2PVXA

Nmr and x-ray analysis of structural additivity in metal binding site-swapped hybrids of rubredoxin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
53
structure length
53
Chain Sequence
MKKWVCTVCGYIYDEDAGDPDNGISPGTKFEELPDDWVCPLCGVGKDQFEKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rubredoxin
publication title NMR and X-ray analysis of structural additivity in metal binding site-swapped hybrids of rubredoxin
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Electron transport
total genus 10
structure length 53
sequence length 53
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2pvxA00
3PWFA 1S2ZA 2VL6A 4RXNA 4POGA 1RYTA 4ME3A 1C09A 1RDGA 2HR5A 1E8JA 1YUZA 2KN9A 1LKOA 4AR3A 5AI2A 2PVEA 2V3BB 1SMWA 1SMUA 1FHMA 1R0GA 1R0IA 1S30A 1R0JA 1QYBA 2DSXA 1R0HA 1LKMA 1T9OA 1B13A 1BQ9A 5RXNA 1T9QA 1IU6A 1ZRPA 1LTLA 2RDVA 4POFA 1H7VA 8RXNA 1VCXA 3KYXA 1RWDA 1IROA 1B2OA 1IRNA 6RXNA 1T9PA 1YK4A 4TPUA 2MS3A 3KYUA 3RYGA 3QVDA 5AI3A 3KYWA 1QCVA 1YUXA 4AR4A 1BQ8A 1NNQA 3PZAA 1CAAA 1BE7A 1S24A 7RXNA 3SS2A 1JYBA 2K2DA 1B71A 1IU5A 2KKDA 1DX8A 1B2JA 4AR5A 4AR6A 4YWMA 1SMMA 2PVXA 4K9FA 2LCQA 1LKPA 1BRFA 3A44A 3KYYA 2QL0A 3MPSA 3RZ6A 4YWLA 1BFYA 1RB9A 2M4YA 1YK5A 1R0FA 1FHHA 2GMGA 2PYAA 3RZTA 1YV1A 3KYVA 1CADA 1RDVA 1DVBA 5IY0A
chains in the Genus database with same CATH superfamily
3PWFA 1S2ZA 4TVMA 1C09A 1RDGA 3H99A 5IP7L 4BXXL 2Z3RB 3HOXL 4A3IL 2KN9A 3H9BA 2PVEA 2Z3QB 1R0IA 1R0JA 4AYBP 1QYBA 1R0HA 1ODHA 4Y52L 4QIWP 1OWBA 2XJQA 4U671 5C3EL 2H12A 3MQKB 2AYJA 2XJPA 3B08B 3KYXA 1WJVA 2XJRA 6RXNA 4A3CL 5GAGc 3ZG6A 1Y1VL 2MS3A 3K7AL 3KYUA 2CKCA 1QQTA 1Y1WL 1VZGA 1YUXA 3LWRB 4AHZA 2RFKB 3PZAA 4AI2A 4A3LL 3WWNB 5MLC3 4BBRL 3S1RL 1B2JA 1R9TL 3M4OL 2O5JD 4AR6A 5IP9L 2NVTL 2PVXA 4K9FA 3MSUA 3KYYA 2QL0A 4UY81 3PL5A 3RZ6A 3M3YL 1TWCL 3GTOL 1YK5A 2A68D 5M5WL 2E2JL 3LWQB 4ZN1B 2CR8A 5M3ML 1RDVA 1TWFL 3VPBE 3HJYB 1SFOL 3LWOB 1E8JA 2XJSA 3I4ML 1YUZA 3HOZL 2R7ZL 4C3HL 3LWPB 2V3BB 2R93L 4LHLA 4A93L 2NVXL 5DM61 3PIO1 2DSXA 1LKMA 3P2AA 2NVQL 1B13A 2Y0SP 3LPEB 4JAFA 3I4NL 2A69D 2RDVA 4Y7NL 1RWDA 1B2OA 2WB1P 3IU3I 3PO3L 1YK4A 4TPUA 5AN9H 2PMZP 4A3EL 1RYQA 5MGNA 2NYDA 5DM71 5K2ME 3QVDA 5AI3A 2PSMC 5MF6A 1NXEA 1TWAL 1I3QL 1S24A 3SS2A 5M3FL 1JYBA 4ZN3B 2K2DA 1B71A 2JA5L 3GTKL 2KKDA 4BBSL 2JA6L 2ZIXA 4YWMA 5IYCL 1IW7D 1LKPA 1BRFA 3MPSA 4AHXA 3GTGL 1I50L 2ERSA 3J7Y1 2B5ID 2L0ZA 5C44L 3FKIL 2M6PA 5GADc 3RZTA 2YU9L 3GTPL 2AUSB 1PFWA 1DVBA 3S1NL 3NFPI 4JADA 1RYTA 3FDJA 4WFN1 2HR5A 2M6OA 3PO2L 2JA8L 3LNLA 4A3DL 4AR3A 1Z92B 1SMUA 1FHMA 3K35A 1R0GA 1S30A 4JAEA 4C3IL 2PPTA 3H97A 3H0GL 1T9OA 3GTML 3GTQL 1BQ9A 3J7Z1 5IYBL 5RXNA 1LTLA 4AI3A 1H7VA 8RXNA 5M5YL 3S2DL 1VCXA 1IRNA 1T9PA 3CQZL 5JVG1 4A3JL 4A3GL 2JI3A 3RYGA 4XXBB 4BY1L 1I6HL 5JVH1 2BE5D 4V196 3KYWA 4A3ML 1QCVA 4AR4A 3H3VM 1WCML 2C6AA 3S17L 1CAAA 2A6HD 5C4JL 2E2IL 3HAXC 4JAGA 4AI0A 1NXGA 4AR5A 5MFPA 3RZDL 2WAQP 1SMMA 2LCQA 4GS7D 4AI1A 4A3BL 1BFYA 2AQCA 3WWLA 2M4YA 1R0FA 1K83L 1FHHA 5FJ8L 2PYAA 3LWVB 3KYVA 2V0EA 5MFZA 3PKJA 5IY0A 3P8BA 2JA7L 3GTJL 3PIP1 2VL6A 4RXNA 4POGA 5GAHc 4ME3A 3HOYL 1PZXA 4X6AL 1LKOA 5AI2A 2J9UB 1SMWA 2V0FA 4A3KL 3HOWL 2XJVA 3HJWB 3HOUL 2ERJA 3S1ML 5EIOC 1T9QA 1IU6A 3S16L 1ZRPA 4POFA 2VUML 1P7PA 4AHWA 3S15L 2EY4E 1IROA 1PFUA 2C6BA 3QQCE 2NVYL 3GTLL 3S1QL 1VZIA 1PFYA 2E2HL 2CKAA 3RZOL 3HKZP 3B0AB 4B8CD 4A3FL 3S14L 4AHYA 2R92L 2A6ED 5GAEc 2XJUA 5C4XL 5FLML 1BQ8A 1NNQA 2XJTA 1PFVA 2JI1A 3JR7A 1TWHL 1BE7A 3PKIA 7RXNA 4BY7L 4XGHA 1F4LA 3H9CA 1IU5A 5M5XL 1DX8A 3S2HL 2HVYC 5EINC 3HOVL 3A44A 4G6BA 2M4VA 2APOB 1OWCA 4YWLA 2B63L 1RB9A 4LHNA 2GMGA 5H1Sc 4C2M1 1TWGL 1YV1A 1VZHA 5IYDL 1CADA 4C3JL 2JI2A 4E6YA
chains in the Genus database with same CATH topology
3PWFA 1S2ZA 4TVMA 3PIP1 3NFPI 2VL6A 4RXNA 4JADA 5GAHc 4POGA 1RYTA 4ME3A 1C09A 1RDGA 4WFN1 2HR5A 2M6OA 1E8JA 2XJSA 1YUZA 2Z3RB 3LNLA 2KN9A 1LKOA 4AR3A 5AI2A 2PVEA 1Z92B 2J9UB 2V3BB 2Z3QB 1SMWA 1SMUA 2V0FA 4LHLA 1FHMA 3K35A 1R0GA 1R0IA 1S30A 1R0JA 5DM61 4JAEA 2XJVA 2PPTA 3PIO1 1QYBA 2DSXA 1R0HA 1LKMA 1T9OA 3P2AA 1ODHA 1OWBA 1B13A 2ERJA 3LPEB 2XJQA 1BQ9A 4U671 5EIOC 3J7Z1 5RXNA 4JAFA 2H12A 1T9QA 1IU6A 2AYJA 2A69D 2XJPA 1ZRPA 1LTLA 2RDVA 4AI3A 4POFA 3B08B 8RXNA 1H7VA 1VCXA 3KYXA 1WJVA 1RWDA 4AHWA 1IROA 1B2OA 1IRNA 2XJRA 3IU3I 2C6BA 6RXNA 1T9PA 1YK4A 4TPUA 3QQCE 5GAGc 5AN9H 3ZG6A 5JVG1 1VZIA 1RYQA 2MS3A 3KYUA 5MGNA 2NYDA 2CKAA 5DM71 2CKCA 2JI3A 3RYGA 5K2ME 3QVDA 4XXBB 3B0AB 4B8CD 1VZGA 5JVH1 2BE5D 5AI3A 4V196 3KYWA 2PSMC 1QCVA 4AHYA 1YUXA 2A6ED 5GAEc 2XJUA 4AR4A 5MF6A 1NXEA 4AHZA 1BQ8A 2C6AA 1NNQA 2XJTA 3PZAA 2JI1A 1CAAA 2A6HD 1BE7A 3PKIA 1S24A 4JAGA 4AI2A 3SS2A 7RXNA 4AI0A 1JYBA 1NXGA 4XGHA 4ZN3B 2K2DA 3WWNB 5MLC3 1B71A 1IU5A 2KKDA 1DX8A 1B2JA 4AR5A 2O5JD 4AR6A 2ZIXA 5MFPA 4YWMA 5EINC 1SMMA 2PVXA 4K9FA 2LCQA 1IW7D 4GS7D 3MSUA 1LKPA 1BRFA 3A44A 3KYYA 2QL0A 3MPSA 4G6BA 4AI1A 2M4VA 4UY81 3RZ6A 1OWCA 4YWLA 1BFYA 4AHXA 1RB9A 3WWLA 2M4YA 1YK5A 1R0FA 1FHHA 2ERSA 2A68D 4LHNA 3J7Y1 2GMGA 5H1Sc 2B5ID 2L0ZA 2PYAA 2M6PA 4ZN1B 5GADc 3RZTA 2CR8A 1YV1A 1VZHA 2V0EA 3KYVA 5IY0A 1CADA 1RDVA 3VPBE 5MFZA 1DVBA 2JI2A 4E6YA 3PKJA 3P8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PWF A;  1S2Z A;  2VL6 A;  4RXN A;  4POG A;  1RYT A;  4ME3 A;  1C09 A;  1RDG A;  2HR5 A;  1E8J A;  1YUZ A;  2KN9 A;  1LKO A;  4AR3 A;  5AI2 A;  2PVE A;  2V3B B;  1SMW A;  1SMU A;  1FHM A;  1R0G A;  1R0I A;  1S30 A;  1R0J A;  1QYB A;  2DSX A;  1R0H A;  1LKM A;  1T9O A;  1B13 A;  1BQ9 A;  5RXN A;  1T9Q A;  1IU6 A;  1ZRP A;  1LTL A;  2RDV A;  4POF A;  1H7V A;  8RXN A;  1VCX A;  3KYX A;  1RWD A;  1IRO A;  1B2O A;  1IRN A;  6RXN A;  1T9P A;  1YK4 A;  4TPU A;  2MS3 A;  3KYU A;  3RYG A;  3QVD A;  5AI3 A;  3KYW A;  1QCV A;  1YUX A;  4AR4 A;  1BQ8 A;  1NNQ A;  3PZA A;  1CAA A;  1BE7 A;  1S24 A;  7RXN A;  3SS2 A;  1JYB A;  2K2D A;  1B71 A;  1IU5 A;  2KKD A;  1DX8 A;  1B2J A;  4AR5 A;  4AR6 A;  4YWM A;  1SMM A;  2PVX A;  4K9F A;  2LCQ A;  1LKP A;  1BRF A;  3A44 A;  3KYY A;  2QL0 A;  3MPS A;  3RZ6 A;  4YWL A;  1BFY A;  1RB9 A;  2M4Y A;  1YK5 A;  1R0F A;  1FHH A;  2GMG A;  2PYA A;  3RZT A;  1YV1 A;  3KYV A;  1CAD A;  1RDV A;  1DVB A;  5IY0 A; 
#chains in the Genus database with same CATH topology
 3PWF A;  1S2Z A;  4TVM A;  1C09 A;  1RDG A;  3H99 A;  5IP7 L;  4BXX L;  2Z3R B;  3HOX L;  4A3I L;  2KN9 A;  3H9B A;  2PVE A;  2Z3Q B;  1R0I A;  1R0J A;  4AYB P;  1QYB A;  1R0H A;  1ODH A;  4Y52 L;  4QIW P;  1OWB A;  2XJQ A;  4U67 1;  5C3E L;  2H12 A;  3MQK B;  2AYJ A;  2XJP A;  3B08 B;  3KYX A;  1WJV A;  2XJR A;  6RXN A;  4A3C L;  5GAG c;  3ZG6 A;  1Y1V L;  2MS3 A;  3K7A L;  3KYU A;  2CKC A;  1QQT A;  1Y1W L;  1VZG A;  1YUX A;  3LWR B;  4AHZ A;  2RFK B;  3PZA A;  4AI2 A;  4A3L L;  3WWN B;  5MLC 3;  4BBR L;  3S1R L;  1B2J A;  1R9T L;  3M4O L;  2O5J D;  4AR6 A;  5IP9 L;  2NVT L;  2PVX A;  4K9F A;  3MSU A;  3KYY A;  2QL0 A;  4UY8 1;  3PL5 A;  3RZ6 A;  3M3Y L;  1TWC L;  3GTO L;  1YK5 A;  2A68 D;  5M5W L;  2E2J L;  3LWQ B;  4ZN1 B;  2CR8 A;  5M3M L;  1RDV A;  1TWF L;  3VPB E;  3HJY B;  1SFO L;  3LWO B;  1E8J A;  2XJS A;  3I4M L;  1YUZ A;  3HOZ L;  2R7Z L;  4C3H L;  3LWP B;  2V3B B;  2R93 L;  4LHL A;  4A93 L;  2NVX L;  5DM6 1;  3PIO 1;  2DSX A;  1LKM A;  3P2A A;  2NVQ L;  1B13 A;  2Y0S P;  3LPE B;  4JAF A;  3I4N L;  2A69 D;  2RDV A;  4Y7N L;  1RWD A;  1B2O A;  2WB1 P;  3IU3 I;  3PO3 L;  1YK4 A;  4TPU A;  5AN9 H;  2PMZ P;  4A3E L;  1RYQ A;  5MGN A;  2NYD A;  5DM7 1;  5K2M E;  3QVD A;  5AI3 A;  2PSM C;  5MF6 A;  1NXE A;  1TWA L;  1I3Q L;  1S24 A;  3SS2 A;  5M3F L;  1JYB A;  4ZN3 B;  2K2D A;  1B71 A;  2JA5 L;  3GTK L;  2KKD A;  4BBS L;  2JA6 L;  2ZIX A;  4YWM A;  5IYC L;  1IW7 D;  1LKP A;  1BRF A;  3MPS A;  4AHX A;  3GTG L;  1I50 L;  2ERS A;  3J7Y 1;  2B5I D;  2L0Z A;  5C44 L;  3FKI L;  2M6P A;  5GAD c;  3RZT A;  2YU9 L;  3GTP L;  2AUS B;  1PFW A;  1DVB A;  3S1N L;  3NFP I;  4JAD A;  1RYT A;  3FDJ A;  4WFN 1;  2HR5 A;  2M6O A;  3PO2 L;  2JA8 L;  3LNL A;  4A3D L;  4AR3 A;  1Z92 B;  1SMU A;  1FHM A;  3K35 A;  1R0G A;  1S30 A;  4JAE A;  4C3I L;  2PPT A;  3H97 A;  3H0G L;  1T9O A;  3GTM L;  3GTQ L;  1BQ9 A;  3J7Z 1;  5IYB L;  5RXN A;  1LTL A;  4AI3 A;  1H7V A;  8RXN A;  5M5Y L;  3S2D L;  1VCX A;  1IRN A;  1T9P A;  3CQZ L;  5JVG 1;  4A3J L;  4A3G L;  2JI3 A;  3RYG A;  4XXB B;  4BY1 L;  1I6H L;  5JVH 1;  2BE5 D;  4V19 6;  3KYW A;  4A3M L;  1QCV A;  4AR4 A;  3H3V M;  1WCM L;  2C6A A;  3S17 L;  1CAA A;  2A6H D;  5C4J L;  2E2I L;  3HAX C;  4JAG A;  4AI0 A;  1NXG A;  4AR5 A;  5MFP A;  3RZD L;  2WAQ P;  1SMM A;  2LCQ A;  4GS7 D;  4AI1 A;  4A3B L;  1BFY A;  2AQC A;  3WWL A;  2M4Y A;  1R0F A;  1K83 L;  1FHH A;  5FJ8 L;  2PYA A;  3LWV B;  3KYV A;  2V0E A;  5MFZ A;  3PKJ A;  5IY0 A;  3P8B A;  2JA7 L;  3GTJ L;  3PIP 1;  2VL6 A;  4RXN A;  4POG A;  5GAH c;  4ME3 A;  3HOY L;  1PZX A;  4X6A L;  1LKO A;  5AI2 A;  2J9U B;  1SMW A;  2V0F A;  4A3K L;  3HOW L;  2XJV A;  3HJW B;  3HOU L;  2ERJ A;  3S1M L;  5EIO C;  1T9Q A;  1IU6 A;  3S16 L;  1ZRP A;  4POF A;  2VUM L;  1P7P A;  4AHW A;  3S15 L;  2EY4 E;  1IRO A;  1PFU A;  2C6B A;  3QQC E;  2NVY L;  3GTL L;  3S1Q L;  1VZI A;  1PFY A;  2E2H L;  2CKA A;  3RZO L;  3HKZ P;  3B0A B;  4B8C D;  4A3F L;  3S14 L;  4AHY A;  2R92 L;  2A6E D;  5GAE c;  2XJU A;  5C4X L;  5FLM L;  1BQ8 A;  1NNQ A;  2XJT A;  1PFV A;  2JI1 A;  3JR7 A;  1TWH L;  1BE7 A;  3PKI A;  7RXN A;  4BY7 L;  4XGH A;  1F4L A;  3H9C A;  1IU5 A;  5M5X L;  1DX8 A;  3S2H L;  2HVY C;  5EIN C;  3HOV L;  3A44 A;  4G6B A;  2M4V A;  2APO B;  1OWC A;  4YWL A;  2B63 L;  1RB9 A;  4LHN A;  2GMG A;  5H1S c;  4C2M 1;  1TWG L;  1YV1 A;  1VZH A;  5IYD L;  1CAD A;  4C3J L;  2JI2 A;  4E6Y A; 
#chains in the Genus database with same CATH homology
 3PWF A;  1S2Z A;  4TVM A;  3PIP 1;  3NFP I;  2VL6 A;  4RXN A;  4JAD A;  5GAH c;  4POG A;  1RYT A;  4ME3 A;  1C09 A;  1RDG A;  4WFN 1;  2HR5 A;  2M6O A;  1E8J A;  2XJS A;  1YUZ A;  2Z3R B;  3LNL A;  2KN9 A;  1LKO A;  4AR3 A;  5AI2 A;  2PVE A;  1Z92 B;  2J9U B;  2V3B B;  2Z3Q B;  1SMW A;  1SMU A;  2V0F A;  4LHL A;  1FHM A;  3K35 A;  1R0G A;  1R0I A;  1S30 A;  1R0J A;  5DM6 1;  4JAE A;  2XJV A;  2PPT A;  3PIO 1;  1QYB A;  2DSX A;  1R0H A;  1LKM A;  1T9O A;  3P2A A;  1ODH A;  1OWB A;  1B13 A;  2ERJ A;  3LPE B;  2XJQ A;  1BQ9 A;  4U67 1;  5EIO C;  3J7Z 1;  5RXN A;  4JAF A;  2H12 A;  1T9Q A;  1IU6 A;  2AYJ A;  2A69 D;  2XJP A;  1ZRP A;  1LTL A;  2RDV A;  4AI3 A;  4POF A;  3B08 B;  8RXN A;  1H7V A;  1VCX A;  3KYX A;  1WJV A;  1RWD A;  4AHW A;  1IRO A;  1B2O A;  1IRN A;  2XJR A;  3IU3 I;  2C6B A;  6RXN A;  1T9P A;  1YK4 A;  4TPU A;  3QQC E;  5GAG c;  5AN9 H;  3ZG6 A;  5JVG 1;  1VZI A;  1RYQ A;  2MS3 A;  3KYU A;  5MGN A;  2NYD A;  2CKA A;  5DM7 1;  2CKC A;  2JI3 A;  3RYG A;  5K2M E;  3QVD A;  4XXB B;  3B0A B;  4B8C D;  1VZG A;  5JVH 1;  2BE5 D;  5AI3 A;  4V19 6;  3KYW A;  2PSM C;  1QCV A;  4AHY A;  1YUX A;  2A6E D;  5GAE c;  2XJU A;  4AR4 A;  5MF6 A;  1NXE A;  4AHZ A;  1BQ8 A;  2C6A A;  1NNQ A;  2XJT A;  3PZA A;  2JI1 A;  1CAA A;  2A6H D;  1BE7 A;  3PKI A;  1S24 A;  4JAG A;  4AI2 A;  3SS2 A;  7RXN A;  4AI0 A;  1JYB A;  1NXG A;  4XGH A;  4ZN3 B;  2K2D A;  3WWN B;  5MLC 3;  1B71 A;  1IU5 A;  2KKD A;  1DX8 A;  1B2J A;  4AR5 A;  2O5J D;  4AR6 A;  2ZIX A;  5MFP A;  4YWM A;  5EIN C;  1SMM A;  2PVX A;  4K9F A;  2LCQ A;  1IW7 D;  4GS7 D;  3MSU A;  1LKP A;  1BRF A;  3A44 A;  3KYY A;  2QL0 A;  3MPS A;  4G6B A;  4AI1 A;  2M4V A;  4UY8 1;  3RZ6 A;  1OWC A;  4YWL A;  1BFY A;  4AHX A;  1RB9 A;  3WWL A;  2M4Y A;  1YK5 A;  1R0F A;  1FHH A;  2ERS A;  2A68 D;  4LHN A;  3J7Y 1;  2GMG A;  5H1S c;  2B5I D;  2L0Z A;  2PYA A;  2M6P A;  4ZN1 B;  5GAD c;  3RZT A;  2CR8 A;  1YV1 A;  1VZH A;  2V0E A;  3KYV A;  5IY0 A;  1CAD A;  1RDV A;  3VPB E;  5MFZ A;  1DVB A;  2JI2 A;  4E6Y A;  3PKJ A;  3P8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...