2PW0A

Crystal structure of trans-aconitate bound to methylaconitate isomerase prpf from shewanella oneidensis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
392
structure length
385
Chain Sequence
FPPQIKVAATYMRGGTSKGVFFRLQDLPEAAQVPGPARDALLLRVIGSPDPYAKQIDGMGGATSSTSKTVILSHSSKANHDVDYLFGQVSIDKPFVDWSGNCGNLTAAVGAFAISNGLIDAARIPRNGVCTVRIWQANIGKTIIAHVPITDGAVQETGDFELDGVTFPAAEVQIEFMNPAADMFPTGNLVDVLEVPGIGRFNATMINAGIPTIFINAEDLGYTGTELQDDINSDNAALAKFETIRAHGALRMGLIKHIDEAASRQHTPKIAFVAPPKSYASSSGKTVAAEDVDLLVRALSMGKLHHAMMGTAAVAIGTAAAIPGTLVNLAAGGGEKEAVRFGHPSGTLRVGAQAVQENGEWTVIKAIMSRSARVLMEGFVRVPKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The three-dimensional crystal structure of the PrpF protein of Shewanella oneidensis complexed with trans-aconitate: insights into its biological function.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Unknown function
molecule keywords PrpF methylaconitate isomerase
total genus 97
structure length 385
sequence length 392
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04303 PrpF PrpF protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2pw0A02
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2pw0A01
2GKEA 2Q9HA 1GQZA 2PW0A 1TM0A 1U1WA 1YM5A 5M47A 3EKMA 5HA4A 1QY9A 4J9WA 4JD7A 4JBDA 4IK0A 2H9FA 1SDJA 4LB0A 5H2GA 4K7XA 3FVEA 1T6KA 2PVZA 4K8LA 4DUNA 5IWEA 4JUUA 1XUAA 1S7JA 4Q2HA 3EJXA 2GKJA 5H2YA 3EDNA 2Q9JA 1U1VA 1U1XA 1W61A 1QYAA 1W62A 4J9XA 1BWZA 4JCIA 2OTNA 2AZPA 3G7KA 4Q60A 4K7GB 1U0KA 1XUBA 4IJZA
chains in the Genus database with same CATH superfamily
2GKEA 4JD7A 4JBDA 4IK0A 2H9FA 1IR6A 4DUNA 5IWEA 1XUAA 3EDNA 3ICJA 4GL6A 1W61A 1QYAA 4JCIA 2QB8A 2QB6A 3G7KA 4Q60A 3IGHX 1U0KA 2PW0A 1TM0A 3EKMA 3G98A 3W5WA 1SDJA 4LB0A 2PVZA 4OA3A 4Q2HA 5H2YA 2Q9JA 2KPTA 1BWZA 4K7GB 1U1WA 5M47A 2Q9HA 1GQZA 1YM5A 3WQZA 4J9WA 2MPBA 2LT2A 2ZXRA 2ZVFA 5H2GA 1WPMA 4K7XA 3FVEA 1T6KA 3PTJA 1K20A 4JUUA 3PVHA 2KW7A 3EJXA 2GKJA 2QB7A 4LS9A 1K23A 2AZPA 4PY9A 1XUBA 4IJZA 5ANPA 5HA4A 2ZXOA 1QY9A 2EB0A 2YMAA 2ZXPA 4LG3A 2HAWA 4K8LA 2ENXA 4RPAA 3DEVA 1S7JA 3PW9A 2IW4A 1U1VA 1U1XA 1W62A 1WPPA 4J9XA 2OTNA 1I74A
chains in the Genus database with same CATH topology
2GKEA 4JD7A 4JBDA 4IK0A 2H9FA 1IR6A 4DUNA 5IWEA 1XUAA 3EDNA 3ICJA 4GL6A 1W61A 1QYAA 4JCIA 2QB8A 2QB6A 3G7KA 4Q60A 3IGHX 1U0KA 2PW0A 1TM0A 3EKMA 3G98A 3W5WA 1SDJA 4LB0A 2PVZA 4OA3A 4Q2HA 5H2YA 2Q9JA 2KPTA 1BWZA 4K7GB 1U1WA 5M47A 2Q9HA 1GQZA 1YM5A 3WQZA 4J9WA 2MPBA 2LT2A 2ZXRA 2ZVFA 5H2GA 1WPMA 4K7XA 3FVEA 1T6KA 3PTJA 1K20A 4JUUA 3PVHA 2KW7A 3EJXA 2GKJA 2QB7A 4LS9A 1K23A 2AZPA 4PY9A 1XUBA 4IJZA 5ANPA 5HA4A 2ZXOA 1QY9A 2EB0A 2YMAA 2ZXPA 4LG3A 2HAWA 4K8LA 2ENXA 4RPAA 3DEVA 1S7JA 3PW9A 2IW4A 1U1VA 1U1XA 1W62A 1WPPA 4J9XA 2OTNA 1I74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GKE A;  2Q9H A;  1GQZ A;  2PW0 A;  1TM0 A;  1U1W A;  1YM5 A;  5M47 A;  3EKM A;  5HA4 A;  1QY9 A;  4J9W A;  4JD7 A;  4JBD A;  4IK0 A;  2H9F A;  1SDJ A;  4LB0 A;  5H2G A;  4K7X A;  3FVE A;  1T6K A;  2PVZ A;  4K8L A;  4DUN A;  5IWE A;  4JUU A;  1XUA A;  1S7J A;  4Q2H A;  3EJX A;  2GKJ A;  5H2Y A;  3EDN A;  2Q9J A;  1U1V A;  1U1X A;  1W61 A;  1QYA A;  1W62 A;  4J9X A;  1BWZ A;  4JCI A;  2OTN A;  2AZP A;  3G7K A;  4Q60 A;  4K7G B;  1U0K A;  1XUB A;  4IJZ A; 
#chains in the Genus database with same CATH topology
 2GKE A;  4JD7 A;  4JBD A;  4IK0 A;  2H9F A;  1IR6 A;  4DUN A;  5IWE A;  1XUA A;  3EDN A;  3ICJ A;  4GL6 A;  1W61 A;  1QYA A;  4JCI A;  2QB8 A;  2QB6 A;  3G7K A;  4Q60 A;  3IGH X;  1U0K A;  2PW0 A;  1TM0 A;  3EKM A;  3G98 A;  3W5W A;  1SDJ A;  4LB0 A;  2PVZ A;  4OA3 A;  4Q2H A;  5H2Y A;  2Q9J A;  2KPT A;  1BWZ A;  4K7G B;  1U1W A;  5M47 A;  2Q9H A;  1GQZ A;  1YM5 A;  3WQZ A;  4J9W A;  2MPB A;  2LT2 A;  2ZXR A;  2ZVF A;  5H2G A;  1WPM A;  4K7X A;  3FVE A;  1T6K A;  3PTJ A;  1K20 A;  4JUU A;  3PVH A;  2KW7 A;  3EJX A;  2GKJ A;  2QB7 A;  4LS9 A;  1K23 A;  2AZP A;  4PY9 A;  1XUB A;  4IJZ A;  5ANP A;  5HA4 A;  2ZXO A;  1QY9 A;  2EB0 A;  2YMA A;  2ZXP A;  4LG3 A;  2HAW A;  4K8L A;  2ENX A;  4RPA A;  3DEV A;  1S7J A;  3PW9 A;  2IW4 A;  1U1V A;  1U1X A;  1W62 A;  1WPP A;  4J9X A;  2OTN A;  1I74 A; 
#chains in the Genus database with same CATH homology
 2GKE A;  4JD7 A;  4JBD A;  4IK0 A;  2H9F A;  1IR6 A;  4DUN A;  5IWE A;  1XUA A;  3EDN A;  3ICJ A;  4GL6 A;  1W61 A;  1QYA A;  4JCI A;  2QB8 A;  2QB6 A;  3G7K A;  4Q60 A;  3IGH X;  1U0K A;  2PW0 A;  1TM0 A;  3EKM A;  3G98 A;  3W5W A;  1SDJ A;  4LB0 A;  2PVZ A;  4OA3 A;  4Q2H A;  5H2Y A;  2Q9J A;  2KPT A;  1BWZ A;  4K7G B;  1U1W A;  5M47 A;  2Q9H A;  1GQZ A;  1YM5 A;  3WQZ A;  4J9W A;  2MPB A;  2LT2 A;  2ZXR A;  2ZVF A;  5H2G A;  1WPM A;  4K7X A;  3FVE A;  1T6K A;  3PTJ A;  1K20 A;  4JUU A;  3PVH A;  2KW7 A;  3EJX A;  2GKJ A;  2QB7 A;  4LS9 A;  1K23 A;  2AZP A;  4PY9 A;  1XUB A;  4IJZ A;  5ANP A;  5HA4 A;  2ZXO A;  1QY9 A;  2EB0 A;  2YMA A;  2ZXP A;  4LG3 A;  2HAW A;  4K8L A;  2ENX A;  4RPA A;  3DEV A;  1S7J A;  3PW9 A;  2IW4 A;  1U1V A;  1U1X A;  1W62 A;  1WPP A;  4J9X A;  2OTN A;  1I74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...