2R4QA 3R41A 3CLVA 3IUNA 5EMJA 4IW3B 5CR9A 4LY3A 2CB0A 4EMTA 2IL1A 4QNMA 2DUNA 1G21B 2B4RO 1F8GA 2P8JA 1XLVA 1X7YA 2PBFA 3DGFC 4KYIB 3BWYA 1K8YB 2C96A 2VLIA 1DSSG 2BDEA 2Z3VA 2F55A 3QJGA 3IO5A 2QZZA 1YR7A 3SFTA 2YXDA 1XTSA 4JXKA 4AMZA 4UD6A 4AU1A 1CIVA 4ZVSA 1E7WA 2EZ4A 4YLEA 5FCDA 5TPZA 3QWAA 1TKAA 4YRPA 1T6BY 4QODA 1U7WA 3NBQA 5FIUA 1W5AA 2HXGA 3CW9A 3L8MA 3DHNA 1ZS9A 3IDFA 4IZIA 5CB8A 4ND3A 1KIMA 1M6NA 3FBGA 3FG4A 5A4JA 3Q3JB 4JFRA 3R3YA 5LIPA 1YBHA 2QHXA 4PV7A 4DC0A 4KU4A 3ZD9A 4EL5A 3NWEA 1NSYA 1DRJA 4YMHA 3MRVA 1XMVA 2HF2A 2BGLA 3K6KA 4PBSA 1VJ1A 1MX9A 3D6MA 4F6CA 2VOJA 3V4FA 4RIGA 5AW1A 1QVWA 1ZI6A 2ZB3A 4IH4A 3SR4A 2QAIA 3CJRA 5TPWA 1E99A 3WK7A 1HDOA 1X7DA 3BWMA 1JAIA 3DMDA 4HX5A 4NONA 1Z8FA 4QUIA 1WOMA 3EXHC 1EDDA 2WEKA 3GWZA 1BFKA 3O1JC 3T5BA 9ATCA 1G64A 1U0NA 2QYSA 3AEKA 3CF2A 2WKPA 5B3LA 4MUKA 2IH2A 2UZ1B 3JQ7B 3TVYA 4GS5A 1J97A 3V3TA 1T15A 5HMMA 4WZBB 2GX6A 3EZGA 1U5AA 4L5AA 5HM6A 4DW8A 3HB0A 2ZRMA 1U7TA 3OWOA 4PZYA 2GDZA 3RYCA 3WYCA 3MINB 3A4LA 4D8WA 5EIXA 3ROQA 4K0KB 5DNUA 1BVHA 1XZ8A 5CGQB 4J76A 3PPXA 4Z4HA 3OF5A 2V9PA 3LCRA 2BZGA 1E5VA 3CLUC 4BQRA 3EPRA 3QSYA 1P4JA 2DR2A 1ISPA 1E6CA 3CVWA 3Q8KA 1Z08A 3P4XA 3T7TA 4IRUB 2OAP1 3DEYX 2PT5A 1PGNA 3KKQA 4CRWB 1GNRA 1MB4A 2DPGA 2HDOA 3U3XA 4BP9A 2BF7A 4C14A 3I5AA 1T1GA 4R7GA 3CW8X 3E7FA 1HE8B 1QGED 2AEMA 3NWPA 4ZAVA 4XEHA 1NKTA 3AUFA 4Q3LA 1C7IA 5FF9A 4OEHA 3RKUA 4ALNA 2XXAA 1CF4A 4Q00A 2ACWA 3SJCA 2I3ZA 4BLSA 1TA0A 1Y1LA 1R4MB 1H8EA 2F43A 2R25B 1K8RA 1W30A 1XDGA 1J2RA 3I09A 2WAXA 3O3OB 5FLKA 5BN5B 4BMNA 3T3NA 3LQFA 2ZTMA 4X54A 2IKQA 5F7JA 1QZTA 1W0KA 1ILEA 3TQCA 3CYFA 4F6RA 1R9GA 1NI4B 1ZMOA 1D0SA 1KK1A 3D31A 4NFYA 1O8BA 5KQRA 4PLWA 2YC2C 1G2IA 1JQAA 3Q2IA 1P3DA 2DBYA 2A5FA 2PBLA 2FSHA 2AJDA 2NTYC 4FCCA 2AQ8A 4PTZA 1L7PA 2E1PA 3JD3A 4C5CA 4MV0A 2G9VA 1H6DA 2XUIA 1DC4A 3QVTA 4O2RA 4B0OA 1OLUA 2VYCA 2WK1A 5CG2A 3BH6A 3HNRA 3LUKA 4JNKA 1JSRA 2PO7A 3Q85A 1E7YA 2DHCA 2E3JA 5B37A 3SIRA 2GNPA 1W9HA 4AM8A 3H4IA 1N8SA 1CD5A 3W5BA 3IEKA 1YCHA 2J08A 3VO8A 3SNHA 2Z6UA 1D0VA 2RH8A 3TW8B 2YV4A 4RKEA 4AIIA 1P1CA 2P67A 4WEOA 4B6GA 4F9GA 5A5EA 5CEEA 4RZSA 4UMFA 4N03A 3IAS6 3EF1A 2B9EA 1M83A 2COUA 2IVZA 3SK0A 3VKUA 2OCIA 4DNFA 3C24A 5EE5B 4BTEA 2EFCB 3A6LA 4G1FA 4O29A 1ULSA 1YFJA 2KSQA 1OBFO 4A15A 4CDNA 4DSOA 1E5XA 2JJMA 1H5QA 5K3EA 4K9DA 1BAPA 4C3OB 1KKUA 2HCTA 4DV3B 1JMKC 1N5DA 4FFDA 1X2EA 2WYHA 2LGEA 1GEGA 4M7OA 5DM70 1HL7A 4CEIB 4EGQA 2I2DA 3M3DA 3TAHA 1CJCA 1U0GA 1SEPA 3U7FB 2BFMA 4A0GA 2I65A 4D82A 2B1JA 5BSKA 2D0PB 2P2ZA 1CUUA 4RFSB 4GQIA 3SM3A 4TTJA 5K0EA 5LUAA 2JAQA 5KJFA 2EAUA 1ZKDA 1U2SA 3PQ6A 5G1OA 2RONA 1XTVA 1KRWA 3FG1A 3BWBA 4UEOA 1MEEA 2FSGA 3ZS8A 4RMNA 5JATA 1Q74A 1XKXA 3ABZA 2BFBB 1RQPA 5CUQA 2VTVA 3DF9A 1YB4A 1XMIA 2R1ZA 1NJGA 2X22A 1OT3A 1T25A 3K2EA 4GH5A 1Z0KA 2Y6VA 3C48A 4GMFA 5F9FA 1IVNA 1A5AB 2REBA 3LKDA 1AXGA 1G3IA 2YBEA 4O59O 3HCOA 2VF7A 5HIKA 3PX7A 1DAPA 4E2XA 5DOVA 2J4FA 1IM5A 3DV9A 3UHFA 3RHZA 5D01A 3GARA 3SJUA 1L4FA 4Z99A 3BTOA 1PIWA 4FFMA 4A2CA 3LO5A 4FQ8A 4KGVA 2A14A 4DLBA 5FWYA 1N8TA 1A7JA 2VDNB 3EXEB 3H6KA 3OIGA 1G1AA 3M49A 4P80A 3CRVA 4G9GA 3EISA 4QJ4A 5FJJA 5HBGA 4LMAA 4RXMA 5AW7A 5HIAA 1VSBA 2P4HX 5F78A 2OZKA 2NO9A 1YA6A 4B3XA 4IIUA 1VP3A 2OD9A 1EUQA 3M6XA 2IV2X 3H0EA 4FYJA 5ECGC 3WLQA 2QLMA 1N0HA 1DHTA 1TMYA 3LFTA 1NPDA 1QWSA 1YR1A 1N0IA 3EEFA 4OG2A 1T4BA 2VNHA 1ZK1A 1JQBA 2GO1A 5FB3A 4F3CA 4BYMA 2X0FA 1RXCA 1ZICA 3OU6A 3E05A 4OTZA 3LX5A 4EZIA 5LDGA 4TWJA 1P29A 3UFXA 1MC8A 3GBSA 3FPKA 3QX8A 3TJMA 3MG9A 4CI9A 5JJLA 1YUMA 2CF6A 4LRTB 1GKLA 4TWZA 1LBTA 1B2RA 1YXMA 3TJZA 1H66A 1MC1A 1CY7A 1GGHA 1ESEA 3MQ2A 5L53A 2ACKA 5JJKA 1ISIA 1RAHA 1OLXB 3RTGA 3ZQKA 3C87A 3PDIB 2PH1A 4XWGA 1FPQA 5F2EA 1BXRA 1ZCFA 3K05A 4PO8A 1AN0A 4MR9B 2Q8QA 1UPFA 2XE7A 2B1QA 1BJKA 3KBBA 3L0SA 1T1EA 3S28A 1EFVB 3STYA 3W5IA 2O8FB 3PUIA 3KS9A 5IC6A 2ADFA 3L7BA 5BN4B 1AV7A 3PHIA 2FEXA 3HMKA 4J1NA 4U6SA 2ECFA 3IEMA 2F3QA 1QJ4A 2CLKB 4FKZA 2Q5CA 4ARBA 2I8AA 1Z5VA 3CX8A 4KQJA 4BVGA 4I9HA 4ZRNA 4GYYA 4TMTA 4CV0A 3HACA 2OHGA 2B4KA 2J0VA 5KAMA 2GXSA 3PDJA 5P21A 3OAAD 5DGHA 1YZGA 2GUGA 5K05A 3VNRA 3OLVA 1DKQA 1A82A 4I3GA 2ACVA 2PQ0A 3HCFA 4U0JA 5ULLA 3S55A 2E48A 1LOXA 2F3UA 3AUUA 4HDRB 3WL6A 1ZP6A 1Z2EA 1EUCB 1DOZA 3ET4A 3AEYA 5JCOC 4CGYA 2R2GA 5TT0A 4I6JA 2JGMA 2NU8A 4JY7A 3HSYA 1S2LA 3AV0B 4HQ0A 1G8FA 5I7SA 1HFEL 2VPIA 4DJTA 1JR6A 2Z58A 2HJ9A 2YVLA 4DNPA 4DG5A 1GQ2A 4MR8A 4UHEA 1ZK0A 2CLLB 4GEKA 2JLSA 2AZMA 3O03A 4PQGA 4LJ7A 3BD6A 4B74A 3LC2O 3NHRA 3ORFA 4RA6A 4K87A 3JARA 1SOVA 2CD9A 1EJ2A 3UB2A 1KH3A 3BE5A 1WNFA 1HQYE 5AI0A 4EB6B 2VJMA 4CLDA 3HBJA 4EPRA 1KYXA 4ZA2A 2VDOB 3H5NA 2DULA 2OV6A 2Y27A 2JBWA 3ILYA 5IZ4A 3QTLA 4PZAA 4U1RA 4TYQA 5EXEA 8ADHA 3IO3A 1N77A 4UDXX 2ZBFA 5FV4A 3NOVA 5AJUA 1Y3CE 3V1YA 1A7KA 1IN4A 3FUCA 3C15C 2ATXA 2Y68A 4FOOA 5B1DA 1MO4A 1OV6A 5J2TB 2AFIA 3A6GA 3U81A 5K3OA 2YJNA 2C2KA 1GJRA 3IEIA 3TRHA 1SBNE 4RDIA 4M1TA 2ZRKA 4E31A 4F5YA 4UTOA 2ZTLA 1DO8A 3NEPX 1AZWA 4JSTA 5B6IA 2WWGA 3JS5A 2RHBA 2YUTA 4K9NA 4MNTA 4P7JA 2O3SA 7REQB 5K45A 4F2HA 2ZJ0A 1C1YA 5LA6A 1W36D 3RASA 3GRUA 4L85A 2QR3A 2QD3A 2V9CA 2WYOA 3HDYA 5EXSA 4FB5A 2C8JA 5K6AA 2W8BB 2WHYA 1JAHA 4OQ4A 2FX3A 3I6MA 4TRJA 5D3QA 5K4AA 2X0DA 4ZI2A 2ZE6A 4Q01A 2WY6A 4U9UA 2I1LA 5D00A 3DBLB 5DIZA 2WF8A 5THXA 5D85A 1CYEA 1DRKA 1WMAA 3WZMA 4MWTA 2WM8A 3G8BA 6AT1A 2RGWA 3QXXA 2E5LB 3AESA 4C5BA 1VJRA 2FU5C 1W59A 3MMNA 2FPPB 3TVTA 3DXYA 3RJTA 4BV8A 1L2TA 4HRXA 5AVZA 2HA3A 1TLTA 2PS0A 4W9MC 3A1WA 3NT2A 2VJAA 1ZBDA 5HCIA 1W44A 4DCTA 7AT1A 1N2EA 3U1VA 3OUUA 4DDMA 1HDCA 3EA0A 1XL0A 3JPYA 4RZ2A 5DM2A 1SUPA 4ALIA 1KAEA 5KNDA 1SXPA 1SOUA 4F92B 3PYMA 1JDUA 1TB4A 3K6RA 4L7QA 3ORSA 4RD4A 3ZHBA 5IJ9A 2UYHA 1QVAA 4NRDA 1BROA 3UJDA 3KHKA 1XE3A 1E9AA 4HAIA 5DBIA 4EHJA 4N1AA 4PG5A 1V5EA 2RCNA 3IIKA 3HEBA 4ZC8A 3RS4A 3N3AC 4ZVLA 3UMFA 3QE9Y 3FPGA 5ED4A 1I9GA 3FDZB 4EZBA 5DTEA 3WZ2A 1DJPA 2WINI 1YZTA 3ZWXA 4NJOA 4MGIR 4Q3AA 5BMOA 2BDTA 3W5VA 5JCXA 3A70A 3IA7A 5CDFE 1QKKA 1ZVQA 4I1PA 2YZGA 4LYYA 4YT2A 3LPDA 4BNDB 3T9BA 3AUJB 3GVCA 1SB8A 3HU1A 4M54A 1QIMA 2PD4A 3HBMA 2PFKA 5HA5A 3UUWA 3T1TA 2GEUA 2H7VA 4P35A 4MUMA 5C8VA 1PNVA 3EXG2 4CMEC 3AMVA 2UAGA 1NHWA 3MGKA 4WCFA 2XKAA 2XGMA 3HBLA 2O5VA 3CLSC 1QH1A 2FPXA 3NALA 4EW1A 1C7ZA 1T3SA 2ID7A 1Y5LA 1G0OA 2Y0BA 4IUCS 4ZZ2A 1OKKA 3BXEA 4C76A 1NX9A 4LBVA 2GRAA 1FL9A 4Z6KA 3DE5X 3LK6A 2CNWD 3A6DA 3RUEA 1VHJA 3A9CA 4WY2A 3OICA 5K1ZA 5K8JB 4N76A 4IXNA 4E5PA 1DDOA 2YOGA 3FR8A 2J3QA 3OHSX 1QDLB 2M6RA 2BP7A 2ZRAA 3TZLA 1DBRA 1K66A 1T4DA 1GV0A 1HY3A 4XIGS 2YINC 3KOMA 7MDHA 1WXIA 3ONNA 3VO1A 1MFPA 3OX3A 2QAGA 3JWEA 2PKCA 2CUNA 2G88A 3EVCA 1HT3A 2LIVA 1EESA 3R9KA 1CE8A 4Q02A 3ZV4A 5BSMA 4REQB 5EHGA 2VAPA 1G4HA 2ZJ1A 3HE3A 1V8BA 3MUEA 1R37A 2FP4A 2PR7A 3BUSA 4IHKA 5AK6A 3WV5A 1SHTX 3PKJA 4RWEA 4AJ1A 4F5DA 3AQ4A 5AD1A 1GVNB 1MO5A 4BNNA 2WIBA 3JAWB 3ESYA 4G0ZA 1UUFA 2IBTA 2PXCA 4NE7A 1EHCA 2V7WA 1XTRA 4EARA 2PFSA 3VPHA 1KAMA 1IBKB 1OYOA 2BBWA 1ZINA 2H3EA 4H6WA 5B58T 1F2VA 3ILSA 4M9SA 5ALYA 3WQRA 1TRKA 4BFYA 3MMPA 4HNGA 3GCXA 4BE7B 2DBZA 3QTBA 4AZVA 1X7WA 1DXHA 1OASA 4OP3A 2Q6TA 1QO0D 2PUVA 2ALJA 4MKFA 2VXBA 1OY1A 1P2SA 4WDQA 5TDHA 1PJ8A 1ZL2A 5JMPA 1CA1A 4FWBA 2C7OA 1NBMD 3P9XA 1G20A 1QTNA 2C2MA 2JKVA 4ECAA 2GESA 2CLEB 4M0MA 4O4LB 3UT5A 4HLQB 1GTG1 1H2ZA 2AF4C 2I67A 2ZSJA 3JR3A 3K0AA 3NP7A 4BOYA 2CLCX 4QDOA 1JDZA 1KK2A 2VAWA 3HV0A 1DKNA 1MDFA 3ZLUA 1KP2A 3P0HA 3NOOA 3MT9A 3O6VA 9LDBA 2SICE 1NOIA 1UZUA 1QLHA 2EEZA 2FZCA 1TTHA 2Z9CA 4ZOCA 2EP7A 1XZDA 1NNI1 4WZAB 2HIMA 4QUKA 4UDNA 5FV7A 1NJ5A 1P5JA 2PMEA 4AZ0B 4BFZA 1R4NB 4GR5A 4G0NA 4MW2A 1SQSA 3QLJA 2AW5A 4KSYA 2ZP1A 5T4EA 1Q7RA 2V65A 4XB6B 1KNXA 1LZKA 3DXZA 1SXJE 4KE7A 5BR8B 3ZIAA 4EYEA 2PWZA 5DRTA 3G2HA 3GR6A 1W4ZA 4ID9A 3R4CA 4EL0A 2HYDA 2I7CA 2FPGB 3ZX4A 1CEYA 1C0EA 2F8MA 2WABA 3RHSA 4NPCA 1XRNA 2IV7A 4KBGA 4I8IA 3T0FA 1OW3B 1Z33A 2FKNA 3N1UA 4AY2A 4E15A 3WY9A 2B94A 3ZNNA 5DYNA 1YASA 3IT3A 5EUQB 4J1TA 1O0BA 4HN9A 1CUFA 1GNSA 4GHWA 4WUVA 3PHHA 3ZWAA 3ZDAA 3EXHB 3DHEA 4XPIB 2IDZA 3A3KA 1J33A 1FFEA 2J0UA 3B1VA 3FGOA 1BHJA 2GUWA 1G5FA 2ZB4A 1SU6A 3ANNA 3O1IC 4J0KA 4K86A 3MF4A 1P45A 2WOJA 3LSTA 4XYEA 3DZHA 4ZXFA 4RH1A 2B78A 1N3LA 1ZOSA 5KSZA 2HCFA 4E07A 1RJDA 2QW8A 5BWOA 1ISRA 2IQIA 2NO6A 4KNYA 2VDQB 3WRYC 1K8QA 3K2BA 4A8JC 4CDMA 2XUZA 2HN9A 4AJJA 5HGJA 1Z4KA 3N8GA 4B6EA 1XNGA 3EVAA 4KMOA 2LKDA 2J8ZA 3KELA 1GNLA 3OBBA 1J8QA 5BPHA 5ERYA 4ZCRA 1UXKA 3CCCA 4BNTA 3TF5A 2C2OA 4A36A 2GEVA 1VRVA 2GVDC 2XT0A 3HU3A 3IPLA 5KYXA 2WZDA 1VM6A 3FG3A 2BEWA 3PGLA 1UKVY 4B3JA 2VS1A 3X2SA 1HZJA 2IITA 2CF5A 4OU4A 3FZGA 3FGPA 3G2PA 1PNOA 2LTAA 1TPYA 1UKCA 4TKVB 3WNCA 1AGXA 4GKBA 2VHEA 4ZO4A 5JCJA 3OUZA 3CCFA 4ZTUB 2ID8A 4MRPA 3GLIB 1Q16A 1XMJA 2I4LA 4FFBB 4JQOA 4CMGA 5CB6A 1LLDA 5HDBB 1JEYA 1TYEB 1JSXA 2Y9PB 4JBHA 1RD4A 1ZNQO 1UJBA 3GN1A 3QWIA 4UW9A 5CURA 2ASEA 2ZR9A 4H15A 3X0DA 4EFKA 1S8FA 2X42A 3MCUA 2R86A 2ZYRA 1C9MA 2J6BA 4GAEA 1Z17A 2I76A 3T7CA 1GYQA 1ZUNA 3TNDA 3TOCA 3IUYA 4B48A 1CJKC 2DFNA 2P4UA 1KYQA 4EW2A 4ZYXA 4ND6A 1JHDA 4KQMA 3RFXA 2VP2A 4DB4A 3W3AH 4TMZA 3IT2A 3GVXA 3SJZA 3TR5A 2WC1A 3DDOA 4R9VA 3T5TA 1TUBB 2W6ID 3T3DA 4TYNA 2VDJA 2CYBA 3EULA 5I9BA 3A2MA 1EB8A 1N5MA 1O94D 4CM4A 4LYHA 3D0OA 4ABYA 4PCVA 3MK31 1C3VA 3P0FA 1Z29A 4NK4A 1G3RA 2C4WA 2PZJA 3PEFA 1YCFA 5FUYA 4OYRA 1XDDA 1PZFA 5GGYA 3II6X 1G5TA 4GP6A 2Q07A 2C9OA 2I9PA 1IG0A 4XUDA 1E1LA 3EMKA 4S12A 1GN8A 1E7RA 2WPDA 1NW6A 1N0UA 4WBSA 3AG6A 1FJHA 3O92A 1XZMA 4K6GA 3MGAA 1ODSA 1M6VA 2C2XA 2P77A 3OE1A 3BMQA 1IG3A 5HZGA 5EPUA 1S7GA 5JARA 1GAEO 3VR6A 3PNQA 1Y1QA 2HMTA 4MKGA 4X7BA 3U44A 1RXVA 3FYSA 2NVWA 2OESA 3A14A 1FDOA 3PE3A 4IWNA 1KPIA 3W8DA 1YOVA 4PGHA 4Z4GA 3ACCA 4U7DA 4P0QB 4FN4A 4CR8A 4AF7A 4J90A 1TO6A 3LIIA 2N75A 2QOEA 1CS0A 2FGKA 2O8VA 4LCJA 1V11B 1L7RA 5KHAA 3P9SA 3VRHA 3EWIA 4XLLA 3ZJUA 4FZ5A 3NMUF 1I01A 1ACMA 1ZSVA 3GEGA 4C7VA 3D7NA 5TQVA 5J4HA 2RK6A 1AN9A 1HEUA 4QWWA 1BS1A 3AI7A 2QYHA 3DWFA 3Q11A 1X1AA 3KU1A 2H0RA 4ZTBA 4BVHA 2HWWA 3CU5A 1YR8A 1B1AA 5IRCD 3EWSA 4WK4B 3VZPA 1K9SA 4WLEA 3FN4A 1YBAA 1I4WA 4FD3A 4HNAA 4O2AA 4WA8A 4WY8A 4BRUA 1ELOA 3Q9LA 1K08A 1R4ZA 1RM0A 1TX4B 5AK3A 3OQOA 3G2NA 2ZETA 4TMWA 3SI7A 4WFOA 1Q3TA 3A7DA 4OBWA 2JATA 4DA0A 1LD3A 1AB6A 4HFNA 1H6CA 5BMVA 2GF9A 1W25A 3ASZA 5AW5A 3JSXA 4XCVA 3S29A 1SUIA 1AMOA 1CZOA 1PR4A 5TIIA 3MTDA 1KFJB 3OU7A 4DQ0A 2XCUA 1ZWLA 5I4CA 4ER3A 3R0IA 1KHHA 2YZ7A 2FFQA 3SVZA 1WPGA 4XWWA 2BEVA 5FUWA 4US1R 5CT6A 1I7LA 1QIGA 1EG2A 1KO4A 5TR9A 3ZNQA 4RS4A 5F3RA 3N05A 3JALA 5EKSA 1U3UA 5K3FB 3MJCA 4X0EA 1J42A 1E69A 5DV9A 4KYVA 2O8DB 2P9YA 4A0RA 1RI5A 3LY5A 4KQHA 2XDQB 3T9CA 1C2TA 4OAQA 1V48A 1GL9B 4LFAB 4D3YA 4TLBA 3V8QA 3JQFC 3SM9A 3H2ZA 1FJXA 2YOHA 1XWIA 3M3PA 1KBZA 3KV3O 1P5HA 1RM3A 4HRAA 2YV3A 2B61A 4XSVA 1SG0A 2PM8A 1F51E 1ZZGA 1OOEA 3HZHA 3NRJA 4GC5A 4B6QA 4KFTA 1IMJA 1QM6A 3B78A 3LV8A 2EQAA 3G02A 4IDNA 2C4NA 5HS4A 4YDRA 4BNIA 3BDVA 3AZPA 1P1RA 2X9QA 2PUWA 2VQSA 3H97A 5I7AA 4C0AC 4C7JA 1R9NA 4WHAA 3VMFA 4ZEXA 3DXXA 4DTIA 3CEPB 3K09A 4EGSA 5A7GA 1G3QA 1HYGA 2V0CA 3NIWA 4INJA 2XA1A 4UQPA 3NS7A 3PYLA 4Q3NA 1J0CA 4JJFA 4M87A 5TXGA 4DUZB 3PCTA 4BQEA 1FNDA 3FPCA 2OB2A 5A5FA 4CMHA 3FCYA 2IHJA 3DT6A 3SBDA 5JCZA 1Z2PX 1N9GA 3T4PA 3KOUA 5HZKA 1Q6ZA 2PZEA 5H5JA 5KNBD 1B73A 1Y6JA 1NUTA 1YS7A 5IXSA 4UFNA 2FI1A 3D4LA 2GJSA 3QPUA 4JH0A 1J5PA 1MA3A 2J9ZB 2CXOA 5I51A 4CG0A 1PD0A 4LF9B 1FTGA 1Z26A 3OZ7A 5LDHA 1Y9EA 3COYA 2O3UA 4W5QA 1Y6GA 4LFBB 4EJ6A 5E4FA 4AMYA 2WKSA 1LK5A 1R8JA 2YNMA 3CB2A 2W4QA 7ADHA 3B6IA 1KI9A 3TSCA 1O96A 3I05A 1F2UB 3KR9A 4E09A 2H2HA 1CR2A 4E4YA 3RUDA 3VH4A 1CS4C 4ZAGA 1ZHHA 2OFXA 2BMVA 1YJXA 3JD2A 1U8AA 4PYRA 5IH3A 4YJ3A 3W9BA 2F8TA 1N1MA 1Z2CA 4M38A 1LW7A 4N0DA 2JI8A 4ZEWA 2FUG1 1A9ZA 3WFIA 2ZT6A 1EB9A 2CUZA 2G25A 3O8YA 3H9CA 1MRSA 3LE8A 3P9IA 3PGXA 4OXRA 1A98A 4UDYX 4CMIB 4R0MA 3GUCA 4BLTA 1UDAA 3C3CA 4LDRA 4M0CA 3NHMA 2QPAA 3LD9A 4Z8XA 4UASA 4RMIA 2HV8A 4RSRA 4ZV4A 3ED1A 1LBQA 1VJTA 3G68A 3KUXA 2JLWA 1WA5A 3FY4A 5CH3A 4C1BA 1KKMA 1QGUA 3THYA 4URUR 3ZCSA 2SKEA 3ZHZA 2GBIA 1FP1D 3T95A 4IHJA 4GM4A 2HSZA 4RKWA 3FDXA 4LBZA 2PZKA 4BS9A 3SPXA 4HXYA 3LC1O 4GUDA 5IKOA 4C7MA 4ZOEA 4UBJA 3TE7A 3P7MA 1B8PA 3ZLJA 4TL7A 2IZ7A 5KO2A 1EFDN 3ELBA 1E4EA 3AFIA 2EIHA 3LUJA 5DEIA 2Q3BA 3B9QA 2HTEA 1RM4A 3DV0B 1UP7A 3ZHOA 4GPZA 4UXHA 2RI0A 3ITEA 2V54A 4V3CA 5DGTA 1HKUA 1FGOA 1O5OA 2FFJA 2YN4A 3NWBA 3IJPA 4RESA 3QLUC 3PBKA 4ZMBA 4NENA 1ZUIA 4PGGA 1COZA 5HZHA 2ZJ4A 1L4YA 1KSJA 2XWSA 5KAPA 1MGOA 4BO7A 4WOJA 2WG1A 3ISTA 2VXCA 3RU7A 1S96A 2OOSA 2P41A 1OI3A 4ERNA 1WLYA 3AXTA 1APBA 4UEKA 1U8YA 3IHKA 3IR5A 3IQEA 4FR2A 2I1VB 1SOWA 4H1TA 4NJMA 1YU6A 4MGHA 3RTAA 4AECA 3RU2A 5JUWA 1D1TA 4PAOA 1B93A 4FNMA 4TMXA 4AP5A 1E2EA 5FORA 3VI3B 3NR2A 4NX2A 5FA6A 3PNLA 3DZ8A 1GA6A 3U40A 5B4TA 2CXNA 4QQKA 4WV3A 1TEXA 5JAZA 1LBEA 3A05A 2NV0A 3MNFA 4J94A 5TMDA 3KXDA 5C5CA 2H92A 4L5BA 1ECBA 2ZAMA 1JB1A 4YLYA 4LJ4A 3W2IA 3QF7A 2W48A 4HQNA 1EFUA 2ZANA 4IS2A 1CQJB 3NTUA 1NDUA 1D7OA 2BYTA 3CEJA 5CYGA 1WV0A 5AM3A 3PGA1 5KSPA 4R71A 4QFCA 4FOPA 4RKFA 4MQFB 2AK2A 2ZBEA 1HNZB 2KBFA 3WSWA 1U0TA 4MJXA 5FBHA 4S0ZA 3NTXA 2B7CA 5E2IA 2I2WA 4WRRA 5A4AA 1NP7A 1ULZA 4MLCA 4EAQA 1VPWA 5AM1A 1UAAA 1N0WA 4EHBA 3LFUA 4MYUA 3HM2A 1XTIA 1Z0FA 3Q4GA 1TNDA 3PT5A 3JASA 2P7HA 2PLNA 4N0PA 3HGMA 5FP0A 2WTBA 3X1YA 3RFTA 4B4KA 4S24A 1I33A 4WESA 2OE2A 4B6PA 1ZD8A 4YQFA 3D4OA 3KSMA 3MPUA 3N5CA 3ZE1B 4LMBA 5FTJA 3GOHA 3QKSA 1I5EA 4KR0A 4W4TA 1L7XA 3GRRA 1G21A 4MB6A 4EEZA 1T2CA 4QOJA 4C6TB 6ABPA 1TM2A 1MX5A 4DVGA 4H16A 3MJEA 3C4QA 1ZSYA 1QFMA 2JBAA 1M1YB 3QKRA 3AKEA 1YC5A 4EX6A 2B4TO 2D5IA 4GSYA 3KSUA 4TKZA 4D9BA 1E2FA 3DBRA 1PQPA 4RC9A 4ROTA 5M3BA 4NBWA 2WTUA 3BGSA 4ARZB 1TTPB 4MIKA 4R1NA 3H11B 1UFVA 1IUPA 4CLHA 5TV2A 3U31A 3VJLA 3WL5A 4RCYA 2I3DA 3DAGA 1JDSA 2FJPA 4V3BA 1JQKA 2HNAA 1CDZA 2PSFA 4WECA 5HIJA 4BVLA 3WICA 4L57A 1IPEA 2VF4X 2J9YB 5DGXA 1RZVA 4IILA 5CM8B 5C8YF 3OEWA 1UAYA 2H7CA 4KRGA 1WDTA 3V2GA 3QU5A 2NO5A 1HU9A 3W77A 4TUYB 2JH9A 5GADl 1E2JA 1VHTA 4LK2A 4V03A 3PCRB 2WY2D 2NO0A 1A04A 1EK0A 1T0UA 5ITSA 2OILA 5K8CA 4IXWA 4KI0A 1E32A 2DJIA 4UJ3A 5BUQA 1YDGA 4KAXA 4JI2B 3NBAA 3PJEA 2P2CA 4Y2VA 2O50A 1NQXA 1T5HX 3DUFA 4UHFA 3ZWNA 3D7RA 4M0EA 3C7DB 3AVWA 3KQHA 3ZY5A 4AI6A 5JOQA 4IHJF 2JHFA 2HNKA 4BQIA 2JH8A 3TLCA 5JSZB 3MMXA 3PITA 1FSFA 4F6LA 4M1MA 4OB6A 5FEUA 2OVFA 3Q8XB 4RTLA 1OIWA 2A5GA 3NT5A 4MS1A 5THKA 1FFXA 1YB1A 2QR2A 2XVMA 5B3AA 1PZGA 4UFPA 5JJCA 5JRDS 4MHTA 9MHTA 1AQLA 2GPWA 3CEAA 4X62B 3AFNA 1SVOA 3OG9A 3K94A 4B0PA 1U8ZA 3FYHA 1FW8A 2MINA 2B21A 2Q5QA 3N8KA 3H5RA 3P9YA 4EB8A 3KQLA 4RV5A 1QQ6A 3AVQA 5CCDA 3NHLA 5BN3B 2YN2A 2FXIA 2REQB 1EQ2A 3PI7A 3UH1A 1E9EA 1UODA 3EXIA 2GZ2A 4HLCA 1T0JB 2C1ZA 4JOBA 4X93A 3VHXB 4DIKA 1NP3A 4PU0A 4N8SA 3UXHA 4L2IB 2R5FA 4UU8A 4W7HA 1A4RA 2ODAA 3OCWA 4ZVVA 3UGJA 1AKRA 1D2RA 2NQ2C 4D9JA 1R4MA 5BR1A 2F43B 3M33A 3HBNA 3QWHA 4P98A 3E9MA 2HEGA 5JCJD 1FE8A 3ND7A 1DT5A 1I1HA 5IT4A 2R8XA 1Y4UA 1I9CA 2QF7A 2NW6A 3MT7A 1EP3B 3OTWA 4QXMA 4JI7B 1JE1A 1USVA 2QK4A 3X2FA 1UWVA 2IXDA 2C07A 2A33A 3A4VA 3ASUA 3B5JA 2JFVA 4CL8A 3BMCB 4II7A 4XCQA 1KEVA 3FKSD 2ZSBA 4NU5A 3DYVA 1MR3F 1UJMA 1ZN8A 4PG8A 5E0KB 4E2WA 4FI3C 4E12A 3RVOA 4QTUB 1SKBA 2PUAA 1MRZA 1ATIA 4GRAA 3TCNA 4HXEB 3ME5A 4JA2A 4GL2A 2FOXA 3KG2A 5LLSA 4B4VA 1N6NA 2O57A 4MZXA 3KYDA 3TKAA 4AYXA 5D6NA 1TF2A 1A4UA 2J5RA 2D0DA 3KIPA 2NN3C 1I13A 3OLCX 3TW8A 3UJNA 5KDDA 4OBXA 2O54A 3BBLA 3NEJA 3KKMA 3PE4A 3T41A 1VLQA 2Q6VA 3A4MA 3I73A 1MA0A 4KLAA 1BN7A 4ZQEA 1TZJA 4MYRA 1J9EA 3R3ZA 5B55A 2NM0A 5EZQA 3BZUA 4CQNA 1ES9A 3QGMA 4GI5A 3STHA 1CZHA 1H42A 2YOFA 1XQYA 5EJMA 4BQNA 1EXWA 3BERA 4RQBA 1GCOA 3IEXA 5FHRA 5REQB 4BJ6A 4CF3A 1S3GA 2CHUA 3Q72A 4Q37A 3C1AA 2QL9A 1P9LA 3MCTA 2BPOA 4JBWA 3P97A 3K4PA 4WNIA 4YJFA 3GP8A 2IW1A 1ZCBA 3SZOA 1YZFA 5CX1A 1ZNWA 1R50A 5M5BA 3RRZA 1ESZA 4U6NA 3ZU6A 3EOAI 4QULA 5BNWA 2JKYA 3MT8A 3UAOA 4L8FA 3FTCA 1PT9A 2BKAA 3ZIAD 2JLAA 2PH7A 3AIMA 2QTZA 2V7QA 4MQ5A 3OPNA 2ZLBA 2OBFA 2Q3CA 1RTTA 4H08A 2VO1A 1QRSA 4KR7A 1XNRB 4PLFA 2C8LA 3IVGA 1V45E 1A8UA 2AMLA 2FMKA 1Q15A 2BZSA 4ER7A 2BL4A 2WJPA 1WHTB 4KQKA 2DMRA 3EVEA 1ZN2A 4L6IA 2GN1A 4EBBA 4YCCA 2RGDA 1UBMS 2V7XA 1JZSA 5FNZA 3MIZA 3CQ9A 2I33A 4RNCA 1NBWB 2B0JA 2YWGA 4H2DA 4EKIA 4YRQA 3L40A 1IATA 4OOEA 2ETXA 5E1OA 4WUTA 2V0NA 1PE0A 3CZMA 3QBVA 2BH9A 5B12A 1QS0B 5H68A 3GF4A 5IASA 3GRFA 1ZM3A 1ZVMA 3MJ4A 1MJ5A 1I32A 4O02B 3RKRA 1QO0A 1XRQA 2A1UB 1HDYA 3JYNA 3NW9A 1TIKA 3SEZA 4BNXA 3OWXA 4MUYA 2WTMA 3SZLA 1OH8A 4KXFB 1N34B 4JLUA 2Z4RA 1Y0BA 5KYWB 3W3AA 5KTMA 3PHBE 1P2VA 1O58A 3IOEA 4JR0A 3NUGA 3LYHA 3LT2A 3R7AA 3IMKA 4BO1A 5SY9A 1AQJA 1C7EA 3T15A 3BWEA 3IOCA 2CCJA 2PDAA 2Y6UA 3QE2A 3C16C 2C4KA 2HA2A 5FEMA 3PTLA 2QVZX 4UUAA 1WXDA 5TMEA 3AR4A 3WRVA 4EF4A 4YV1A 1TK2A 3OM1A 3PXGA 2DSNA 4J49A 1U0LA 1U02A 5AYVA 1UQRA 3RQIA 5A3RA 3EGEA 4YYEA 4J0GA 1SQ6A 4BLOA 5G4KB 1U1FA 1C5KA 2FFRA 3R9IA 4E1VA 3HQ4O 4NH4A 1E6LA 2NX2A 3BL8A 1Z4OA 2CXRA 3NC0C 3O90A 2VJNA 1KTVA 2VSFA 4PANA 1LRLA 2YVAA 3N2YA 5LCXA 1EVZA 2GHRA 4JIMA 2HH9A 3I6QA 3KWLA 4EW3A 2V3VA 1ORWA 1E5QA 1V16B 3CLHA 3DOFA 3FPLA 4G0OA 1RE1A 1KYIA 1CRLA 5AK0A 4D0NA 3I42A 3R5SA 3H0KA 1XGKA 2A9FA 3INRA 5LB2A 5A7HA 2QAGC 3VZCA 4DCOA 5IW8A 1DAFA 1U1CA 3EZLA 5DGDA 2C4UA 5FPSA 4HGNA 4P81A 2VTBB 3PDIA 1IY2A 1K5DA 1KJIA 4C4PA 5KPDA 3V2IA 1E18A 2P2YA 1OREA 3ABQB 4L74A 4TWIA 2CYAA 4IIBA 3TSWA 2YFYA 4FS3A 1P6UA 4O25A 4BLUA 4CQJA 4EX7A 1QHIA 5FYQA 4YHHB 1UC4B 4IOKA 4QPNA 3V9PA 2VSQA 2GKOA 5KVCA 2VOEA 1Q19A 3N76A 2QX4A 4F56A 5E9QA 2K7FA 2FETA 1T5SA 2JLYA 3SU8A 2NVUA 5CVEA 4JIGA 3AL2A 4F91B 2H2WA 2WYIA 4PX3A 3L4BA 2O0JA 3FKQA 4TM8A 1W29A 2UZAA 4DLXA 521PA 3E4CA 3QFFA 3U1TA 3UUEA 2ZSIA 1GAXA 2X41A 5KJ1A 3SFVA 3I37X 3TMKA 3DM9B 1ND6A 4K8RB 2FDXA 4UVDA 1YL5A 2GLXA 4PAWA 1CB0A 1T8SA 1SJ9A 2F6RA 2VKTA 4C3ZA 1AKQA 1LX6A 3ITKA 1JKXA 2C99A 2OK7A 4HS9A 1MGPA 4Z9BA 4IGAA 2YZMA 2OUIA 2BMDA 2FE1A 2VWQA 3QUTA 4IIXA 4X91A 2DYKA 4CCAA 2RH9B 3GYGA 2QTGA 4IVQA 2XDYA 3PIDA 4LIPD 1W5FA 3CBGA 4G5FA 3VC7A 2NXCA 2Z83A 3D6AA 3IUPA 3OPMA 1Y63A 2YRWA 3TRDA 1UJ4A 1I0IA 4HQLA 1QIEA 2VJMB 3BB1A 4B09A 2R6FA 4QOFA 2GR9A 5JI3E 4EYKA 1XQXA 2G4LA 4QOIA 4FC6A 1ACLA 1Z34A 1LTKA 2ORYA 4FT4A 2DECA 3KAJA 4EUSA 5KPJA 1TZMA 5EZ5A 3R3HA 4S04A 1KAQA 4DCGA 3O94A 4TLAA 2PGXA 4BIIA 3A27A 1MJFA 2MSNA 1NLYA 4DAEA 5BW5A 3R20A 3KNZA 4M4SA 2FRDC 3JD1A 1ZG3A 4G81A 3CUWA 1NV8A 3ENZA 4RDCA 2XGOA 2Y93A 1BU5A 4PONA 3BNBA 4IBOA 4Q3OA 2HT1A 1RWBA 5IJ0B 3ZV3A 5EZYA 1GTVA 1J0EA 2FSVC 3MBIA 3R3JA 1ZGJA 4OQZA 2P6MA 3K1ZA 1X7GA 4BUCA 4ADSG 5BRJA 1XMQB 1BZYA 2PEZA 1UM9B 3DBLA 3EZYA 4W7IA 3D8BA 4Y3UA 3F6SA 3ZXXA 1O9BA 2BFOA 1LDMA 3SHTA 1VMAA 4YTEA 1FGQA 1XO1A 1E9SA 2I03A 3LVQE 4NULA 5G4LA 4PG4A 1RHUA 1VLZA 1OU4A 3W4JA 3G79A 2IP1A 2JJ1D 3MWLA 1AMNA 4OXIA 3FRIA 3GPDG 5KCMA 3RWBA 5DF1A 3WK6A 1M74A 1CNEA 1H2HA 1MX3A 3JQDA 3OLXA 4OL9A 2CEKA 4O4HA 5I9IA 3M1LA 4MB0A 4EY7A 3CPJB 2Z9BA 1CLUA 2Y2UA 3TUJC 3USES 4K9RA 3K8QA 1P9RA 3BL5A 4XCXA 1TK9A 1UAGA 2FN4A 4ZXPA 1K3TA 5HWSA 4BMSA 3L43A 4DFDA 1VKOA 3S70A 4G8JA 4N54A 3QELA 3HGQA 2PZMA 5SZIA 3ADOA 3C14C 4NMHA 1Y6RA 1L1EA 4DCNA 2XZTA 1QBGA 2DPXA 2VR1A 3H84A 3UC5A 1Q1GA 2I6XA 2KWIA 3FCUB 4R0VA 4MWDA 3K1AA 4WK0B 4KDRA 1LSOA 3TLMA 1QVZA 4YT4A 3IJEB 4FZJA 3A2NA 1YRLA 4LYEA 2CE2X 4ZVUA 3SBXA 4GDMA 3IA2A 1YR9A 3TSYA 1FLAA 3PZRA 3D5QA 4H3KB 3UF0A 1L7OA 1REQB 2BBOA 2XF2A 3BX1A 1I1QB 2WAOA 2HFJA 4OXXA 3VHQA 3WP0A 1QP0A 5GV8A 1Y42X 3F3SA 1Y8RB 5FQOA 5TQ2B 4WIAA 1HI9A 1OILA 3VDQA 5F12A 3NKFA 1F6DA 4DBZA 1R7RA 3QFCA 4NCBA 4DA4A 1NTRA 5U9CA 4NCAA 4QHYA 1COWD 1XTTA 4D6PA 4DE5A 2PRSA 5BSHA 4TT8A 4KX3A 1WSBA 4P4TA 4MS3A 3RR2A 4EKGA 3S5UA 2HJVA 4G0WA 1N6PA 1W9MA 4NTZA 2W2PA 1LF5A 3WKCA 4ACAA 1Z5NA 2Q45A 3CFYA 2EL7A 4CIVA 4Y7DA 2HRRA 3FOWA 3W0LB 5A9SB 1JI3A 5IJZA 4IQ4A 2WNHA 5AVUA 2C5FA 1H3EA 4QTZA 1CK4A 1IIBA 3MYRA 4C3UA 2O7NA 5L3VA 5C1OA 1X86B 1AKMA 4NZPA 1GITA 2QAGB 4JI1B 3OOHA 3WRYA 2HBZA 4D56A 1UDBA 2AMFA 5IP5A 2FMIA 3SEQA 4ZPJA 1C3XA 4QAQA 3BXGA 4ENTA 3G49A 3AKZA 1W4AA 2X8JB 4AG3A 5I7WA 2SCUA 4JLMA 3CVVA 2UYQA 2Z8XA 3ED5A 3C7TA 1F3LA 1JR3A 4Y2RA 4ZD6A 3FWZA 3O9ZA 3VNSA 2GYVA 3CC8A 1TDJA 3HYSA 2W42A 3B1YA 4DV4B 2GD0A 3R5KA 4P4UA 1R8XA 1VLJA 4GZLA 2JGKA 4MVJI 4DCPA 2YWBA 1Y4AE 4CTJA 4DRZA 3E2MA 1VJ5A 2P4QA 3KTDA 3B36A 4TS4A 3D6TB 3RIEA 1UINA 2R9VA 3LCMA 1Q95A 1NV9A 2ZPTX 3KZCA 1WVGA 5DI3B 3F78A 4BAGA 1N2CE 2BUBA 3JZMA 4CKEA 2GXQA 1D6NA 3KPYA 3EX7C 1P9WA 2AR0A 3L9WA 2ZUEA 3PVSA 1QLWA 1A8HA 3NWOA 4R2MA 3JVVA 4QDZA 4Q4LA 4ZT7A 5EA2A 1KZ4A 3P9KA 2ZRHA 3ZBQA 1EQUA 4HNVA 2GZHA 1R0XA 3PNVA 1FP6A 4ZAZA 4E13A 3MTJA 4I55F 4M6WA 4M8LA 2WVJA 4HGPA 2VUIB 5HFNA 5YASA 2WU0A 1HTTA 4UU1A 4MMZB 4GYJA 4BY9E 1CY6A 3PD7A 4R41A 3BD7A 1Z36A 1QF6A 4TL6A 3KRTA 2VN8A 1R4NA 4FR0A 3TMYA 1JA1A 1M6EX 4XQ0A 4LOLA 5GP1A 4DZZA 5CG1A 1F8NA 3O3CA 1NWCA 5SYMA 2H5JA 3HHPA 4PYKA 3MOSA 3E23A 4C3VA 2VA9A 2ZPUA 1ZHOA 2FG7C 1SCNE 3UUGA 1E9CA 1UEXC 2EKLA 3EF3A 2WU8A 3HJGA 1Z73A 1QMDA 2X0EA 1FU7A 3NGLA 3T1NA 1EBBA 2CBXA 3VX4A 3U6KA 4ZIRA 3F74A 1U6KA 1L8QA 2VDWB 2Q9CA 1S2IA 4XDZA 3W9UA 5HBRA 4S2UA 4RENA 3BGOS 1JPUA 4IVPA 5CA0F 3I04M 3G2KA 1PHRA 3DKIA 1ZU4A 2OCYC 2WR8A 3PA6A 4H27A 3RH0A 1UXJA 4G5RA 4RS3A 2BGNA 4B9AA 3E5NA 2GJAA 4MQUA 3WVNA 2OV3A 2Q3HA 4PX9A 2HCJB 2XV1A 2ZIUB 2A92A 1G2OA 1KBOA 2BGMA 2CHGA 2PBZA 3BZWA 3HDHA 1K3UB 5HYVA 1QP7A 1CJTC 3V4PB 3G9ZA 4AMGA 3JX9A 1TQ6A 3ET5A 5F1OA 4PIVA 2B4AA 3BK1A 4D02A 1SXGA 2O1EA 3C3WA 3CT4A 2WBLC 4HNQA 4UAVA 5DN6D 1OE0A 3DXFA 4OP2A 2ATVA 1PT6A 4L3VA 4Z0TA 1T13A 1KZGB 3OQPA 3RSZA 4GRIA 3QKTA 1ZGZA 1P72A 2WJYA 3PXDA 3TLZA 1QH0A 2QU8A 1ZK4A 3C5VA 4YONB 1W88A 5DM4A 4ZHQA 4EHLA 2AJLI 2I2AA 3GZTB 4YGYA 1SZPA 3KT8A 3R09A 5LC1A 3U5ZB 5LZ9A 2JIMA 3LL4A 1XA4A 2N1BA 3LWDA 3PPYA 1OB2A 1NIJA 2BM8A 2G63A 4O5OA 4YRLA 3DKPA 3FUVA 5LOVA 1JBKA 2V03A 3CS3A 3MC1A 3ETJA 3ERCA 3K8OE 3WISA 4LJRA 2UYYA 4ZOLB 2NUTB 3RU3A 3E9QA 4IDDA 3WGKA 4L73A 5AW9A 5EHZA 4G5YA 4PNZA 4D6YA 3TE6A 4Z5XA 5FAXA 4LZNA 3FMPB 1SURA 1VQ1A 1AQIA 2ZXEA 4LDNA 1BD4A 1QCYA 3CH7A 1TT5B 2C3UA 1VJDA 1ZESA 4FFPA 5AT1A 4KWHA 4XGRA 4EO9A 3E1KA 2R8BA 4HVCA 5A3JA 3DOJA 4AW9A 3V46A 1L5OA 3G6KA 2R6GA 5AXCA 1X0XA 5KNCA 3MGBA 3TI9A 1EDEA 1K4YA 1KQPA 1X7YB 1GG2A 4PM4A 3X1ZA 3QLTA 1CDDA 3ZJ5A 4II3A 3C39A 1PJ4A 3GLHA 3FKJA 4BQFA 3ZHVA 4DMKA 3F3KA 1XEWX 2WV9A 4PPGA 1SUSA 1ZAYA 2QQ0A 3DV2A 2XYGA 4NECA 3CHYA 5G0VA 3RVDA 2Q2OA 2VUHB 1OYVA 1XB2A 2IHTA 3DM5A 3DOEA 3OIUA 5CFOA 4Z8YA 3M81A 1W6UA 4D8YA 1TKRA 3BICA 1IL0A 2O0MA 4Y6SA 2IX3A 4QL3A 2Z56A 3ZI4A 4I81A 1LF0A 4LRXA 4F4UA 5GV7A 1PS9A 3HMQA 1F7UA 3CZPA 1AUOA 3KXPA 1UJ2A 4UNIA 1F0PA 2OXCA 2RB4A 2JIRA 3KT3A 1TZKA 3OCZA 5JYCA 2A0WA 1QDEA 1CUJA 2QNIA 4UQOA 1X8JA 3U44B 3AUKA 2HV9A 3IOMA 3WGUA 1DARA 5HK9A 4YCBA 1KETA 1LFAA 1TOAA 4BGUA 3M4ZA 5LP6C 2IPLA 1JEEA 3D8NA 4LGMA 4D3XA 4NBTA 1KK0A 3VU0A 2JFZA 3AEQB 2XAAA 3NHYA 1G8SA 1STOA 3JQ7A 4CM9A 1NJSA 3R4VA 4CXMA 4DLNA 1CJUC 2EARA 4BQPA 5AVXA 2DHRA 2ZRLA 5KDLA 3H75A 4CKWA 1SKQA 3U0VA 3ZXSA 2GPYA 1H0RA 2YASA 1M10A 2LUOA 4DC1A 2KXVA 5J4YA 2BFWA 3PDWA 5EJGA 4LJSA 4DBLE 3ASYA 5DGCA 2WSSD 1UBTS 4FYHA 1F14A 4XR9A 1ZN7A 4YRIA 5E9AA 1BSVA 2BMAA 1XD2A 3HPQA 4KBYA 5CA1A 1JLKA 3E84A 1F5NA 4C78A 3AGQA 3PLAE 3TBKA 3KKOA 2R6R1 4E0BA 4WKCA 2C58A 3IEPA 1PJRA 1HNNA 4UVEA 1A97A 2ZW9A 1N36B 2A2ZA 2ZBRA 5EJ8A 1KPGA 2ZPAA 4EJSA 2W6ZA 3DE6X 5FHQA 2DF8A 2ZT8A 3CKKA 1VRCA 4GZ5A 1Z5OA 1P5RA 3SSMA 1D2GA 5E1DA 1AKUA 3U26A 4XQ9A 1B6GA 3DWGA 3FMGA 3NX4A 1EIZA 4XJVA 5LFAA 1EVKA 1ZITA 4UM7A 3BE8A 5KYVA 1ZMTA 4Y9TA 2VG8A 5EIBC 4X61A 1WCYA 2G1KA 1WZIA 2R6HA 2AN1A 3WLMA 4Q1AA 2AOUB 3FNFA 4OQFA 4QLBA 2HX1A 2HHLA 4RVHA 1MRNA 1PWHA 2Q7XA 4OLFA 1RYMA 3VUFA 5K3FA 5KQPA 3S5JA 4F0JA 3BJMA 1IUOA 3B52X 1TW3A 4XIYA 3FWHA 1FDSA 2ZJYA 2X8LA 2P1RA 2JLRA 2FH5B 1RI2A 1I4EB 2RC5A 5ILOA 1QU3A 4HAZA 3MAJA 1CEEA 4UEQA 1HZZA 1AB5A 1OGYA 4ZEVA 3Q7TA 3COVA 4ED9A 3FJ1A 3GRZA 1T34A 2EEPA 3LLUA 4JJZA 5JISA 5HZMA 4LDJA 4PGMA 1UIMA 2QLJA 4RPJA 4RVFA 2GYYA 1CWUA 1BVUA 1NT4A 1UJ5A 3HM9A 3OJ0A 4K81B 3EOZA 2ZAGA 5KI6A 3UOWA 8LDHA 5AVWA 2IU6A 1TLFA 3CPSA 3H05A 2HC9A 2IHBA 1J2EA 1NLUA 2CVFA 3CRRA 3GMIA 4IIVA 3RV4A 2AOXA 2HPZA 2BI4A 2D5CA 3W78A 1MNQA 3NTRA 1BCSA 1ECPA 2YY7A 3EY9A 1HLGA 1S3FA 1KEEA 3KTAB 4K6FA 5L3QA 3S27A 4E5KA 2X6RA 4L4ZA 4RUKA 3E6AA 1NATA 1FMTA 3VSEA 1AMUA 2GVZC 4ECEA 2QG4A 3W7AA 4HBZA 3P71T 3I72A 1MOPA 3G89A 2OWDA 2PMFA 4O4JF 1JLMA 2QRPA 3SMVA 4UM9B 4D5EA 1HTWA 2XZPA 1JKFA 1HYEA 2WP8J 1YA4A 4BNFA 1A5TA 1EFLA 3GQBA 3HDVA 4KXVA 4Z9FA 5IT9A 5EQJB 2A78A 4ZVPA 4ZICA 1ZXLA 3T1YB 3QXSA 3R6LA 4XZ3A 4A10A 3ONDA 1AC5A 5ES4B 4U2EA 4BFSA 2XHHA 3OBIA 4UVIA 4HQOA 3K32A 5FOTA 1AGPA 4JU9A 4R0NA 5JAPA 1N2GA 2VL7A 4LC9A 4O3FA 1CIJA 2RHWA 3B3QA 3WWDA 1WABA 3HUFA 4YDHB 1FQWA 1Y1KE 2G82A 3N6RA 4IICA 4HNTA 1BU8A 2IPMA 4DYVA 4D45A 2BISA 5GJWC 2HB6A 4RIFA 4DMGA 2PVPA 4EYGA 5LLDA 3I6BA 1V8PA 2EP5A 3R9XA 2NYVA 2Q4BA 1NSFA 4FZ3A 3ETEA 3GH3A 1FLVA 2PWAA 3OT4A 1UKEA 1T2FA 4ZT5A 3SHQA 4ZDIA 2DBQA 4UVHA 3T5AA 4CM5A 1WMEA 2K2WA 2QRQA 2YR0A 1CY8A 2MTBA 1M75A 1PGOA 3QV1A 1N6KA 4MV6A 4HAXA 1FFYA 2W6NA 3EE6A 1AUVA 4I4TB 1QRUA 1A27A 1LS6A 4KR3A 2H65A 2C00A 5CB4F 3V3KA 1OAOA 4XM2A 3EA5A 1ORTA 1W52X 3ZCXA 3WMGA 3WA7A 4US2R 3USCS 2VHWA 3PC8A 1RWKA 3PFIA 2Z2KA 4US0R 6GPBA 3RUAA 2H17A 1T2EA 4OHMA 4AJIA 2FK8A 1EK1A 3GUZA 3EGIA 3IXMA 3AEKB 5H0IA 3TZKA 3JWHA 4CWAA 1NA5A 4BBZA 2I4NA 1VE7A 3PZBA 2P5UA 1Y8QB 1A72A 1KK3A 1ZMBA 4N0MA 5H4HA 1OV4A 3DPIA 5ADUS 3EQ7A 4HYYA 2X2FA 2ZXFA 1XN1A 3KFLA 5C52B 2XFEA 2UVQA 4U9HS 4RJTA 1CRZA 1YRYE 2XVZA 4R8RA 4BNUA 2ZJ6A 2Q3LA 4ABTA 1CCWA 4CEJB 2NYUA 2B4YA 4QPJC 1KAGA 5HE8A 3KZNA 2MJLA 3R6TA 1NBMA 4QXAA 3EEOA 1R0KA 1N6HA 3CIFA 2P65A 1FTWA 1NF2A 4O4HF 1IOLA 1DTEA 3B5EA 2AK3A