2PVZA

Crystal structure of methylaconitate isomerase prpf from shewanella oneidensis
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
393
structure length
386
Chain Sequence
LFPPQIKVAATYMRGGTSKGVFFRLQDLPEAAQVPGPARDALLLRVIGSPDPYAKQIDGMGGATSSTSKTVILSHSSKANHDVDYLFGQVSIDKPFVDWSGNGNLTAAVGAFAISNGLIDAARIPRNGVCTVRIWQANIGKTIIAHVPITDGAVQETGDFELDGVTFPAAEVQIEFMNPAADCMFPTGNLVDVLEVPGIGRFNATMINAGIPTIFINAEDLGYTGTELQDDINSDNAALAKFETIRAHGALRMGLIKHIDEAASRQHTPKIAFVAPPKSYASSSGKTVAAEDVDLLVRALSMGKLHHAMMGTAAVAIGTAAAIPGTLVNLAAGGGEKEAVRFGHPSGTLRVGAQAVQENGEWTVIKAIMSRSARVLMEGFVRVPKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The three-dimensional crystal structure of the PrpF protein of Shewanella oneidensis complexed with trans-aconitate: insights into its biological function.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Unknown function
molecule keywords PrpF methylaconitate isomerase
total genus 96
structure length 386
sequence length 393
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04303 PrpF PrpF protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2pvzA02
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2pvzA01
4IK0A 4Q2HA 1XUAA 4K7GB 1T6KA 4IJZA 3G7KA 5IWEA 4DUNA 4JCIA 4J9XA 4K7XA 4JUUA 5M47A 3EJXA 1U1VA 4J9WA 1BWZA 4LB0A 1XUBA 1QY9A 4Q60A 1QYAA 3EKMA 3EDNA 4JBDA 2PW0A 2GKEA 1S7JA 5HA4A 1U1WA 1TM0A 1YM5A 1U1XA 5H2GA 2PVZA 1W61A 1U0KA 5H2YA 1GQZA 1W62A 3FVEA 4JD7A 2AZPA 2OTNA 2GKJA 2H9FA 2Q9JA 4K8LA 1SDJA 2Q9HA
chains in the Genus database with same CATH superfamily
4IK0A 5ANPA 5IWEA 4DUNA 4JUUA 4LB0A 1U1VA 4J9WA 1XUBA 3EKMA 4LG3A 5HA4A 3PW9A 3W5WA 2Q9JA 2ZXRA 2ZVFA 1K23A 1WPPA 1T6KA 4IJZA 4J9XA 5M47A 4RPAA 1QY9A 4GL6A 2GKEA 1S7JA 1U1WA 2PVZA 2KPTA 1GQZA 2IW4A 4JD7A 2AZPA 2OTNA 2H9FA 4K8LA 2QB7A 2ZXPA 4K7GB 2QB6A 3PTJA 1I74A 1IR6A 4K7XA 1BWZA 4PY9A 4Q60A 1QYAA 3WQZA 2HAWA 2PW0A 1YM5A 3PVHA 5H2GA 1WPMA 4OA3A 5H2YA 1W62A 2GKJA 2QB8A 4Q2HA 1K20A 1XUAA 2KW7A 3G7KA 4JCIA 3EJXA 2MPBA 2ENXA 3EDNA 3ICJA 4JBDA 2YMAA 1TM0A 1U1XA 2ZXOA 1W61A 1U0KA 4LS9A 3FVEA 3G98A 3DEVA 3IGHX 1SDJA 2LT2A 2EB0A 2Q9HA
chains in the Genus database with same CATH topology
4IK0A 5ANPA 5IWEA 4DUNA 4JUUA 4LB0A 1U1VA 4J9WA 1XUBA 3EKMA 4LG3A 5HA4A 3PW9A 3W5WA 2Q9JA 2ZXRA 2ZVFA 1K23A 1WPPA 1T6KA 4IJZA 4J9XA 5M47A 4RPAA 1QY9A 4GL6A 2GKEA 1S7JA 1U1WA 2PVZA 2KPTA 1GQZA 2IW4A 4JD7A 2AZPA 2OTNA 2H9FA 4K8LA 2QB7A 2ZXPA 4K7GB 2QB6A 3PTJA 1I74A 1IR6A 4K7XA 1BWZA 4PY9A 4Q60A 1QYAA 3WQZA 2HAWA 2PW0A 1YM5A 3PVHA 5H2GA 1WPMA 4OA3A 5H2YA 1W62A 2GKJA 2QB8A 4Q2HA 1K20A 1XUAA 2KW7A 3G7KA 4JCIA 3EJXA 2MPBA 2ENXA 3EDNA 3ICJA 4JBDA 2YMAA 1TM0A 1U1XA 2ZXOA 1W61A 1U0KA 4LS9A 3FVEA 3G98A 3DEVA 3IGHX 1SDJA 2LT2A 2EB0A 2Q9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IK0 A;  4Q2H A;  1XUA A;  4K7G B;  1T6K A;  4IJZ A;  3G7K A;  5IWE A;  4DUN A;  4JCI A;  4J9X A;  4K7X A;  4JUU A;  5M47 A;  3EJX A;  1U1V A;  4J9W A;  1BWZ A;  4LB0 A;  1XUB A;  1QY9 A;  4Q60 A;  1QYA A;  3EKM A;  3EDN A;  4JBD A;  2PW0 A;  2GKE A;  1S7J A;  5HA4 A;  1U1W A;  1TM0 A;  1YM5 A;  1U1X A;  5H2G A;  2PVZ A;  1W61 A;  1U0K A;  5H2Y A;  1GQZ A;  1W62 A;  3FVE A;  4JD7 A;  2AZP A;  2OTN A;  2GKJ A;  2H9F A;  2Q9J A;  4K8L A;  1SDJ A;  2Q9H A; 
#chains in the Genus database with same CATH topology
 4IK0 A;  5ANP A;  5IWE A;  4DUN A;  4JUU A;  4LB0 A;  1U1V A;  4J9W A;  1XUB A;  3EKM A;  4LG3 A;  5HA4 A;  3PW9 A;  3W5W A;  2Q9J A;  2ZXR A;  2ZVF A;  1K23 A;  1WPP A;  1T6K A;  4IJZ A;  4J9X A;  5M47 A;  4RPA A;  1QY9 A;  4GL6 A;  2GKE A;  1S7J A;  1U1W A;  2PVZ A;  2KPT A;  1GQZ A;  2IW4 A;  4JD7 A;  2AZP A;  2OTN A;  2H9F A;  4K8L A;  2QB7 A;  2ZXP A;  4K7G B;  2QB6 A;  3PTJ A;  1I74 A;  1IR6 A;  4K7X A;  1BWZ A;  4PY9 A;  4Q60 A;  1QYA A;  3WQZ A;  2HAW A;  2PW0 A;  1YM5 A;  3PVH A;  5H2G A;  1WPM A;  4OA3 A;  5H2Y A;  1W62 A;  2GKJ A;  2QB8 A;  4Q2H A;  1K20 A;  1XUA A;  2KW7 A;  3G7K A;  4JCI A;  3EJX A;  2MPB A;  2ENX A;  3EDN A;  3ICJ A;  4JBD A;  2YMA A;  1TM0 A;  1U1X A;  2ZXO A;  1W61 A;  1U0K A;  4LS9 A;  3FVE A;  3G98 A;  3DEV A;  3IGH X;  1SDJ A;  2LT2 A;  2EB0 A;  2Q9H A; 
#chains in the Genus database with same CATH homology
 4IK0 A;  5ANP A;  5IWE A;  4DUN A;  4JUU A;  4LB0 A;  1U1V A;  4J9W A;  1XUB A;  3EKM A;  4LG3 A;  5HA4 A;  3PW9 A;  3W5W A;  2Q9J A;  2ZXR A;  2ZVF A;  1K23 A;  1WPP A;  1T6K A;  4IJZ A;  4J9X A;  5M47 A;  4RPA A;  1QY9 A;  4GL6 A;  2GKE A;  1S7J A;  1U1W A;  2PVZ A;  2KPT A;  1GQZ A;  2IW4 A;  4JD7 A;  2AZP A;  2OTN A;  2H9F A;  4K8L A;  2QB7 A;  2ZXP A;  4K7G B;  2QB6 A;  3PTJ A;  1I74 A;  1IR6 A;  4K7X A;  1BWZ A;  4PY9 A;  4Q60 A;  1QYA A;  3WQZ A;  2HAW A;  2PW0 A;  1YM5 A;  3PVH A;  5H2G A;  1WPM A;  4OA3 A;  5H2Y A;  1W62 A;  2GKJ A;  2QB8 A;  4Q2H A;  1K20 A;  1XUA A;  2KW7 A;  3G7K A;  4JCI A;  3EJX A;  2MPB A;  2ENX A;  3EDN A;  3ICJ A;  4JBD A;  2YMA A;  1TM0 A;  1U1X A;  2ZXO A;  1W61 A;  1U0K A;  4LS9 A;  3FVE A;  3G98 A;  3DEV A;  3IGH X;  1SDJ A;  2LT2 A;  2EB0 A;  2Q9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...