2PW0A

Crystal structure of trans-aconitate bound to methylaconitate isomerase prpf from shewanella oneidensis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
392
structure length
385
Chain Sequence
FPPQIKVAATYMRGGTSKGVFFRLQDLPEAAQVPGPARDALLLRVIGSPDPYAKQIDGMGGATSSTSKTVILSHSSKANHDVDYLFGQVSIDKPFVDWSGNCGNLTAAVGAFAISNGLIDAARIPRNGVCTVRIWQANIGKTIIAHVPITDGAVQETGDFELDGVTFPAAEVQIEFMNPAADMFPTGNLVDVLEVPGIGRFNATMINAGIPTIFINAEDLGYTGTELQDDINSDNAALAKFETIRAHGALRMGLIKHIDEAASRQHTPKIAFVAPPKSYASSSGKTVAAEDVDLLVRALSMGKLHHAMMGTAAVAIGTAAAIPGTLVNLAAGGGEKEAVRFGHPSGTLRVGAQAVQENGEWTVIKAIMSRSARVLMEGFVRVPKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The three-dimensional crystal structure of the PrpF protein of Shewanella oneidensis complexed with trans-aconitate: insights into its biological function.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Unknown function
molecule keywords PrpF methylaconitate isomerase
total genus 97
structure length 385
sequence length 392
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04303 PrpF PrpF protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2pw0A02
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2pw0A01
4K7XA 1U0KA 2OTNA 1U1XA 1S7JA 5M47A 4Q2HA 1QY9A 1U1VA 4J9WA 4K8LA 5HA4A 5H2YA 4LB0A 2H9FA 4JUUA 2PVZA 1W61A 1XUAA 3FVEA 2GKEA 3G7KA 1GQZA 1YM5A 4Q60A 1W62A 1TM0A 4JCIA 4JD7A 1QYAA 4DUNA 4JBDA 1SDJA 3EKMA 3EDNA 4IJZA 2PW0A 1U1WA 4K7GB 2Q9HA 1XUBA 1BWZA 1T6KA 3EJXA 5IWEA 4IK0A 4J9XA 5H2GA 2GKJA 2AZPA 2Q9JA
chains in the Genus database with same CATH superfamily
2OTNA 3ICJA 5H2YA 2H9FA 4JUUA 1WPPA 3IGHX 2ZXRA 3FVEA 4DUNA 2KPTA 3EDNA 2IW4A 2PW0A 2KW7A 2Q9HA 2YMAA 2GKJA 2AZPA 2ZXPA 4LG3A 1S7JA 4J9WA 1U1VA 4K8LA 5HA4A 4LB0A 4LS9A 1W61A 2GKEA 1GQZA 1W62A 4JD7A 3G98A 3PTJA 3EKMA 1WPMA 1U1WA 3PW9A 4K7GB 1XUBA 1BWZA 4OA3A 2QB6A 4IK0A 3W5WA 1U1XA 2EB0A 5M47A 1QY9A 2ENXA 3WQZA 2PVZA 3PVHA 2QB7A 3G7KA 4Q60A 2ZVFA 1QYAA 2LT2A 4JBDA 4GL6A 5ANPA 4RPAA 2MPBA 2HAWA 1T6KA 5IWEA 4J9XA 3DEVA 2Q9JA 4K7XA 1U0KA 1K20A 4Q2HA 4PY9A 1XUAA 1IR6A 1YM5A 1TM0A 4JCIA 1K23A 1SDJA 4IJZA 1I74A 2ZXOA 2QB8A 3EJXA 5H2GA
chains in the Genus database with same CATH topology
2OTNA 3ICJA 5H2YA 2H9FA 4JUUA 1WPPA 3IGHX 2ZXRA 3FVEA 4DUNA 2KPTA 3EDNA 2IW4A 2PW0A 2KW7A 2Q9HA 2YMAA 2GKJA 2AZPA 2ZXPA 4LG3A 1S7JA 4J9WA 1U1VA 4K8LA 5HA4A 4LB0A 4LS9A 1W61A 2GKEA 1GQZA 1W62A 4JD7A 3G98A 3PTJA 3EKMA 1WPMA 1U1WA 3PW9A 4K7GB 1XUBA 1BWZA 4OA3A 2QB6A 4IK0A 3W5WA 1U1XA 2EB0A 5M47A 1QY9A 2ENXA 3WQZA 2PVZA 3PVHA 2QB7A 3G7KA 4Q60A 2ZVFA 1QYAA 2LT2A 4JBDA 4GL6A 5ANPA 4RPAA 2MPBA 2HAWA 1T6KA 5IWEA 4J9XA 3DEVA 2Q9JA 4K7XA 1U0KA 1K20A 4Q2HA 4PY9A 1XUAA 1IR6A 1YM5A 1TM0A 4JCIA 1K23A 1SDJA 4IJZA 1I74A 2ZXOA 2QB8A 3EJXA 5H2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K7X A;  1U0K A;  2OTN A;  1U1X A;  1S7J A;  5M47 A;  4Q2H A;  1QY9 A;  1U1V A;  4J9W A;  4K8L A;  5HA4 A;  5H2Y A;  4LB0 A;  2H9F A;  4JUU A;  2PVZ A;  1W61 A;  1XUA A;  3FVE A;  2GKE A;  3G7K A;  1GQZ A;  1YM5 A;  4Q60 A;  1W62 A;  1TM0 A;  4JCI A;  4JD7 A;  1QYA A;  4DUN A;  4JBD A;  1SDJ A;  3EKM A;  3EDN A;  4IJZ A;  2PW0 A;  1U1W A;  4K7G B;  2Q9H A;  1XUB A;  1BWZ A;  1T6K A;  3EJX A;  5IWE A;  4IK0 A;  4J9X A;  5H2G A;  2GKJ A;  2AZP A;  2Q9J A; 
#chains in the Genus database with same CATH topology
 2OTN A;  3ICJ A;  5H2Y A;  2H9F A;  4JUU A;  1WPP A;  3IGH X;  2ZXR A;  3FVE A;  4DUN A;  2KPT A;  3EDN A;  2IW4 A;  2PW0 A;  2KW7 A;  2Q9H A;  2YMA A;  2GKJ A;  2AZP A;  2ZXP A;  4LG3 A;  1S7J A;  4J9W A;  1U1V A;  4K8L A;  5HA4 A;  4LB0 A;  4LS9 A;  1W61 A;  2GKE A;  1GQZ A;  1W62 A;  4JD7 A;  3G98 A;  3PTJ A;  3EKM A;  1WPM A;  1U1W A;  3PW9 A;  4K7G B;  1XUB A;  1BWZ A;  4OA3 A;  2QB6 A;  4IK0 A;  3W5W A;  1U1X A;  2EB0 A;  5M47 A;  1QY9 A;  2ENX A;  3WQZ A;  2PVZ A;  3PVH A;  2QB7 A;  3G7K A;  4Q60 A;  2ZVF A;  1QYA A;  2LT2 A;  4JBD A;  4GL6 A;  5ANP A;  4RPA A;  2MPB A;  2HAW A;  1T6K A;  5IWE A;  4J9X A;  3DEV A;  2Q9J A;  4K7X A;  1U0K A;  1K20 A;  4Q2H A;  4PY9 A;  1XUA A;  1IR6 A;  1YM5 A;  1TM0 A;  4JCI A;  1K23 A;  1SDJ A;  4IJZ A;  1I74 A;  2ZXO A;  2QB8 A;  3EJX A;  5H2G A; 
#chains in the Genus database with same CATH homology
 2OTN A;  3ICJ A;  5H2Y A;  2H9F A;  4JUU A;  1WPP A;  3IGH X;  2ZXR A;  3FVE A;  4DUN A;  2KPT A;  3EDN A;  2IW4 A;  2PW0 A;  2KW7 A;  2Q9H A;  2YMA A;  2GKJ A;  2AZP A;  2ZXP A;  4LG3 A;  1S7J A;  4J9W A;  1U1V A;  4K8L A;  5HA4 A;  4LB0 A;  4LS9 A;  1W61 A;  2GKE A;  1GQZ A;  1W62 A;  4JD7 A;  3G98 A;  3PTJ A;  3EKM A;  1WPM A;  1U1W A;  3PW9 A;  4K7G B;  1XUB A;  1BWZ A;  4OA3 A;  2QB6 A;  4IK0 A;  3W5W A;  1U1X A;  2EB0 A;  5M47 A;  1QY9 A;  2ENX A;  3WQZ A;  2PVZ A;  3PVH A;  2QB7 A;  3G7K A;  4Q60 A;  2ZVF A;  1QYA A;  2LT2 A;  4JBD A;  4GL6 A;  5ANP A;  4RPA A;  2MPB A;  2HAW A;  1T6K A;  5IWE A;  4J9X A;  3DEV A;  2Q9J A;  4K7X A;  1U0K A;  1K20 A;  4Q2H A;  4PY9 A;  1XUA A;  1IR6 A;  1YM5 A;  1TM0 A;  4JCI A;  1K23 A;  1SDJ A;  4IJZ A;  1I74 A;  2ZXO A;  2QB8 A;  3EJX A;  5H2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...