2PW7A

Crystal structure of staphylococcal nuclease variant v66y/p117g/h124l/s128a at 100k
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
130
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKVEKYGPEASAFTKKMYENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystallographic study of hydration of an internal cavity in engineered proteins with buried polar or ionizable groups.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 130
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2pw7A00
5NUCA 1A3UA 2EYLA 5I6WA 4ZUIA 4F7XA 1SNMA 2F0QA 3SK5A 3BDLA 5IGEA 5KYIA 4B9XA 5J22A 3TP6A 2F0NA 4G57A 1ENCA 1KDCA 1A3TA 5IOCA 2PW7A 2WACA 3SK4A 1EY8A 2F0OA 3C1EA 3HZXA 3NK9A 4KY7A 4RKLA 5CV8A 2EY5A 3SK6A 3TMEA 3NQTA 5I6YA 1SNQA 4KY6A 5C3WA 1KDAA 4K5WA 1U9RA 2PYKA 4ZQ3A 3ITPA 3LX0A 3SXHA 3S9WA 2SOBA 2OEOA 1EQVA 2EYPA 4J6HA 5CV4A 1SNOA 4PNYA 5IGCA 2EY2A 3RUZA 4IUNA 4J1MA 3EROA 4DF7A 3MXPA 4ODGA 2RBMA 2OXPA 3OWFA 4IALA 4WRDA 3TP5A 4ZUJA 4NKLA 3NUCA 3T13A 1JORA 2QDBA 4KJNA 3SHLA 3P75A 2KHSA 1TT2A 4PMCA 3T16A 2F0FA 5CV9A 5JOBA 1A2TA 4K5XA 2EY1A 2PQEA 1A2UA 3NHHA 3C1FA 1IHZA 3QB3A 1EY4A 1TQOA 3QOJA 4KY5A 4QB4A 4DFAA 4ME5A 3BDCA 4EVOA 3D4DA 3DMUA 5I9OA 1EYCA 2F0EA 1A3VA 4NMZA 5KRUA 2M00A 5KEEA 1SYEA 2F0TA 2RDFA 3NXWA 4K6DA 2F0DA 1SYGA 4KD3A 3MVVA 4HMJA 1KABA 1SYBA 2PZTA 2RKSA 4EQOA 5CR3A 3EJIA 2SNSA 4OL7A 4H7BA 4K8JA 1F2MA 2LKVA 3ERQA 1EYAA 4KJOA 5DAUA 3QOLA 4N9TA 5M9OA 4TRDA 4HMIA 4KV6A 2OF1A 3TP8A 5EKKA 4DU9A 4DGZA 5CGKA 1EZ8A 1EY6A 1STYA 2NUCA 3D4WA 3MHBA 4S3SA 5E3FA 5C5MA 1RKNA 1JOKA 1SNPA 1SNDA 2F0VA 3TP7A 5I9PA 4K8IA 2F0UA 1F2YA 1SYCA 4B9WA 2EYFA 4PMBA 1KAAA 5C3XA 1SYFA 3P1HA 4E6IA 4KTAA 3HEJA 1STBA 4I65A 4ID6A 3VA5A 5C4HA 4RKBA 2EXZA 4F8MA 3SR1A 5IGBA 5EKLA 2F0KA 2EYOA 3OMGA 5C6AA 5ISRA 5KYLA 5KIXA 5K5PA 1JOQA 4N9PA 4MIUA 1JOOA 1EZ6A 3R3OA 1STHA 5HURA 5IGDA 4WORA 3SK8A 1EYDA 1SNCA 2F0GA 5J1ZA 5J39A 2F0PA 3E5SA 3MZ5A 1EY0A 5IGFA 1STAA 3PMFA 5CV7A 4NP5A 1STNA 2F3VA 4LAAA 5CC4A 4EQNA 3D6CA 1F2ZA 1NUCA 2F0SA 3OMCA 3H6MA 1SYDA 5CV5A 5CV6A 5DEHA 5C5LA 2EYJA 3U9OA 3DHQA 1AEXA 2EYHA 3MEHA 4K5VA 2F0JA 2PZUA 3OSOA 2F0WA 2F3WA 5F2DA 2F0LA 5C4ZA 5E1FA 4QF4A 4KHVA 1NSNS 5IODA 2PZWA 3EVQA 4HTHA 1ENAA 2KQ3A 4QMGA 2F0HA 2HQEA 1EY9A 4IZ8A 2ENBA 2SNMA 2EYMA 1EY7A 2EY6A 5KGUA 1KDBA 2O4XA 1STGA 3NP8A 4K2KA 3D8GA 4NDXA 4YIJA 5JAVA 5EGTA 2PW5A 5IGGA 2F0MA 5HGTA 4K2LA 1TR5A 2F0IA 1EY5A 3V2TA 5IIFA 4KD4A 4R8NA 1II3A 4EQPA 4K14A
chains in the Genus database with same CATH superfamily
4XQQA 2A8VA 1VMPA 4LUOA 3H0GG 3A8IE 3NE5B 1XMOL 1K0RA 3T1YQ 3F2BA 3EBEA 3FDTA 1X3PA 4DV0L 1V43A 5A2QE 1R4QB 2G9DA 4XT1B 3S17H 4ZQ3A 2KHIA 1VF5C 1HNWL 1EQVA 1KXLA 4LUVA 4X64L 2ICIA 3GTGH 4HSVA 4WRDA 5EPLA 3PIP3 1OXUA 1DOKA 4ZUJA 3DWQA 3GTJB 2QDBA 4HJ9A 3GTPB 1EOVA 1PTOF 3CC2A 2F0FA 2V1CC 3OW7A 1PA6A 4YY3L 3IFDA 5G3LD 1D7QA 2ZJRA 2IWHA 2O5JC 3GTQB 1E2VA 1QNUA 3H3VH 3HOZH 5KEEA 5C44G 1DGSA 2F1MA 4OIJA 1XWEA 3A8JE 4L5QA 4LF6L 5IT9c 4H7BA 3M4QA 1U4LA 3MAQA 2D62A 5I2XA 4QJFA 3JAMc 5C5MA 2DY7A 4E6IA 3I8ZA 3OIPA 3SR1A 2B8GA 2F0KA 1IBML 4PZ7A 4C3IG 5T1IA 1CZWA 4JK1C 5IWAL 2RA4A 2CCZA 1Q86C 1YJWA 1GUSA 1RTNA 2ZXRA 2VQFQ 5CV7A 4JI7L 3PUYA 1PZID 5ELFA 4FXDA 1L2FA 4C1NK 3GP7A 2CQOA 5C5LA 1GUWA 4Q5VA 2ZJPA 1VQCA 2MJ8A 3DXJC 4HIMA 1LTGD 1N33Q 3PIOA 3CPFA 4A3JH 3ND8A 1YZ6A 1EOTA 4GLAC 1IZ6A 2KJXA 4ZRZA 4KI0A 1PH5A 5A2QL 5EBDA 4A3DB 2IJ0A 1LTID 1X65A 2PQAA 1B4OA 2Q2UA 3S1QH 1UE7A 2F0IA 4FXKC 1NJIC 1V1OA 3CRLC 1HQRD 2EYLA 5I6WA 5IGEA 5KYIA 3HKZE 5IOCA 3UDFA 1YNXA 4KKUA 1X32A 1LABA 1U9RA 1Q12A 4DV6L 5IYDG 3Q24A 1Y8NB 2QF7A 2SOBA 3MWYW 5JEAH 5C4XH 1HNZL 4BY7G 1CA5A 1SSOA 3OWFA 2Z6BA 5ELOA 4KN4C 2ZM6L 1TY2A 3PV0A 2MHVA 4ZLTF 2NVQB 1Q81C 5AJ3Q 3UI2A 4NXML 4IPCA 3E9IA 5JOBA 1A2TA 3URYA 5JVG3 2UUAQ 4C3HG 1BNZA 3PO2G 4IO9A 4JCVE 4QUCA 5GROA 3T4AC 3DMUA 2VUMH 2RDHA 2XRSD 2F0TA 1L0WA 1BVSA 1OO9B 3RZDH 1QVFA 3T53B 4XT3B 2FHTA 3TZDA 2YV5A 2F52A 3NTIA 3CXCA 1KNAA 4J15A 4H0LC 2E2JB 4DUYL 2OT2A 4JYAL 1B70B 1UE1A 4DV3L 3NWTA 3MXUA 1RKNA 1ZYRC 1JJ2A 4HJ5A 4HIOA 1A0IA 4A3MG 1KD1C 2B63B 3EQLC 4DAPA 2AWOA 5EKLA 5FO8B 1VQKA 1WOCA 3V96A 1V8QA 2EYOA 4V0BA 3K0YA 3AFPA 3CAMA 4DR3L 3M4OB 2CHBD 2LS01 1K28A 1N9WA 4NXNL 4B3TQ 4LWCA 4DXGA 2F0GA 4DV2L 1IL8A 1CQFA 3K7AB 4FF3A 4GKJL 1UAPA 3E5SA 3O13A 3AEVA 2K5QA 3MFGA 5IP9G 3SDZA 1TWGH 1E22A 4DK3C 4DNIA 4TSSA 2JSOA 1RDPD 1LO5D 2JK8A 1I6HB 3RD4A 4CDCC 3ICEA 2JQOA 3E3XA 3NWSA 4A3KB 3HGBA 5IODA 1GJXA 1GOZA 3G7LA 2EPBA 1VS0A 4CDFC 4DR6Q 1YNND 1EY7A 2DY8A 2EY6A 3T1HQ 1CKMA 3I90A 3M4PA 4YIJA 1Y1WG 3HOXG 3RNUA 2E2IH 2NVTB 2PQAB 2AQ1B 1BUVT 3KJOA 1Z6HA 1SEBD 1A3UA 4DV7Q 2KCTA 3J7A5 2WACA 3VDYA 4POFA 1Q8IA 2DGYA 5JEAJ 2GN5A 4YWMA 5GADC 5JPNC 4BA2I 3PCOB 1KTKA 3CCVA 1D5ZC 2B2WC 2ICEC 1EQRA 3LWEA 1SNOA 4PNYA 3SVMA 4HIDA 4IUNA 5CGKA 2WB1G 4LFCQ 1KC8C 3NUCA 4RHRA 5M5XB 2EJFC 4A4IA 1G2SA 2X69A 1S5CD 1LACA 1B1ZA 3LNNA 3NHHA 3W1BA 1SFOB 3J7YW 1SRUA 1E3PA 4OGQC 1CFMA 2B2WA 2UXCL 1I4HA 1SYEA 1NR2A 1OXSC 1D5XC 4HCEA 1SYGA 1KABA 2PZTA 4P74A 4A93B 1QNKA 2K5VA 3EJIA 5LMNL 4K8JA 4A3JG 3BJUA 1PXUA 2QEXA 3BYTB 3VYRA 1EY6A 3R2TA 1G291 2D0OA 2F0UA 3IL8A 2XVSA 5FLMG 1SYFA 2Q8IB 2Z6KA 1QVCA 2MP1A 3I56A 4CKCA 5KIXA 1EU3A 2XN9C 1LT3D 2HIXA 2J4XA 2A69D 4MTKA 1KAWA 2L5TA 1FJGL 3FKIG 5K36G 1VQHA 2F4VL 4ULLA 5C4XG 3VR4A 5C0XG 4KMUC 3KLRA 3DHQA 3ND9A 2NZ1D 4R8IA 3K81C 1I94L 4QF4A 2ZTEA 1VQFA 2LXJA 4QMGA 4CBVA 1ICWA 1V1PA 3S15B 5KGUA 4A3DG 4KHZA 1HNXQ 3A54A 3G6JB 4GKKL 4H13C 3TSSA 3V2TA 4DV5L 5BR8Q 1TY0A 5EKIA 4A3EH 5DLQE 5C4JB 2PW7A 2LMCB 3HZXA 2GA4B 4PZ8A 4JOIC 1B9MA 4CDEC 3ZJYC 2I07B 3S1MB 4WJ3M 1KDAA 2RSOA 2PYKA 3S9WA 2K5NA 5LMUL 4ODGA 1N8RC 2MGSA 4FNFA 3MFYA 1PYSB 4HAEA 3RN5A 4NKLA 1KRSA 3T51B 1JT8A 2NZHA 4JOIA 5FLXE 2EY1A 3AFQA 2PQEA 3H0GB 3Q0AA 3C1FA 3T56B 1PRTC 2RHQB 3BDCA 1EYCA 2R93B 4X3SA 2KOLA 2IHFA 5M3MG 2ZJQA 3MXNA 5ELBA 1EYGA 2ZXPA 2JA9A 4LUZA 3QJYA 1YI2A 3CCLA 1D5MC 4UP7A 2QA4A 3WDNA 1JB7A 4ZKCB 3HOWB 3BS1A 1SROA 5EKKA 4RHSA 3L2PA 1JOKA 4O1NA 3OWEB 5BN5A 2XWJB 1K73C 3T1YL 1AE2A 4I7ZC 1K0SA 2Q8TA 1TS3A 2L11A 4DR2Q 1HA5A 3OMGA 5EPJA 4KKSA 4L5TA 1ZXTA 3SGIA 1EZ6A 3R3OA 5M3FH 1Q3LA 4HR7B 2XRQD 3FRPB 2KBNA 3OHXC 1PV4A 1EYDA 1SNCA 4OX9L 4AH6A 2F0PA 3PMFA 3H09A 4BBRH 2R92H 1HZCA 1I50B 2D9UA 3H94A 1S5FD 3S1NB 1NBWA 2MO0A 4X65L 4IOCA 3GV3A 3HOVH 1Q82C 4HTHA 2WKCA 2G5DA 1SJHD 3D31A 3Q23A 5EPKA 3RZOB 1V1PB 4PMWA 4X62Q 1TIID 1EFID 2BOSA 3E0EA 3TMEA 2B2TC 2I0QA 3H3VC 1QZHA 3CC4A 1I4PA 2BDOA 5J3BA 2A1AA 2K5HA 1WJJA 1GXDC 2UUBQ 1WTPA 1KHIA 4KY7A 4PQXA 4AIMA 2O5IC 1MGSA 5FLXL 2JXMB 4BY1G 4JBWA 1YJ9A 1PH6A 3RR5A 2JA5H 1VQAA 1Y8PB 4JI1L 3S1RB 2EYPA 3KLSA 3H3VI 2WB1E 2GVBA 4DR1L 2B2TA 2OXPA 5FKAC 3F2DA 1CKNA 4LF4L 5IE8A 1DCZA 3JAME 4FO2A 1F2LA 3QB3A 3QOJA 4RH6A 3ZYYX 4DR4Q 3J80E 1SN8A 3PIO3 2OWOA 4XDXA 1WTRA 3I4NH 1G2TA 4KD3A 3MXNB 3BZKA 1BCPC 3R2IA 1WTHA 3GTMH 3D6WA 1TWCB 4EQ5A 1N34Q 2PO4A 3FMCA 1R9TB 1WTQA 3K5NA 2QW7A 2I5HA 3MHBA 3PF4A 4LFBL 1L0YB 1D1KA 1SNDA 1PRTB 3BZCA 4JI3Q 1LTTD 2A68C 1RCVD 4C3HB 3VA5A 5A35A 2BA0A 3S16H 1PFBA 3D4RA 1WCMB 1W2BA 1K83H 4A3IH 4CKBA 1O80A 4JBKA 3DEPA 1B44D 2IY5B 5CBAE 1STAA 5DNFA 1YHAA 1MI2A 1JWMD 1DZ1A 1CTMA 3G71A 4UDUC 4F87A 5IYBH 4LF9L 4JG2A 2JA8B 3A5ZB 2EYJA 1AZPA 2PZUA 3G6EA 5M5YB 3HS0C 1EWIA 1SDFA 2KHJA 4IOAA 1ENAA 4QUFA 1Y8OB 2N3SA 2PI2E 1Q46A 2FXQA 2UU9Q 2DN8A 4JI4Q 5CYUA 2PW5A 5E7NA 1EIHA 3S17B 1EY5A 3HOUG 1LTBD 4X66Q 1BCPF 1I5FA 4P73A 4DUZQ 4G57A 3NBHA 3KF6A 5M5WH 3SK6A 2LY7A 1GVPA 4JW0A 1L1OC 3A5UA 1DXMA 3CPWA 3UE0A 3LX0A 3SXHA 4ALPA 4B3TL 3OTOQ 1G51A 5TSSA 4J1MA 3EROA 3VR6A 1C4QA 1Y1WB 2XNAC 2Z9HA 3KDFA 4EX5A 4IUQA 3SE0A 1M1KC 1B9NA 3HOXB 3HOZB 2BE5C 1CKNB 1LUZA 1G8ZD 4KJNA 4IUTA 4CDDC 2A5HA 1ZKOA 3I3CA 1TT2A 4A3GH 2A74C 1JC7A 3QWNA 2WINB 4R9WA 1CA6A 1L1OA 3U4VA 3Q8DA 4ZAIA 1TQOA 1YBYA 1HTLD 2YTYA 2B2VC 1RJTA 5I9OA 1Q7YC 4GN3B 2QILA 4Y7NH 3ONAB 1AW7A 2R93G 3QR8A 4ZK9B 2WB1B 3HOWG 5L37A 4KV6A 1PYBA 4DV7L 1AE3A 4L8JA 1U0LA 1Y69U 1EIFA 4B3RL 1H95A 5IYCH 3EIVA 1RTOA 1EEFD 2B2VA 1IBKQ 3P1HA 4L5SA 4BXXH 4JV5Q 4ID6A 1LV9A 3FHWA 5C6AA 2Y0SG 1JOOA 1Z7TA 4A3FH 2WAQE 1VMCA 1BCPB 1GUNA 5J39A 4LFCL 2OQ0A 4A3JB 2K52A 3RLFA 1JJCB 5JJKA 1FYCA 4LAAA 3I4MG 3E9HA 3OMCA 2VXWA 3CCUA 1CZGA 1SYDA 1W6JA 1CHPD 3M7NA 1BO0A 3GQBA 1AEXA 4OWXB 3S1QB 3KBXA 1XYIA 4B3SL 4K0KQ 3A7AB 1XPOA 5C4ZA 4KLKA 1I4XA 4PG3A 2B29A 1JICA 2PZWA 1K3BC 1FR3A 2F0HA 2N78A 2NTSA 4TVAB 3S24A 1RHPA 3PUZA 1IYJB 3U9SA 2JA7H 2YU9H 1XTDA 3FKIB 1Y1VH 4XQNA 1II3A 1U4PA 4F7XA 3A8KE 1VQLA 5C4XB 4RG1A 4B9XA 1N36L 1D1IA 1ESFA 3NEMA 5I2YA 1MIUA 2WKDA 1K8AC 3C1EA 3GD7A 3NBHB 4M1UB 3PO3H 1IW7D 2HHHL 2YTXA 3KF6B 3UDXA 1FL0A 1W3SA 2VY3A 2HCIA 2PNRC 1G6ZA 3N52A 1CKOA 1PTOB 1EEID 2L55A 4FF2A 4IALA 4CJ0B 2VUMB 2D5DA 4KHPQ 3TP5A 3KDFB 1JORA 1J8IA 3P75A 1JWSD 3RZDB 3IFTA 2E75C 3ULPA 4IPDA 1EY4A 1L1OB 4DFAA 4EVOA 4HJAA 5JPMC 4LMQD 3MA2B 1YHBA 4RGNA 2F0DA 3DWPA 3KOJA 2R61A 3MVVA 2RKSA 4A3BH 2RF4A 2MFIA 4IFDH 1B7YB 3K59A 3QOLA 5BR8L 5M9OA 4RAUC 4YHHQ 3TP8A 1EZ8A 1QVGA 4GNXC 3D4WA 4DR5L 3PF5A 2DUDA 3TP7A 2EYFA 2NVXH 1EL0A 1N32Q 2EXZA 1X3EA 1TWGB 1YEZA 5FJ8H 4G4KA 3KFUA 1WCMG 4N9PA 1KLGD 4MIUA 3U50C 5HURA 1O78A 5M3MB 4DR7Q 4MHEA 1PZKD 2BH8A 2K4KA 2QKIC 4RGOS 2ES2A 2Q2IA 5JJLA 2VQEQ 4GNXA 5IGFA 1STNA 1F77A 5GQOA 2JA6H 1YHQA 5CV6A 3Q6SA 4BBSH 1MSGA 1C9OA 4IN3A 2JA8G 1J9OA 1QJOA 2E2IB 4LF5L 1UUPA 3MEHA 3DM3A 1K8GA 1HUNA 4KHVA 1I4QA 1BOSA 1GUGA 3P20A 1K9MC 2SNMA 2WAQB 3PSIA 2MO1A 1KDBA 2O4XA 2I5LX 4POGA 3D8GA 2F0MA 1B50A 1HUMA 1V9PA 3J81j 3STBD 4EQPA 1FGBD 1SNMA 3W5OA 1F9SA 2EQSA 3E0JA 4JC0A 2L9HA 1EY8A 3NK9A 3F2UA 3FEWX 4B08A 1Q1EA 3NQTA 2VS1A 4LF8Q 4DK0A 5C3WA 2ZT9C 1OXXK 2B3GA 1A63A 4JI6Q 2L1BA 3CU7A 1XTCD 2UUCQ 2OEOA 1QCBD 3BG3A 2MNAA 1F9PA 1G6PA 2RBMA 1HHVA 1UNSA 3KLSX 3WWVA 2NN6H 2NWGA 1MSHA 3HOZG 5ELDA 3T13A 4A3FG 1XMQQ 3HG9A 4JI0L 3TS2A 1VQDA 1PRTD 2IT1A 3K8AA 1A2UA 4A3CH 1XMOQ 1IHZA 1TWAB 1P8LA 2UXDL 2K04A 3D4DA 4BY1B 4DV0Q 3A74A 4IFDJ 1ZEQX 2E2JH 1E2WA 4RCNA 3RMHA 2R7ZH 2AHOB 2R3ZA 1SYBA 5E4WC 3PIPA 4X62L 2B63H 4X64Q 5GAGC 4ME3A 5DAUA 1DOLA 4G7OC 1XNQL 4DGZA 4OWWB 1Z9FA 1ASYA 2HUGA 4JI2L 4XXEA 1E0BA 1AP0A 2OTLA 3GTLH 4B9WA 2XTIA 4YY3Q 4X3TA 1PVOA 4C3JH 1H9SA 3OYYA 2Y0SE 3Q22A 1IBLL 2PPBC 2NBFA 4HJ8A 1K8OA 5K5PA 1JOQA 2XWBB 1STHA 1ENFA 4PZ6A 5G3LF 2C9OA 4TQUS 4LF6Q 1F9RA 5EAYA 4FDBA 4JI5L 1NNXA 3J80i 4GNXB 4AQYL 4A3KH 5CC4A 4EQNA 1X3QA 2A6HD 5FO9B 4GLXA 3QIAA 2K14A 5T1GA 1EWCA 4FP5D 2EIFA 2EYHA 1PYWD 2NVTH 1IBMQ 4A3EB 5DM73 1XNRL 3HP3A 3NSWA 3VYSA 1C7YA 2LXKA 5IWAQ 3KYHC 2HQEA 3OIQA 3CCMA 3S14H 3GDEA 5HGQA 1KL9A 1KRTA 4FXGC 4CHTB 4JI7Q 3BYYB 5JEAG 2L15A 1X9NA 4GLVB 1AN8A 5C3XA 5IP7H 1TWHH 3KBGA 2QGQA 3J81E 1IYVA 3CF5A 1LTRD 4HN7A 1SE4A 4V190 4LFAL 2BH2A 1YNJC 1PFSA 1GO3E 2PCFB 3I91A 3MXPA 1SFOH 2R7DA 2VUMG 2ID0A 2J7ZA 3HOUB 3A0JA 1WI5A 4P75A 1LYLA 4LF7L 2HDLA 1HJPA 1OXTA 1RIPA 1CSQA 1C0AA 1HZBA 1VQOA 4HJ7A 5COYA 3HFZB 2UU9L 2P5ZX 4JI4L 3AU7A 5C3EH 1WTXA 4R1JA 3ERQA 4JI8L 3HOYH 4X66L 3G4SA 2ZM6Q 2OF1A 2KEDA 4DU9A 1XXGA 3GTKH 2A68D 5M3FB 1XJVA 3K7UC 3DLLA 1YJNA 1CT1D 1S3OA 2F0VA 3OW2A 2CW0D 4BS9A 1YIJA 4DV1Q 4B3MQ 1H9SB 3R8BA 1PDQA 1VQ9A 4BBRB 2R92B 2K7VA 4WJ4A 2AUJD 4FYDA 4RGTA 3PQIA 1ILQA 4IURA 3OTOL 3SEBA 1H9KA 1LT6D 4DV4L 1JJGA 3LWUA 1A15A 5D14A 2F3IA 2F3VA 4DUYQ 4JYAQ 4DV3Q 1S5DD 3H6MA 1EQQA 1PH1A 3TRZA 1S40A 2B39A 4LJZC 2F0JA 4R4OA 2Z4IA 3CCRA 2ALYB 1JWUD 4HEDA 4BWGB 5H1SE 4DR3Q 3ERSX 2Y0SB 3J81L 4G7HC 4DAYA 1PTOD 1O7IA 5C4JH 1SMXA 1BXTA 1HR0Q 4NXNQ 2KVMA 2WAQG 4DV2Q 4A3LH 1PFNA 3CD6A 2NVYH 1VQPA 1IXRA 2JA5B 1BBWA 1VQEA 4QY7A 4K14A 1SAPA 5NUCA 3I4MB 3CW2C 3IAYA 1IKLA 3RLOA 2KCMA 2RVLA 1E2ZA 1ENCA 1VQMA 1A3TA 1SE8A 4FF4A 1XPRA 5I6YA 4OO1H 2B2UC 1I4RA 1F9QA 2JP1A 3K5MA 3W3AA 2WFWA 4DK6C 1PH4A 4R4QA 4LK1C 4NPSA 4JPBW 5FK9C 3DM1A 1QB5D 1VQ4A 3I4NB 5JJIA 4R4IA 2OCEA 1ILPA 1CHQD 2IPKD 2EOTA 2J0TD 4XTCS 2B2UA 2HQLA 1HCZA 1I4GA 2E2DC 3GTMB 3W1GA 2AWNA 2K75A 1M4VA 3FPUB 4K0KL 4KY5A 3U4ZA 3PUXA 2VB3X 4ZKBB 1WD1A 1E7ZA 4NMZA 3NXWA 2K28A 4UP8A 2VQFL 3MTSA 1F2MA 4KK7A 3S16B 3F8TA 5EBCA 2A69C 4TRDA 1K83B 5KNDA 4A3IB 5C44H 5IT9E 1HA6A 5E3FA 5I9PA 3EFXD 4A76A 3HEJA 2HT1A 3GTOH 1N33L 4C2MH 1EQTA 2K03A 2UXCQ 2E2HH 3C2PA 1H9MA 5IP7G 2QDLA 2K50A 3F2CA 4KHPL 3AYHB 4K6LA 3BU2A 5DM63 2NYZD 2Z4HA 4OHJA 3M3YB 4QGUA 4IUPA 2AMCB 1F2ZA 2CQAA 4C3IH 2K5DA 2EJGC 3D0FA 4IUVA 2EDGA 3EN2A 1EU4A 1NSNS 4A3EG 1LTAD 4DAYB 5M5WB 4CKEA 1G91A 4NDXA 4K2KA 1FJGQ 2WP8J 4K2LA 2L12A 1UEAB 2F4VQ 4QIWE 5AJ3L 3A56A 1JR0D 1TU2B 4O42A 2UUAL 5IY0A 3CMAA 3SK4A 1N32L 1HQMC 1NCVA 5JJZA 3CHBD 1LT5D 4A3GB 2A73B 2C5CA 1I3QH 3ULLA 3KUPA 3RUZA 4DF7A 2VQEL 5FLXc 4IJHA 4Y7NB 3IRBA 4DV5Q 2X6LA 2XSCA 1MKHA 1SLJA 3K57A 4IFDI 1J5EQ 4LNQA 1HH2P 2B8FA 4PMCA 2KUMA 3T16A 5IYDH 2K5WA 3D3RA 4WFN3 4GZYC 2KEEA 4YCWA 3GTGB 4BY7H 5IT9L 5IGGA 3VR2A 5FOBB 2SDFA 4IPGA 3JAML 1Q90A 2RDFA 2F03A 3S2DH 3J80L 5CR3A 3J7ZC 5LMUQ 3I4OA 4C3HH 1T5XD 3PO2H 1CK1A 3K5OA 2VB2X 1A8VA 4A3FB 4Y52H 1CI3M 5M3FG 1STYA 4S3SA 3CCEA 2ATWA 1DOMA 3MEFA 4LF8L 2R7FA 4RKBA 1ET9A 4BBRG 2R92G 2UXBQ 4DAVA 4JI6L 5KYLA 1VQIA 3S2HH 1E1OA 1RD9D 2IL8A 4DR6L 2FINB 4TKOB 3TN2A 3T1HL 4A3MH 3HOVG 3CQZH 4NW2A 1ZYRD 1HFGA 4HCSA 4MZ9A 2F0SA 2EXDA 4QCLA 2DNEA 2PNHA 3J7AF 5CMDA 5ELCA 1NR4A 3U9OA 3L7ZC 2BCOA 3BDOA 2JA7B 2E8GA 2YU9B 3NPPA 3OSOA 1Y1VB 3AB9A 3CRKC 3LGJA 2E5LQ 3NTKA 4X6AH 5IP9H 2KCCA 2NZOA 3EVQA 2KQ3A 1MJEA 1PFMA 3L0OA 3PO3B 4IZ8A 1T9HA 4OX9Q 3P7JA 3PUWA 4LW1A 2E76C 2CVRA 2JA5G 1HXYD 3SK5A 1NTGA 2H4OA 1TWFH 2NN6I 3TP6A 4I7AA 4CJ2C 1KDCA 5FO7B 2HCCA 5I4DA 1EIYB 1XPUA 2F0OA 4RKLA 4X65Q 4XQJA 1Y1WH 1AH9A 3HOXH 4CJ1B 4APVA 1VQ6A 2AQ2B 1MHWC 5CV4A 4IUUA 5BN3A 2IHEA 5LL6S 2K05A 1OTCA 3BVGA 1HZ9A 3I4NG 2K32A 2KHSA 1X3GA 2M2LA 3J80c 1KLUD 4A3BB 4QIWB 1DM0B 1X56A 4BA1I 4U673 2CH4A 1JMCA 1A3VA 1U5KA 2M00A 3AQQA 4L5RC 3TQYA 3GTJH 2JE6I 2Z1CA 1C8CA 3GTPH 4JI1Q 2NVXB 3KLWA 2A6EC 1TKWB 5GAHC 1O7YA 2SNSA 4OL7A 2K01A 2TSSA 3I4LA 5CORA 4EGVA 3J81i 2IW3A 4DR1Q 4KJOA 4IPHA 3GTQH 4LF4Q 4OEMB 4A3IG 4UP9A 2NUCA 4Z9CB 1SMYC 3L9AX 1QE6A 4YWLA 1ML0D 2AKWB 3DUZA 1FNWA 3WOFA 3UDGA 3PUVA 2YTVA 2WIIB 2NTTA 4F8MA 1NMGA 4RMFA 5HY6A 2PMZB 1JB3A 2JA6B 2FMMA 4MNOA 4BBSB 5IYBG 1CSPA 4AYBB 1U4RA 4UPAA 3X3NA 5FLMH 1HNXL 1HPCA 1WVLA 3BZDB 5D65A 3QG1A 1H9RA 3K0XA 1VQBA 4LFBQ 2VW9A 4HIKA 1VQNA 4YWKA 4WJWA 4N8X1 3TEHB 3FKIH 1WTVA 5K36H 2E74C 3A7LA 1BR9A 1VQGA 2FMCA 4HSPA 4UAIA 5C0XH 1TS4A 3UE1A 1SE3A 4DNTB 5EGTA 2D0PA 3K58A 1JE4A 1BBXC 4R8NA 1O7ZA 3RLNA 4ZUIA 4UHVA 1B53A 1DONA 4LF9Q 1X55A 4DV1L 4RA8A 4C1NI 4YCVA 1PTOH 4B3ML 3OPOA 5CV8A 3M4YA 4M8AA 4A3DH 1YNJD 1IYUA 1TS5A 2K33A 4Q0FA 1LM0A 4A3GG 2MUYA 5CBEE 1ONLA 3E6ZX 4L63B 2N88A 3K5LA 1VQJA 1ASZA 1Q8KA 3I7FA 1MJCA 1LLRD 1PH8A 2NB0A 2R7ZB 2O2LD 2L0CA 5JVH3 1Z47A 4K5XA 2N8NA 2RHSB 3K6OA 1YITA 4DR2L 3CMEA 1SJED 1I6VC 5IYCG 3GTLB 4DN4M 1HR0L 3FPPA 2NVQH 2WV6D 4HMJA 4G7ZC 1K3RA 4C3JB 3K80C 4EQOA 4BXXG 1EFWA 1C48A 4JBMA 1WTOA 4RGMA 3VR3A 1UE6A 3I70A 1Q1BA 2CKZB 4HMIA 4O0AA 3JC66 1UWVA 5D3IB 4H44C 4XIGS 1SNPA 3CCQA 5M3MH 1GUOA 1EWHA 2OQKA 2Q8RE 4KTAA 3F1ZA 4I65A 2RCNA 3L3OC 4FVMA 1VQ8A 2Q2TA 2TMPA 2HDMA 2XGTA 5KNBA 1HNWQ 1B2TA 1M8AA 4MN3A 2RDGA 1PZJD 3I73A 3MZ5A 3W2DA 1S4ZA 2R6GA 1WFQA 2KENA 2N55A 4B3RQ 3M4OH 3S14B 1FVIA 3GO5A 2F4IA 2UUBL 1YVCA 1BDOA 2L4NA 2JA7G 3K7AH 2I5MX 1Y1VG 5C0XJ 2F0WA 1IW7C 5E1FA 3R93A 1O7LA 1L0XB 4OO1I 5BN4A 1S5ED 1EIGA 5KNCA 4DPGA 1NAPA 3PO3G 1TWHB 1J6QA 2ENBA 3JAMi 1STGA 5JAVA 1I6HH 2BDNA 2IX1A 1FNUA 1PHJA 2F0QA 3HKZB 3CP0A 4CGYB 5EQ0A 2C35B 4RCOA 1DYQA 3PGZA 4B3SQ 4DR4L 3G48A 4KY6A 2Z6KC 3I55A 1IKMA 2LSSA 2EZVA 4K5WA 3ITPA 4DKAC 3CC7A 1NE3A 2YYZA 4ABNA 3J7AV 1T5EA 1RF2D 2EY2A 2GVAA 3MXGA 4IQZA 1TWAH 3FVQA 1N34L 4OONA 2CWAA 4BY1H 4FF1A 3NELA 1NY4A 4A3BG 5CV9A 1JCKB 1N36Q 1BF4A 1DD2A 5C3EB 4JI3L 1FD7D 4J8QA 4IFDG 2EJMA 3HOYB 2VZAA 2HHHQ 4QB4A 3GTKB 4DAMA 4ILWA 5KRUA 5M5XH 1SE2A 2ASBA 3I2ZA 4K6DA 4YCUA 1X54A 3H15A 3TDQA 2HD3A 1TVXA 3TBIB 4N8FA 2JJQA 1EYAA 5ELNA 5FJ8G 4C56C 2AQ3B 2QEJC 2X6GA 1SBBB 1WYDA 3HKSA 2V4DA 1SYCA 2ZTCA 1KAAA 4X3UA 1QILA 4A93H 1STBA 4A75A 5IGBA 2N49A 1LTSD 2JA6G 3GV6A 1VDZA 4BBSG 1BCPD 4DV6Q 2H5XA 1FNVA 3KK7A 3UDIA 4AYBG 1GM5A 5GAEC 1HNZQ 3N6RA 3NTHA 1W6KA 1GHKA 3EA6A 3OOCA 2I46A 2SEBD 1J5EL 1BKBA 4DUZL 4DR5Q 1LT4D 4RFBA 3STBC 1WD0A 4NXMQ 1DJRD 2NVYB 2JEBI 3BVZA 1CQVA 1GHJA 1H9JA 2F0LA 3FP9A 1SR3A 1KIXA 2H1EA 3WOEA 2Q2HA 3M9BA 1GD7A 1EY9A 1JQYD 3VA7A 2B2YC 3NP8A 3TS0A 1JE5A 5EJWA 4DK1A 3HOVB 5HGTA 4QL5A 1OXVA 4KKTA 1YNNC 3I72A 5J22A 1FGUA 4LF5Q 3S15H 2EY5A 2NN6G 1SNQA 2UXBL 3CKIB 1D6EC 3HOUH 2B2YA 1GKHA 1UEBA 2D2CC 1K8MA 3KF8A 4J6HA 4A3CG 5IGCA 4DNRB 2CH4W 1BQQT 4GKJQ 2R7ZG 3SHLA 3S1MH 4ZYSA 1E1TA 2ZXOA 4XYQA 2B63G 1IBKL 1Y14B 2EE1A 4JV5L 4OWTB 1MD2D 2E5LL 1M90C 1S5BD 5C44B 4H02A 3CCJA 1VQ7A 2EVBA 4C3JG 3TREA 3GTOB 4XYOA 4OXPA 2BE5D 4C2MB 3NENA 3H0GH 1HRJA 3QO2A 4N9TA 3ULJA 1E24A 2E2HB 4GOPC 4JI0Q 1QWYA 1PH3A 4DXFA 3X3MA 2R93H 2A6HC 4PMBA 1X3FA 1U4MA 5C4HA 2VL6A 4A3KG 2UXDQ 4P71A 3DEOA 3DWAA 1VQ5A 4OIKA 4C3IB 3HOWH 1PRTF 1QUQA 2KECA 3ER0A 4P72A 1GUTA 3NBIA 1PLFA 5IGDA 3SK8A 5J1ZA 4GOPA 2RQXA 2K1BA 4NB3A 1HR0W 1HZAA 4ZCKA 1P16A 2JYOA 4NP5A 4OELB 1R4PB 2Z0SA 1XNQQ 3AMUA 2XIWA 4JI2Q 5CV5A 3NQIA 4IJLA 1VF7A 3V05A 4O2DA 2FFKB 4GN4B 2F3WA 5F2DA 1IBLQ 2VNUD 1XX8A 3I4MH 1BBUA 3C46A 4KN7C 2KA7A 1I50H 1MBYA 1QG7A 2DJGC 1IL2A 4R4CA 4F88A 3S1NH 1D8LA 5LMNQ 4P2CB 1TR5A 4JI5Q 1PH7A 3KJPA 4AQYQ 5IIFA 4KD4A 3J81c 1I3QB 1ET6A 3BDLA 2CWPA 4R4TA 2F0NA 3IKJA 4PV1C 3HKZG 4JBJA 4QQBX 1ESRA 3RZOH 5D3DA 1PH9A 3HRZC 2LFNA 3A55A 1XNRQ 1NMFA 1HTPA 3VYTA 4A93G 1VCIA 4DA2A 2A19A 3H91A 4BY7B 3KF8B 2K6AA 1CM9A 3M7GA 1RODA 1WTWA 1TXYA 4YHHL 2OTJA 2ZTDA 4GN5A 5LL6X 2M9VA 5ELEA 3S2DB 2Z8LA 1QOHA 5C3EG 4X3KA 2RSNA 2QCPX 3S1RH 4MTNA 1QZGA 1AZQA 3PO2B 1A6XA 4U68A 3HOYG 2CW0C 4ME5A 3CCSA 3C3LA 2F0EA 4GS3A 4RWSC 2A6ED 1I94Q 4UY8C 4LFAQ 3BVMA 1B8AA 4DR7L 5LHY1 3B6YA 2IX3A 2RCFA 1RL2A 2LKVA 2KCNA 1V1QA 1SMYD 2CFMA 1TS2A 1D2BA 4GKKQ 3S2HB 5LMNW 2MPMA 4A3MB 4K8IA 1F2YA 4LF7Q 1B3AA 3CQZB 3MC0B 1EUJA 2FJ2A 2PMZE 2IX0A 3M3YH 1TWCH 5ISRA 5AFWA 1X6OA 1PMRA 3TZUA 1R9TH 1QUQB 4AYBE 2DJFC 1KQSA 4WORA 4L6TB 1PTOC 2HIVA 2BA1A 4JI8Q 4GOPB 1EY0A 2JN4A 2JEAI 5C0XI 3VYUA 3U58A 1LTLA 3D6CA 3VR5A 1ICFB 1NUCA 1HFNA 1WCMH 1S72A 5DEHA 1SXTA 4A3LG 4K5VA 1STEA 1KNEA 5E4XA 1CUKA 2G9HD 1PH2A 1AFPA 1B3QA 1TWFB 3M85A 2AUKA 4JVZA 2DNCA 2UUCL 2PI2A 2EYMA 4DV4Q 4OO1G 2JA8H 1UE5A 3RN2A 2MQHA 1A62A 1XMQL 5M5YH
chains in the Genus database with same CATH topology
4XQQA 1VMPA 3A8IE 3NE5B 3FDTA 1X3PA 1V43A 5A2QE 1R4QB 2G9DA 4XT1B 4ZQ3A 1VF5C 1EQVA 2ICIA 4HSVA 4WRDA 5EPLA 3PIP3 1OXUA 1DOKA 4ZUJA 3DWQA 3GTJB 2QDBA 3GTPB 1PTOF 2F0FA 3OW7A 3IFDA 5G3LD 2IWHA 2O5JC 3GTQB 1E2VA 1QNUA 5KEEA 2F1MA 4OIJA 1XWEA 3A8JE 4H7BA 1U4LA 3MAQA 2D62A 5I2XA 5C5MA 2DY7A 4E6IA 3I8ZA 3OIPA 3SR1A 2B8GA 2F0KA 4C3IG 5T1IA 1CZWA 4JK1C 2RA4A 1GUSA 1RTNA 2ZXRA 5CV7A 3PUYA 1PZID 5ELFA 4FXDA 4C1NK 3GP7A 5C5LA 1GUWA 4Q5VA 2MJ8A 3DXJC 1LTGD 3ND8A 1EOTA 2KJXA 4ZRZA 4KI0A 5A2QL 5EBDA 4A3DB 2IJ0A 1LTID 1B4OA 2F0IA 4FXKC 1V1OA 3CRLC 1HQRD 2EYLA 5I6WA 5IGEA 5KYIA 5IOCA 4KKUA 1X32A 1LABA 1U9RA 1Q12A 3Q24A 1Y8NB 2QF7A 2SOBA 3MWYW 5JEAH 1CA5A 1SSOA 3OWFA 4KN4C 1TY2A 3PV0A 2MHVA 4ZLTF 2NVQB 3UI2A 5JOBA 1A2TA 3URYA 5JVG3 4C3HG 1BNZA 4QUCA 3T4AC 3DMUA 2RDHA 2XRSD 2F0TA 1OO9B 3T53B 4XT3B 2FHTA 3TZDA 3NTIA 1KNAA 2E2JB 4H0LC 2OT2A 3NWTA 3MXUA 1RKNA 1ZYRC 2B63B 3EQLC 4DAPA 2AWOA 5EKLA 5FO8B 3V96A 1V8QA 2EYOA 4V0BA 3K0YA 3M4OB 2CHBD 2LS01 4DXGA 2F0GA 1IL8A 1CQFA 3K7AB 4FF3A 1UAPA 3E5SA 3O13A 2K5QA 3MFGA 3SDZA 4TSSA 2JSOA 1RDPD 1LO5D 1I6HB 3RD4A 3NWSA 4A3KB 3HGBA 5IODA 1GJXA 1GOZA 3G7LA 2EPBA 1YNND 1EY7A 2DY8A 2EY6A 3I90A 4YIJA 2NVTB 2AQ1B 1BUVT 1Z6HA 1SEBD 1A3UA 2WACA 1Q8IA 5JEAJ 5JPNC 4BA2I 1KTKA 1D5ZC 2B2WC 2ICEC 3LWEA 1SNOA 4PNYA 3SVMA 4IUNA 5CGKA 3NUCA 4RHRA 5M5XB 2EJFC 1G2SA 2X69A 1S5CD 1LACA 1B1ZA 3LNNA 3NHHA 1SFOB 3J7YW 4OGQC 1CFMA 2B2WA 1I4HA 1SYEA 1NR2A 1OXSC 1D5XC 4HCEA 1SYGA 1KABA 2PZTA 4A93B 1QNKA 3EJIA 4K8JA 1PXUA 3BYTB 3VYRA 1EY6A 3R2TA 1G291 2F0UA 3IL8A 2XVSA 1SYFA 2Q8IB 2MP1A 4CKCA 5KIXA 1EU3A 2XN9C 1LT3D 2J4XA 2A69D 2L5TA 5K36G 4ULLA 3VR4A 5C0XG 4KMUC 3KLRA 3DHQA 3ND9A 2NZ1D 4R8IA 4QF4A 4QMGA 4CBVA 1ICWA 1V1PA 3S15B 5KGUA 4KHZA 3A54A 3G6JB 4H13C 3TSSA 3V2TA 1TY0A 5EKIA 5C4JB 2PW7A 2LMCB 3HZXA 2GA4B 1B9MA 2I07B 3S1MB 1KDAA 2RSOA 2PYKA 3S9WA 4ODGA 2MGSA 4FNFA 3MFYA 4HAEA 4NKLA 3T51B 5FLXE 2EY1A 2PQEA 3H0GB 3Q0AA 3C1FA 3T56B 1PRTC 3BDCA 1EYCA 2R93B 4X3SA 2KOLA 3MXNA 5ELBA 2ZXPA 3QJYA 1D5MC 3WDNA 4ZKCB 3HOWB 3BS1A 5EKKA 4RHSA 1JOKA 4O1NA 3OWEB 5BN5A 2XWJB 4I7ZC 2Q8TA 1TS3A 2L11A 1HA5A 3OMGA 5EPJA 4KKSA 1ZXTA 1EZ6A 3R3OA 1Q3LA 4HR7B 2XRQD 3FRPB 3OHXC 1EYDA 1SNCA 2F0PA 3PMFA 3H09A 1I50B 2D9UA 3H94A 1S5FD 3S1NB 3GV3A 4HTHA 2WKCA 1SJHD 3D31A 3Q23A 5EPKA 3RZOB 1V1PB 4PMWA 1TIID 1EFID 2BOSA 3TMEA 2B2TC 3H3VC 1I4PA 2BDOA 1GXDC 1WTPA 4KY7A 4PQXA 2O5IC 1MGSA 5FLXL 2JXMB 4JBWA 1Y8PB 3S1RB 2EYPA 3KLSA 2B2TA 2OXPA 5FKAC 1DCZA 3JAME 4FO2A 1F2LA 3QB3A 3QOJA 4RH6A 3ZYYX 3J80E 3PIO3 4XDXA 1WTRA 1G2TA 4KD3A 1BCPC 3R2IA 3D6WA 1TWCB 2PO4A 3FMCA 1R9TB 1WTQA 3K5NA 3MHBA 1SNDA 1D1KA 1L0YB 1PRTB 1LTTD 2A68C 1RCVD 4C3HB 3VA5A 5A35A 2BA0A 1PFBA 3D4RA 1WCMB 4CKBA 1O80A 3DEPA 1B44D 5CBAE 1STAA 5DNFA 1MI2A 1JWMD 1DZ1A 1CTMA 4UDUC 4F87A 2JA8B 2EYJA 1AZPA 2PZUA 5M5YB 3HS0C 1SDFA 1ENAA 4QUFA 1Y8OB 2DN8A 5CYUA 2PW5A 1EIHA 3S17B 1EY5A 1LTBD 1BCPF 4G57A 3NBHA 3SK6A 2LY7A 1DXMA 3LX0A 3SXHA 5TSSA 4J1MA 3EROA 3VR6A 1C4QA 1Y1WB 2XNAC 4IUQA 3SE0A 3HOXB 1B9NA 3HOZB 2BE5C 1G8ZD 4KJNA 4IUTA 2A5HA 1ZKOA 1TT2A 3I3CA 2A74C 1JC7A 3QWNA 2WINB 4R9WA 1CA6A 4ZAIA 1TQOA 1HTLD 2B2VC 1RJTA 5I9OA 2QILA 3ONAB 1AW7A 4ZK9B 2WB1B 4KV6A 4L8JA 1Y69U 1RTOA 1EEFD 2B2VA 3P1HA 4ID6A 1LV9A 5C6AA 1JOOA 1Z7TA 1VMCA 1BCPB 1GUNA 5J39A 4A3JB 3RLFA 1FYCA 4LAAA 3OMCA 2VXWA 1CZGA 1SYDA 1W6JA 1CHPD 3M7NA 1BO0A 3GQBA 1AEXA 3S1QB 3KBXA 1XYIA 3A7AB 5C4ZA 1I4XA 1JICA 2PZWA 1FR3A 2F0HA 2NTSA 1RHPA 3PUZA 3U9SA 3FKIB 4XQNA 1II3A 1U4PA 4F7XA 3A8KE 5C4XB 4B9XA 1D1IA 1ESFA 5I2YA 2WKDA 3C1EA 3GD7A 4M1UB 1IW7D 2HCIA 2PNRC 1G6ZA 3N52A 1PTOB 1EEID 2L55A 4FF2A 4IALA 4CJ0B 2VUMB 2D5DA 3TP5A 1JORA 1J8IA 3P75A 1JWSD 3RZDB 3IFTA 2E75C 1EY4A 4DFAA 4EVOA 5JPMC 4LMQD 3MA2B 4RGNA 2F0DA 3DWPA 2R61A 3MVVA 2RKSA 4IFDH 3K59A 3QOLA 5M9OA 4RAUC 3TP8A 1EZ8A 3D4WA 3TP7A 2EYFA 1EL0A 2EXZA 1TWGB 4G4KA 4N9PA 1KLGD 4MIUA 5HURA 1O78A 5M3MB 4MHEA 1PZKD 2QKIC 4RGOS 5IGFA 1STNA 1F77A 5CV6A 3Q6SA 1MSGA 4IN3A 1J9OA 1QJOA 2E2IB 1UUPA 3MEHA 1HUNA 4KHVA 1I4QA 1BOSA 1GUGA 3P20A 2SNMA 2WAQB 1KDBA 2O4XA 3D8GA 2F0MA 1B50A 1HUMA 4EQPA 1FGBD 1SNMA 1F9SA 3E0JA 2L9HA 1EY8A 3NK9A 3F2UA 3FEWX 4B08A 1Q1EA 3NQTA 4DK0A 5C3WA 2ZT9C 1OXXK 2L1BA 3CU7A 1XTCD 2OEOA 1QCBD 3BG3A 1F9PA 2RBMA 1HHVA 1UNSA 3KLSX 2NN6H 2NWGA 1MSHA 5ELDA 3T13A 3HG9A 1PRTD 2IT1A 1A2UA 1IHZA 1TWAB 2K04A 3D4DA 4BY1B 4IFDJ 1ZEQX 1E2WA 4RCNA 3RMHA 2R3ZA 1SYBA 5E4WC 5DAUA 1DOLA 4G7OC 4DGZA 2HUGA 4XXEA 1E0BA 1AP0A 4B9WA 4X3TA 1H9SA 3Q22A 2PPBC 2NBFA 1K8OA 5K5PA 1JOQA 2XWBB 1STHA 1ENFA 5G3LF 2C9OA 4TQUS 1F9RA 5CC4A 4EQNA 1X3QA 2A6HD 5FO9B 3QIAA 5T1GA 1EWCA 4FP5D 2EYHA 1PYWD 4A3EB 5DM73 3HP3A 3NSWA 3VYSA 2HQEA 3OIQA 4FXGC 4CHTB 3BYYB 5JEAG 1AN8A 5C3XA 3KBGA 3J81E 1IYVA 1LTRD 4HN7A 1SE4A 4V190 1YNJC 2PCFB 3I91A 3MXPA 2ID0A 2J7ZA 3HOUB 2HDLA 1OXTA 5COYA 3AU7A 1WTXA 3ERQA 2OF1A 2KEDA 4DU9A 1XXGA 2A68D 5M3FB 1CT1D 2F0VA 2CW0D 4BS9A 1H9SB 3R8BA 1PDQA 4BBRB 2R92B 2K7VA 2AUJD 4FYDA 4RGTA 1ILQA 4IURA 3SEBA 1H9KA 1LT6D 3LWUA 1A15A 5D14A 2F3VA 1S5DD 3H6MA 2B39A 4LJZC 2F0JA 2Z4IA 1JWUD 4HEDA 4BWGB 3J81L 2Y0SB 4G7HC 4DAYA 1PTOD 1BXTA 2KVMA 1PFNA 2JA5B 4K14A 1SAPA 5NUCA 3I4MB 3IAYA 1IKLA 2RVLA 4FF4A 1E2ZA 1ENCA 1A3TA 5I6YA 4OO1H 2B2UC 1I4RA 1F9QA 2JP1A 3K5MA 3W3AA 4LK1C 5FK9C 3DM1A 1QB5D 3I4NB 1ILPA 1CHQD 4XTCS 2EOTA 2IPKD 2J0TD 2B2UA 1HCZA 1I4GA 2E2DC 3GTMB 2AWNA 1M4VA 3FPUB 4KY5A 3PUXA 2VB3X 4ZKBB 1WD1A 4NMZA 3NXWA 2K28A 3MTSA 1F2MA 4KK7A 3S16B 5EBCA 2A69C 4TRDA 1K83B 5KNDA 4A3IB 5IT9E 1HA6A 5E3FA 5I9PA 3EFXD 3HEJA 1EQTA 2K03A 3C2PA 1H9MA 4K6LA 5DM63 2NYZD 2Z4HA 4OHJA 3M3YB 4IUPA 1F2ZA 2CQAA 2K5DA 2EJGC 4IUVA 2EDGA 1EU4A 1NSNS 1LTAD 5M5WB 4CKEA 1G91A 4NDXA 4K2KA 2WP8J 4K2LA 2L12A 1UEAB 3A56A 1JR0D 1TU2B 4O42A 3SK4A 1HQMC 1NCVA 5JJZA 3CHBD 1LT5D 4A3GB 2A73B 2C5CA 3KUPA 3RUZA 4DF7A 4Y7NB 2X6LA 2XSCA 3K57A 4IFDI 2B8FA 4PMCA 2KUMA 3T16A 2K5WA 3D3RA 4WFN3 4GZYC 2KEEA 3GTGB 5IT9L 5IGGA 3VR2A 5FOBB 2SDFA 3JAML 1Q90A 2RDFA 2F03A 3J80L 5CR3A 1T5XD 1CK1A 3K5OA 2VB2X 4A3FB 1CI3M 1STYA 4S3SA 1DOMA 4RKBA 1ET9A 4DAVA 5KYLA 2IL8A 1RD9D 2FINB 4TKOB 3TN2A 4NW2A 1ZYRD 1HFGA 4HCSA 2F0SA 4QCLA 2DNEA 3J7AF 5CMDA 5ELCA 3U9OA 1NR4A 3L7ZC 2BCOA 3BDOA 2JA7B 2YU9B 3NPPA 3OSOA 1Y1VB 3AB9A 3CRKC 3NTKA 2KCCA 3EVQA 2KQ3A 1PFMA 3PO3B 4IZ8A 3P7JA 3PUWA 2E76C 2CVRA 1HXYD 3SK5A 2H4OA 2NN6I 3TP6A 4CJ2C 5I4DA 1KDCA 5FO7B 2HCCA 2F0OA 4RKLA 4XQJA 4CJ1B 2AQ2B 5CV4A 4IUUA 5BN3A 5LL6S 2K05A 3BVGA 2K32A 2KHSA 2M2LA 4A3BB 1KLUD 4QIWB 1DM0B 4BA1I 4U673 1A3VA 2M00A 2JE6I 2Z1CA 1C8CA 2NVXB 2A6EC 1TKWB 1O7YA 2SNSA 4OL7A 2K01A 2TSSA 3I4LA 5CORA 4EGVA 2IW3A 4KJOA 2NUCA 4Z9CB 1SMYC 3L9AX 1QE6A 1ML0D 3DUZA 1FNWA 3WOFA 3PUVA 2WIIB 2NTTA 4F8MA 2PMZB 1JB3A 2JA6B 2FMMA 4BBSB 4AYBB 1U4RA 3X3NA 1HPCA 1WVLA 3BZDB 5D65A 3QG1A 1H9RA 4WJWA 5K36H 1WTVA 2E74C 3A7LA 1BR9A 2FMCA 4HSPA 4UAIA 5C0XH 1TS4A 1SE3A 4DNTB 5EGTA 3K58A 1JE4A 1BBXC 4R8NA 1O7ZA 4ZUIA 1B53A 1DONA 4RA8A 4C1NI 1PTOH 3OPOA 5CV8A 3M4YA 4M8AA 1YNJD 1IYUA 1TS5A 2K33A 4Q0FA 2MUYA 5CBEE 1ONLA 3E6ZX 4L63B 2N88A 3K5LA 1LLRD 2R7ZB 2NB0A 2O2LD 2L0CA 5JVH3 1Z47A 4K5XA 3K6OA 1SJED 1I6VC 3GTLB 4DN4M 3FPPA 2WV6D 4HMJA 4G7ZC 4C3JB 4EQOA 1C48A 1WTOA 4RGMA 3VR3A 3I70A 1Q1BA 4HMIA 5D3IB 4H44C 4XIGS 1SNPA 1GUOA 1EWHA 2Q8RE 4KTAA 4I65A 3L3OC 4FVMA 2TMPA 2HDMA 5KNBA 1B2TA 1M8AA 4MN3A 2RDGA 1PZJD 3I73A 3MZ5A 3W2DA 1S4ZA 2R6GA 2N55A 3S14B 3GO5A 2F4IA 1BDOA 2L4NA 5C0XJ 2F0WA 1IW7C 5E1FA 3R93A 1L0XB 1O7LA 4OO1I 5BN4A 1S5ED 1EIGA 5KNCA 1NAPA 1TWHB 2ENBA 1STGA 5JAVA 2BDNA 2IX1A 1FNUA 2F0QA 3HKZB 4CGYB 5EQ0A 4RCOA 1DYQA 4KY6A 1IKMA 2EZVA 4K5WA 3ITPA 2YYZA 4ABNA 3J7AV 1T5EA 1RF2D 2EY2A 3MXGA 4IQZA 3FVQA 4FF1A 5CV9A 1JCKB 1BF4A 1DD2A 5C3EB 1FD7D 4J8QA 4IFDG 2EJMA 3HOYB 4QB4A 3GTKB 4ILWA 5KRUA 1SE2A 4K6DA 3TDQA 1TVXA 3TBIB 1EYAA 4C56C 2AQ3B 2QEJC 2X6GA 1SBBB 2V4DA 1SYCA 1KAAA 4X3UA 1QILA 1STBA 5IGBA 1LTSD 3GV6A 1VDZA 1BCPD 1FNVA 3KK7A 3N6RA 3NTHA 1W6KA 1GHKA 3EA6A 3OOCA 2I46A 2SEBD 1LT4D 4RFBA 1WD0A 1DJRD 2NVYB 2JEBI 3BVZA 1CQVA 1GHJA 1H9JA 2F0LA 2H1EA 3WOEA 1EY9A 1JQYD 3VA7A 2B2YC 3NP8A 4DK1A 5EJWA 3HOVB 5HGTA 1OXVA 4KKTA 1YNNC 3I72A 5J22A 2EY5A 2NN6G 1SNQA 3CKIB 1D6EC 2B2YA 2D2CC 1K8MA 3KF8A 4J6HA 5IGCA 4DNRB 1BQQT 3SHLA 4ZYSA 2ZXOA 4XYQA 2EE1A 1MD2D 1S5BD 5C44B 2EVBA 4C3JG 3GTOB 4XYOA 2BE5D 4C2MB 1HRJA 3QO2A 4N9TA 2E2HB 1QWYA 4DXFA 3X3MA 2A6HC 4PMBA 1U4MA 5C4HA 3DEOA 3DWAA 4OIKA 4C3IB 1PRTF 2KECA 1GUTA 3NBIA 1PLFA 5IGDA 3SK8A 5J1ZA 2RQXA 2K1BA 2JYOA 4NP5A 1R4PB 3AMUA 2XIWA 5CV5A 3NQIA 1VF7A 3V05A 2FFKB 2F3WA 5F2DA 2VNUD 1XX8A 3C46A 4KN7C 2KA7A 1MBYA 1QG7A 4F88A 4P2CB 1TR5A 5IIFA 4KD4A 1I3QB 1ET6A 3BDLA 2F0NA 3IKJA 4PV1C 1ESRA 5D3DA 3HRZC 2LFNA 3A55A 1HTPA 3VYTA 1VCIA 4DA2A 3H91A 4BY7B 2K6AA 1CM9A 3M7GA 1RODA 1WTWA 5LL6X 2M9VA 5ELEA 3S2DB 2Z8LA 1QOHA 4X3KA 2RSNA 2QCPX 1A6XA 1AZQA 3PO2B 4U68A 2CW0C 4ME5A 3C3LA 2F0EA 4RWSC 2A6ED 3BVMA 5LHY1 2IX3A 2LKVA 2KCNA 1D2BA 1SMYD 1TS2A 3S2HB 2MPMA 4A3MB 4K8IA 1F2YA 1B3AA 3CQZB 3MC0B 2FJ2A 2IX0A 5ISRA 5AFWA 3TZUA 1PMRA 4WORA 4L6TB 1PTOC 2BA1A 1EY0A 2JEAI 5C0XI 3VYUA 3D6CA 3VR5A 1NUCA 1HFNA 5DEHA 1SXTA 4K5VA 1STEA 1KNEA 5E4XA 2G9HD 1AFPA 1TWFB 3M85A 2AUKA 2DNCA 2EYMA 4OO1G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5NUC A;  1A3U A;  2EYL A;  5I6W A;  4ZUI A;  4F7X A;  1SNM A;  2F0Q A;  3SK5 A;  3BDL A;  5IGE A;  5KYI A;  4B9X A;  5J22 A;  3TP6 A;  2F0N A;  4G57 A;  1ENC A;  1KDC A;  1A3T A;  5IOC A;  2PW7 A;  2WAC A;  3SK4 A;  1EY8 A;  2F0O A;  3C1E A;  3HZX A;  3NK9 A;  4KY7 A;  4RKL A;  5CV8 A;  2EY5 A;  3SK6 A;  3TME A;  3NQT A;  5I6Y A;  1SNQ A;  4KY6 A;  5C3W A;  1KDA A;  4K5W A;  1U9R A;  2PYK A;  4ZQ3 A;  3ITP A;  3LX0 A;  3SXH A;  3S9W A;  2SOB A;  2OEO A;  1EQV A;  2EYP A;  4J6H A;  5CV4 A;  1SNO A;  4PNY A;  5IGC A;  2EY2 A;  3RUZ A;  4IUN A;  4J1M A;  3ERO A;  4DF7 A;  3MXP A;  4ODG A;  2RBM A;  2OXP A;  3OWF A;  4IAL A;  4WRD A;  3TP5 A;  4ZUJ A;  4NKL A;  3NUC A;  3T13 A;  1JOR A;  2QDB A;  4KJN A;  3SHL A;  3P75 A;  2KHS A;  1TT2 A;  4PMC A;  3T16 A;  2F0F A;  5CV9 A;  5JOB A;  1A2T A;  4K5X A;  2EY1 A;  2PQE A;  1A2U A;  3NHH A;  3C1F A;  1IHZ A;  3QB3 A;  1EY4 A;  1TQO A;  3QOJ A;  4KY5 A;  4QB4 A;  4DFA A;  4ME5 A;  3BDC A;  4EVO A;  3D4D A;  3DMU A;  5I9O A;  1EYC A;  2F0E A;  1A3V A;  4NMZ A;  5KRU A;  2M00 A;  5KEE A;  1SYE A;  2F0T A;  2RDF A;  3NXW A;  4K6D A;  2F0D A;  1SYG A;  4KD3 A;  3MVV A;  4HMJ A;  1KAB A;  1SYB A;  2PZT A;  2RKS A;  4EQO A;  5CR3 A;  3EJI A;  2SNS A;  4OL7 A;  4H7B A;  4K8J A;  1F2M A;  2LKV A;  3ERQ A;  1EYA A;  4KJO A;  5DAU A;  3QOL A;  4N9T A;  5M9O A;  4TRD A;  4HMI A;  4KV6 A;  2OF1 A;  3TP8 A;  5EKK A;  4DU9 A;  4DGZ A;  5CGK A;  1EZ8 A;  1EY6 A;  1STY A;  2NUC A;  3D4W A;  3MHB A;  4S3S A;  5E3F A;  5C5M A;  1RKN A;  1JOK A;  1SNP A;  1SND A;  2F0V A;  3TP7 A;  5I9P A;  4K8I A;  2F0U A;  1F2Y A;  1SYC A;  4B9W A;  2EYF A;  4PMB A;  1KAA A;  5C3X A;  1SYF A;  3P1H A;  4E6I A;  4KTA A;  3HEJ A;  1STB A;  4I65 A;  4ID6 A;  3VA5 A;  5C4H A;  4RKB A;  2EXZ A;  4F8M A;  3SR1 A;  5IGB A;  5EKL A;  2F0K A;  2EYO A;  3OMG A;  5C6A A;  5ISR A;  5KYL A;  5KIX A;  5K5P A;  1JOQ A;  4N9P A;  4MIU A;  1JOO A;  1EZ6 A;  3R3O A;  1STH A;  5HUR A;  5IGD A;  4WOR A;  3SK8 A;  1EYD A;  1SNC A;  2F0G A;  5J1Z A;  5J39 A;  2F0P A;  3E5S A;  3MZ5 A;  1EY0 A;  5IGF A;  1STA A;  3PMF A;  5CV7 A;  4NP5 A;  1STN A;  2F3V A;  4LAA A;  5CC4 A;  4EQN A;  3D6C A;  1F2Z A;  1NUC A;  2F0S A;  3OMC A;  3H6M A;  1SYD A;  5CV5 A;  5CV6 A;  5DEH A;  5C5L A;  2EYJ A;  3U9O A;  3DHQ A;  1AEX A;  2EYH A;  3MEH A;  4K5V A;  2F0J A;  2PZU A;  3OSO A;  2F0W A;  2F3W A;  5F2D A;  2F0L A;  5C4Z A;  5E1F A;  4QF4 A;  4KHV A;  1NSN S;  5IOD A;  2PZW A;  3EVQ A;  4HTH A;  1ENA A;  2KQ3 A;  4QMG A;  2F0H A;  2HQE A;  1EY9 A;  4IZ8 A;  2ENB A;  2SNM A;  2EYM A;  1EY7 A;  2EY6 A;  5KGU A;  1KDB A;  2O4X A;  1STG A;  3NP8 A;  4K2K A;  3D8G A;  4NDX A;  4YIJ A;  5JAV A;  5EGT A;  2PW5 A;  5IGG A;  2F0M A;  5HGT A;  4K2L A;  1TR5 A;  2F0I A;  1EY5 A;  3V2T A;  5IIF A;  4KD4 A;  4R8N A;  1II3 A;  4EQP A;  4K14 A; 
#chains in the Genus database with same CATH topology
 4XQQ A;  2A8V A;  1VMP A;  4LUO A;  3H0G G;  3A8I E;  3NE5 B;  1XMO L;  1K0R A;  3T1Y Q;  3F2B A;  3EBE A;  3FDT A;  1X3P A;  4DV0 L;  1V43 A;  5A2Q E;  1R4Q B;  2G9D A;  4XT1 B;  3S17 H;  4ZQ3 A;  2KHI A;  1VF5 C;  1HNW L;  1EQV A;  1KXL A;  4LUV A;  4X64 L;  2ICI A;  3GTG H;  4HSV A;  4WRD A;  5EPL A;  3PIP 3;  1OXU A;  1DOK A;  4ZUJ A;  3DWQ A;  3GTJ B;  2QDB A;  4HJ9 A;  3GTP B;  1EOV A;  1PTO F;  3CC2 A;  2F0F A;  2V1C C;  3OW7 A;  1PA6 A;  4YY3 L;  3IFD A;  5G3L D;  1D7Q A;  2ZJR A;  2IWH A;  2O5J C;  3GTQ B;  1E2V A;  1QNU A;  3H3V H;  3HOZ H;  5KEE A;  5C44 G;  1DGS A;  2F1M A;  4OIJ A;  1XWE A;  3A8J E;  4L5Q A;  4LF6 L;  5IT9 c;  4H7B A;  3M4Q A;  1U4L A;  3MAQ A;  2D62 A;  5I2X A;  4QJF A;  3JAM c;  5C5M A;  2DY7 A;  4E6I A;  3I8Z A;  3OIP A;  3SR1 A;  2B8G A;  2F0K A;  1IBM L;  4PZ7 A;  4C3I G;  5T1I A;  1CZW A;  4JK1 C;  5IWA L;  2RA4 A;  2CCZ A;  1Q86 C;  1YJW A;  1GUS A;  1RTN A;  2ZXR A;  2VQF Q;  5CV7 A;  4JI7 L;  3PUY A;  1PZI D;  5ELF A;  4FXD A;  1L2F A;  4C1N K;  3GP7 A;  2CQO A;  5C5L A;  1GUW A;  4Q5V A;  2ZJP A;  1VQC A;  2MJ8 A;  3DXJ C;  4HIM A;  1LTG D;  1N33 Q;  3PIO A;  3CPF A;  4A3J H;  3ND8 A;  1YZ6 A;  1EOT A;  4GLA C;  1IZ6 A;  2KJX A;  4ZRZ A;  4KI0 A;  1PH5 A;  5A2Q L;  5EBD A;  4A3D B;  2IJ0 A;  1LTI D;  1X65 A;  2PQA A;  1B4O A;  2Q2U A;  3S1Q H;  1UE7 A;  2F0I A;  4FXK C;  1NJI C;  1V1O A;  3CRL C;  1HQR D;  2EYL A;  5I6W A;  5IGE A;  5KYI A;  3HKZ E;  5IOC A;  3UDF A;  1YNX A;  4KKU A;  1X32 A;  1LAB A;  1U9R A;  1Q12 A;  4DV6 L;  5IYD G;  3Q24 A;  1Y8N B;  2QF7 A;  2SOB A;  3MWY W;  5JEA H;  5C4X H;  1HNZ L;  4BY7 G;  1CA5 A;  1SSO A;  3OWF A;  2Z6B A;  5ELO A;  4KN4 C;  2ZM6 L;  1TY2 A;  3PV0 A;  2MHV A;  4ZLT F;  2NVQ B;  1Q81 C;  5AJ3 Q;  3UI2 A;  4NXM L;  4IPC A;  3E9I A;  5JOB A;  1A2T A;  3URY A;  5JVG 3;  2UUA Q;  4C3H G;  1BNZ A;  3PO2 G;  4IO9 A;  4JCV E;  4QUC A;  5GRO A;  3T4A C;  3DMU A;  2VUM H;  2RDH A;  2XRS D;  2F0T A;  1L0W A;  1BVS A;  1OO9 B;  3RZD H;  1QVF A;  3T53 B;  4XT3 B;  2FHT A;  3TZD A;  2YV5 A;  2F52 A;  3NTI A;  3CXC A;  1KNA A;  4J15 A;  4H0L C;  2E2J B;  4DUY L;  2OT2 A;  4JYA L;  1B70 B;  1UE1 A;  4DV3 L;  3NWT A;  3MXU A;  1RKN A;  1ZYR C;  1JJ2 A;  4HJ5 A;  4HIO A;  1A0I A;  4A3M G;  1KD1 C;  2B63 B;  3EQL C;  4DAP A;  2AWO A;  5EKL A;  5FO8 B;  1VQK A;  1WOC A;  3V96 A;  1V8Q A;  2EYO A;  4V0B A;  3K0Y A;  3AFP A;  3CAM A;  4DR3 L;  3M4O B;  2CHB D;  2LS0 1;  1K28 A;  1N9W A;  4NXN L;  4B3T Q;  4LWC A;  4DXG A;  2F0G A;  4DV2 L;  1IL8 A;  1CQF A;  3K7A B;  4FF3 A;  4GKJ L;  1UAP A;  3E5S A;  3O13 A;  3AEV A;  2K5Q A;  3MFG A;  5IP9 G;  3SDZ A;  1TWG H;  1E22 A;  4DK3 C;  4DNI A;  4TSS A;  2JSO A;  1RDP D;  1LO5 D;  2JK8 A;  1I6H B;  3RD4 A;  4CDC C;  3ICE A;  2JQO A;  3E3X A;  3NWS A;  4A3K B;  3HGB A;  5IOD A;  1GJX A;  1GOZ A;  3G7L A;  2EPB A;  1VS0 A;  4CDF C;  4DR6 Q;  1YNN D;  1EY7 A;  2DY8 A;  2EY6 A;  3T1H Q;  1CKM A;  3I90 A;  3M4P A;  4YIJ A;  1Y1W G;  3HOX G;  3RNU A;  2E2I H;  2NVT B;  2PQA B;  2AQ1 B;  1BUV T;  3KJO A;  1Z6H A;  1SEB D;  1A3U A;  4DV7 Q;  2KCT A;  3J7A 5;  2WAC A;  3VDY A;  4POF A;  1Q8I A;  2DGY A;  5JEA J;  2GN5 A;  4YWM A;  5GAD C;  5JPN C;  4BA2 I;  3PCO B;  1KTK A;  3CCV A;  1D5Z C;  2B2W C;  2ICE C;  1EQR A;  3LWE A;  1SNO A;  4PNY A;  3SVM A;  4HID A;  4IUN A;  5CGK A;  2WB1 G;  4LFC Q;  1KC8 C;  3NUC A;  4RHR A;  5M5X B;  2EJF C;  4A4I A;  1G2S A;  2X69 A;  1S5C D;  1LAC A;  1B1Z A;  3LNN A;  3NHH A;  3W1B A;  1SFO B;  3J7Y W;  1SRU A;  1E3P A;  4OGQ C;  1CFM A;  2B2W A;  2UXC L;  1I4H A;  1SYE A;  1NR2 A;  1OXS C;  1D5X C;  4HCE A;  1SYG A;  1KAB A;  2PZT A;  4P74 A;  4A93 B;  1QNK A;  2K5V A;  3EJI A;  5LMN L;  4K8J A;  4A3J G;  3BJU A;  1PXU A;  2QEX A;  3BYT B;  3VYR A;  1EY6 A;  3R2T A;  1G29 1;  2D0O A;  2F0U A;  3IL8 A;  2XVS A;  5FLM G;  1SYF A;  2Q8I B;  2Z6K A;  1QVC A;  2MP1 A;  3I56 A;  4CKC A;  5KIX A;  1EU3 A;  2XN9 C;  1LT3 D;  2HIX A;  2J4X A;  2A69 D;  4MTK A;  1KAW A;  2L5T A;  1FJG L;  3FKI G;  5K36 G;  1VQH A;  2F4V L;  4ULL A;  5C4X G;  3VR4 A;  5C0X G;  4KMU C;  3KLR A;  3DHQ A;  3ND9 A;  2NZ1 D;  4R8I A;  3K81 C;  1I94 L;  4QF4 A;  2ZTE A;  1VQF A;  2LXJ A;  4QMG A;  4CBV A;  1ICW A;  1V1P A;  3S15 B;  5KGU A;  4A3D G;  4KHZ A;  1HNX Q;  3A54 A;  3G6J B;  4GKK L;  4H13 C;  3TSS A;  3V2T A;  4DV5 L;  5BR8 Q;  1TY0 A;  5EKI A;  4A3E H;  5DLQ E;  5C4J B;  2PW7 A;  2LMC B;  3HZX A;  2GA4 B;  4PZ8 A;  4JOI C;  1B9M A;  4CDE C;  3ZJY C;  2I07 B;  3S1M B;  4WJ3 M;  1KDA A;  2RSO A;  2PYK A;  3S9W A;  2K5N A;  5LMU L;  4ODG A;  1N8R C;  2MGS A;  4FNF A;  3MFY A;  1PYS B;  4HAE A;  3RN5 A;  4NKL A;  1KRS A;  3T51 B;  1JT8 A;  2NZH A;  4JOI A;  5FLX E;  2EY1 A;  3AFQ A;  2PQE A;  3H0G B;  3Q0A A;  3C1F A;  3T56 B;  1PRT C;  2RHQ B;  3BDC A;  1EYC A;  2R93 B;  4X3S A;  2KOL A;  2IHF A;  5M3M G;  2ZJQ A;  3MXN A;  5ELB A;  1EYG A;  2ZXP A;  2JA9 A;  4LUZ A;  3QJY A;  1YI2 A;  3CCL A;  1D5M C;  4UP7 A;  2QA4 A;  3WDN A;  1JB7 A;  4ZKC B;  3HOW B;  3BS1 A;  1SRO A;  5EKK A;  4RHS A;  3L2P A;  1JOK A;  4O1N A;  3OWE B;  5BN5 A;  2XWJ B;  1K73 C;  3T1Y L;  1AE2 A;  4I7Z C;  1K0S A;  2Q8T A;  1TS3 A;  2L11 A;  4DR2 Q;  1HA5 A;  3OMG A;  5EPJ A;  4KKS A;  4L5T A;  1ZXT A;  3SGI A;  1EZ6 A;  3R3O A;  5M3F H;  1Q3L A;  4HR7 B;  2XRQ D;  3FRP B;  2KBN A;  3OHX C;  1PV4 A;  1EYD A;  1SNC A;  4OX9 L;  4AH6 A;  2F0P A;  3PMF A;  3H09 A;  4BBR H;  2R92 H;  1HZC A;  1I50 B;  2D9U A;  3H94 A;  1S5F D;  3S1N B;  1NBW A;  2MO0 A;  4X65 L;  4IOC A;  3GV3 A;  3HOV H;  1Q82 C;  4HTH A;  2WKC A;  2G5D A;  1SJH D;  3D31 A;  3Q23 A;  5EPK A;  3RZO B;  1V1P B;  4PMW A;  4X62 Q;  1TII D;  1EFI D;  2BOS A;  3E0E A;  3TME A;  2B2T C;  2I0Q A;  3H3V C;  1QZH A;  3CC4 A;  1I4P A;  2BDO A;  5J3B A;  2A1A A;  2K5H A;  1WJJ A;  1GXD C;  2UUB Q;  1WTP A;  1KHI A;  4KY7 A;  4PQX A;  4AIM A;  2O5I C;  1MGS A;  5FLX L;  2JXM B;  4BY1 G;  4JBW A;  1YJ9 A;  1PH6 A;  3RR5 A;  2JA5 H;  1VQA A;  1Y8P B;  4JI1 L;  3S1R B;  2EYP A;  3KLS A;  3H3V I;  2WB1 E;  2GVB A;  4DR1 L;  2B2T A;  2OXP A;  5FKA C;  3F2D A;  1CKN A;  4LF4 L;  5IE8 A;  1DCZ A;  3JAM E;  4FO2 A;  1F2L A;  3QB3 A;  3QOJ A;  4RH6 A;  3ZYY X;  4DR4 Q;  3J80 E;  1SN8 A;  3PIO 3;  2OWO A;  4XDX A;  1WTR A;  3I4N H;  1G2T A;  4KD3 A;  3MXN B;  3BZK A;  1BCP C;  3R2I A;  1WTH A;  3GTM H;  3D6W A;  1TWC B;  4EQ5 A;  1N34 Q;  2PO4 A;  3FMC A;  1R9T B;  1WTQ A;  3K5N A;  2QW7 A;  2I5H A;  3MHB A;  3PF4 A;  4LFB L;  1L0Y B;  1D1K A;  1SND A;  1PRT B;  3BZC A;  4JI3 Q;  1LTT D;  2A68 C;  1RCV D;  4C3H B;  3VA5 A;  5A35 A;  2BA0 A;  3S16 H;  1PFB A;  3D4R A;  1WCM B;  1W2B A;  1K83 H;  4A3I H;  4CKB A;  1O80 A;  4JBK A;  3DEP A;  1B44 D;  2IY5 B;  5CBA E;  1STA A;  5DNF A;  1YHA A;  1MI2 A;  1JWM D;  1DZ1 A;  1CTM A;  3G71 A;  4UDU C;  4F87 A;  5IYB H;  4LF9 L;  4JG2 A;  2JA8 B;  3A5Z B;  2EYJ A;  1AZP A;  2PZU A;  3G6E A;  5M5Y B;  3HS0 C;  1EWI A;  1SDF A;  2KHJ A;  4IOA A;  1ENA A;  4QUF A;  1Y8O B;  2N3S A;  2PI2 E;  1Q46 A;  2FXQ A;  2UU9 Q;  2DN8 A;  4JI4 Q;  5CYU A;  2PW5 A;  5E7N A;  1EIH A;  3S17 B;  1EY5 A;  3HOU G;  1LTB D;  4X66 Q;  1BCP F;  1I5F A;  4P73 A;  4DUZ Q;  4G57 A;  3NBH A;  3KF6 A;  5M5W H;  3SK6 A;  2LY7 A;  1GVP A;  4JW0 A;  1L1O C;  3A5U A;  1DXM A;  3CPW A;  3UE0 A;  3LX0 A;  3SXH A;  4ALP A;  4B3T L;  3OTO Q;  1G51 A;  5TSS A;  4J1M A;  3ERO A;  3VR6 A;  1C4Q A;  1Y1W B;  2XNA C;  2Z9H A;  3KDF A;  4EX5 A;  4IUQ A;  3SE0 A;  1M1K C;  1B9N A;  3HOX B;  3HOZ B;  2BE5 C;  1CKN B;  1LUZ A;  1G8Z D;  4KJN A;  4IUT A;  4CDD C;  2A5H A;  1ZKO A;  3I3C A;  1TT2 A;  4A3G H;  2A74 C;  1JC7 A;  3QWN A;  2WIN B;  4R9W A;  1CA6 A;  1L1O A;  3U4V A;  3Q8D A;  4ZAI A;  1TQO A;  1YBY A;  1HTL D;  2YTY A;  2B2V C;  1RJT A;  5I9O A;  1Q7Y C;  4GN3 B;  2QIL A;  4Y7N H;  3ONA B;  1AW7 A;  2R93 G;  3QR8 A;  4ZK9 B;  2WB1 B;  3HOW G;  5L37 A;  4KV6 A;  1PYB A;  4DV7 L;  1AE3 A;  4L8J A;  1U0L A;  1Y69 U;  1EIF A;  4B3R L;  1H95 A;  5IYC H;  3EIV A;  1RTO A;  1EEF D;  2B2V A;  1IBK Q;  3P1H A;  4L5S A;  4BXX H;  4JV5 Q;  4ID6 A;  1LV9 A;  3FHW A;  5C6A A;  2Y0S G;  1JOO A;  1Z7T A;  4A3F H;  2WAQ E;  1VMC A;  1BCP B;  1GUN A;  5J39 A;  4LFC L;  2OQ0 A;  4A3J B;  2K52 A;  3RLF A;  1JJC B;  5JJK A;  1FYC A;  4LAA A;  3I4M G;  3E9H A;  3OMC A;  2VXW A;  3CCU A;  1CZG A;  1SYD A;  1W6J A;  1CHP D;  3M7N A;  1BO0 A;  3GQB A;  1AEX A;  4OWX B;  3S1Q B;  3KBX A;  1XYI A;  4B3S L;  4K0K Q;  3A7A B;  1XPO A;  5C4Z A;  4KLK A;  1I4X A;  4PG3 A;  2B29 A;  1JIC A;  2PZW A;  1K3B C;  1FR3 A;  2F0H A;  2N78 A;  2NTS A;  4TVA B;  3S24 A;  1RHP A;  3PUZ A;  1IYJ B;  3U9S A;  2JA7 H;  2YU9 H;  1XTD A;  3FKI B;  1Y1V H;  4XQN A;  1II3 A;  1U4P A;  4F7X A;  3A8K E;  1VQL A;  5C4X B;  4RG1 A;  4B9X A;  1N36 L;  1D1I A;  1ESF A;  3NEM A;  5I2Y A;  1MIU A;  2WKD A;  1K8A C;  3C1E A;  3GD7 A;  3NBH B;  4M1U B;  3PO3 H;  1IW7 D;  2HHH L;  2YTX A;  3KF6 B;  3UDX A;  1FL0 A;  1W3S A;  2VY3 A;  2HCI A;  2PNR C;  1G6Z A;  3N52 A;  1CKO A;  1PTO B;  1EEI D;  2L55 A;  4FF2 A;  4IAL A;  4CJ0 B;  2VUM B;  2D5D A;  4KHP Q;  3TP5 A;  3KDF B;  1JOR A;  1J8I A;  3P75 A;  1JWS D;  3RZD B;  3IFT A;  2E75 C;  3ULP A;  4IPD A;  1EY4 A;  1L1O B;  4DFA A;  4EVO A;  4HJA A;  5JPM C;  4LMQ D;  3MA2 B;  1YHB A;  4RGN A;  2F0D A;  3DWP A;  3KOJ A;  2R61 A;  3MVV A;  2RKS A;  4A3B H;  2RF4 A;  2MFI A;  4IFD H;  1B7Y B;  3K59 A;  3QOL A;  5BR8 L;  5M9O A;  4RAU C;  4YHH Q;  3TP8 A;  1EZ8 A;  1QVG A;  4GNX C;  3D4W A;  4DR5 L;  3PF5 A;  2DUD A;  3TP7 A;  2EYF A;  2NVX H;  1EL0 A;  1N32 Q;  2EXZ A;  1X3E A;  1TWG B;  1YEZ A;  5FJ8 H;  4G4K A;  3KFU A;  1WCM G;  4N9P A;  1KLG D;  4MIU A;  3U50 C;  5HUR A;  1O78 A;  5M3M B;  4DR7 Q;  4MHE A;  1PZK D;  2BH8 A;  2K4K A;  2QKI C;  4RGO S;  2ES2 A;  2Q2I A;  5JJL A;  2VQE Q;  4GNX A;  5IGF A;  1STN A;  1F77 A;  5GQO A;  2JA6 H;  1YHQ A;  5CV6 A;  3Q6S A;  4BBS H;  1MSG A;  1C9O A;  4IN3 A;  2JA8 G;  1J9O A;  1QJO A;  2E2I B;  4LF5 L;  1UUP A;  3MEH A;  3DM3 A;  1K8G A;  1HUN A;  4KHV A;  1I4Q A;  1BOS A;  1GUG A;  3P20 A;  1K9M C;  2SNM A;  2WAQ B;  3PSI A;  2MO1 A;  1KDB A;  2O4X A;  2I5L X;  4POG A;  3D8G A;  2F0M A;  1B50 A;  1HUM A;  1V9P A;  3J81 j;  3STB D;  4EQP A;  1FGB D;  1SNM A;  3W5O A;  1F9S A;  2EQS A;  3E0J A;  4JC0 A;  2L9H A;  1EY8 A;  3NK9 A;  3F2U A;  3FEW X;  4B08 A;  1Q1E A;  3NQT A;  2VS1 A;  4LF8 Q;  4DK0 A;  5C3W A;  2ZT9 C;  1OXX K;  2B3G A;  1A63 A;  4JI6 Q;  2L1B A;  3CU7 A;  1XTC D;  2UUC Q;  2OEO A;  1QCB D;  3BG3 A;  2MNA A;  1F9P A;  1G6P A;  2RBM A;  1HHV A;  1UNS A;  3KLS X;  3WWV A;  2NN6 H;  2NWG A;  1MSH A;  3HOZ G;  5ELD A;  3T13 A;  4A3F G;  1XMQ Q;  3HG9 A;  4JI0 L;  3TS2 A;  1VQD A;  1PRT D;  2IT1 A;  3K8A A;  1A2U A;  4A3C H;  1XMO Q;  1IHZ A;  1TWA B;  1P8L A;  2UXD L;  2K04 A;  3D4D A;  4BY1 B;  4DV0 Q;  3A74 A;  4IFD J;  1ZEQ X;  2E2J H;  1E2W A;  4RCN A;  3RMH A;  2R7Z H;  2AHO B;  2R3Z A;  1SYB A;  5E4W C;  3PIP A;  4X62 L;  2B63 H;  4X64 Q;  5GAG C;  4ME3 A;  5DAU A;  1DOL A;  4G7O C;  1XNQ L;  4DGZ A;  4OWW B;  1Z9F A;  1ASY A;  2HUG A;  4JI2 L;  4XXE A;  1E0B A;  1AP0 A;  2OTL A;  3GTL H;  4B9W A;  2XTI A;  4YY3 Q;  4X3T A;  1PVO A;  4C3J H;  1H9S A;  3OYY A;  2Y0S E;  3Q22 A;  1IBL L;  2PPB C;  2NBF A;  4HJ8 A;  1K8O A;  5K5P A;  1JOQ A;  2XWB B;  1STH A;  1ENF A;  4PZ6 A;  5G3L F;  2C9O A;  4TQU S;  4LF6 Q;  1F9R A;  5EAY A;  4FDB A;  4JI5 L;  1NNX A;  3J80 i;  4GNX B;  4AQY L;  4A3K H;  5CC4 A;  4EQN A;  1X3Q A;  2A6H D;  5FO9 B;  4GLX A;  3QIA A;  2K14 A;  5T1G A;  1EWC A;  4FP5 D;  2EIF A;  2EYH A;  1PYW D;  2NVT H;  1IBM Q;  4A3E B;  5DM7 3;  1XNR L;  3HP3 A;  3NSW A;  3VYS A;  1C7Y A;  2LXK A;  5IWA Q;  3KYH C;  2HQE A;  3OIQ A;  3CCM A;  3S14 H;  3GDE A;  5HGQ A;  1KL9 A;  1KRT A;  4FXG C;  4CHT B;  4JI7 Q;  3BYY B;  5JEA G;  2L15 A;  1X9N A;  4GLV B;  1AN8 A;  5C3X A;  5IP7 H;  1TWH H;  3KBG A;  2QGQ A;  3J81 E;  1IYV A;  3CF5 A;  1LTR D;  4HN7 A;  1SE4 A;  4V19 0;  4LFA L;  2BH2 A;  1YNJ C;  1PFS A;  1GO3 E;  2PCF B;  3I91 A;  3MXP A;  1SFO H;  2R7D A;  2VUM G;  2ID0 A;  2J7Z A;  3HOU B;  3A0J A;  1WI5 A;  4P75 A;  1LYL A;  4LF7 L;  2HDL A;  1HJP A;  1OXT A;  1RIP A;  1CSQ A;  1C0A A;  1HZB A;  1VQO A;  4HJ7 A;  5COY A;  3HFZ B;  2UU9 L;  2P5Z X;  4JI4 L;  3AU7 A;  5C3E H;  1WTX A;  4R1J A;  3ERQ A;  4JI8 L;  3HOY H;  4X66 L;  3G4S A;  2ZM6 Q;  2OF1 A;  2KED A;  4DU9 A;  1XXG A;  3GTK H;  2A68 D;  5M3F B;  1XJV A;  3K7U C;  3DLL A;  1YJN A;  1CT1 D;  1S3O A;  2F0V A;  3OW2 A;  2CW0 D;  4BS9 A;  1YIJ A;  4DV1 Q;  4B3M Q;  1H9S B;  3R8B A;  1PDQ A;  1VQ9 A;  4BBR B;  2R92 B;  2K7V A;  4WJ4 A;  2AUJ D;  4FYD A;  4RGT A;  3PQI A;  1ILQ A;  4IUR A;  3OTO L;  3SEB A;  1H9K A;  1LT6 D;  4DV4 L;  1JJG A;  3LWU A;  1A15 A;  5D14 A;  2F3I A;  2F3V A;  4DUY Q;  4JYA Q;  4DV3 Q;  1S5D D;  3H6M A;  1EQQ A;  1PH1 A;  3TRZ A;  1S40 A;  2B39 A;  4LJZ C;  2F0J A;  4R4O A;  2Z4I A;  3CCR A;  2ALY B;  1JWU D;  4HED A;  4BWG B;  5H1S E;  4DR3 Q;  3ERS X;  2Y0S B;  3J81 L;  4G7H C;  4DAY A;  1PTO D;  1O7I A;  5C4J H;  1SMX A;  1BXT A;  1HR0 Q;  4NXN Q;  2KVM A;  2WAQ G;  4DV2 Q;  4A3L H;  1PFN A;  3CD6 A;  2NVY H;  1VQP A;  1IXR A;  2JA5 B;  1BBW A;  1VQE A;  4QY7 A;  4K14 A;  1SAP A;  5NUC A;  3I4M B;  3CW2 C;  3IAY A;  1IKL A;  3RLO A;  2KCM A;  2RVL A;  1E2Z A;  1ENC A;  1VQM A;  1A3T A;  1SE8 A;  4FF4 A;  1XPR A;  5I6Y A;  4OO1 H;  2B2U C;  1I4R A;  1F9Q A;  2JP1 A;  3K5M A;  3W3A A;  2WFW A;  4DK6 C;  1PH4 A;  4R4Q A;  4LK1 C;  4NPS A;  4JPB W;  5FK9 C;  3DM1 A;  1QB5 D;  1VQ4 A;  3I4N B;  5JJI A;  4R4I A;  2OCE A;  1ILP A;  1CHQ D;  2IPK D;  2EOT A;  2J0T D;  4XTC S;  2B2U A;  2HQL A;  1HCZ A;  1I4G A;  2E2D C;  3GTM B;  3W1G A;  2AWN A;  2K75 A;  1M4V A;  3FPU B;  4K0K L;  4KY5 A;  3U4Z A;  3PUX A;  2VB3 X;  4ZKB B;  1WD1 A;  1E7Z A;  4NMZ A;  3NXW A;  2K28 A;  4UP8 A;  2VQF L;  3MTS A;  1F2M A;  4KK7 A;  3S16 B;  3F8T A;  5EBC A;  2A69 C;  4TRD A;  1K83 B;  5KND A;  4A3I B;  5C44 H;  5IT9 E;  1HA6 A;  5E3F A;  5I9P A;  3EFX D;  4A76 A;  3HEJ A;  2HT1 A;  3GTO H;  1N33 L;  4C2M H;  1EQT A;  2K03 A;  2UXC Q;  2E2H H;  3C2P A;  1H9M A;  5IP7 G;  2QDL A;  2K50 A;  3F2C A;  4KHP L;  3AYH B;  4K6L A;  3BU2 A;  5DM6 3;  2NYZ D;  2Z4H A;  4OHJ A;  3M3Y B;  4QGU A;  4IUP A;  2AMC B;  1F2Z A;  2CQA A;  4C3I H;  2K5D A;  2EJG C;  3D0F A;  4IUV A;  2EDG A;  3EN2 A;  1EU4 A;  1NSN S;  4A3E G;  1LTA D;  4DAY B;  5M5W B;  4CKE A;  1G91 A;  4NDX A;  4K2K A;  1FJG Q;  2WP8 J;  4K2L A;  2L12 A;  1UEA B;  2F4V Q;  4QIW E;  5AJ3 L;  3A56 A;  1JR0 D;  1TU2 B;  4O42 A;  2UUA L;  5IY0 A;  3CMA A;  3SK4 A;  1N32 L;  1HQM C;  1NCV A;  5JJZ A;  3CHB D;  1LT5 D;  4A3G B;  2A73 B;  2C5C A;  1I3Q H;  3ULL A;  3KUP A;  3RUZ A;  4DF7 A;  2VQE L;  5FLX c;  4IJH A;  4Y7N B;  3IRB A;  4DV5 Q;  2X6L A;  2XSC A;  1MKH A;  1SLJ A;  3K57 A;  4IFD I;  1J5E Q;  4LNQ A;  1HH2 P;  2B8F A;  4PMC A;  2KUM A;  3T16 A;  5IYD H;  2K5W A;  3D3R A;  4WFN 3;  4GZY C;  2KEE A;  4YCW A;  3GTG B;  4BY7 H;  5IT9 L;  5IGG A;  3VR2 A;  5FOB B;  2SDF A;  4IPG A;  3JAM L;  1Q90 A;  2RDF A;  2F03 A;  3S2D H;  3J80 L;  5CR3 A;  3J7Z C;  5LMU Q;  3I4O A;  4C3H H;  1T5X D;  3PO2 H;  1CK1 A;  3K5O A;  2VB2 X;  1A8V A;  4A3F B;  4Y52 H;  1CI3 M;  5M3F G;  1STY A;  4S3S A;  3CCE A;  2ATW A;  1DOM A;  3MEF A;  4LF8 L;  2R7F A;  4RKB A;  1ET9 A;  4BBR G;  2R92 G;  2UXB Q;  4DAV A;  4JI6 L;  5KYL A;  1VQI A;  3S2H H;  1E1O A;  1RD9 D;  2IL8 A;  4DR6 L;  2FIN B;  4TKO B;  3TN2 A;  3T1H L;  4A3M H;  3HOV G;  3CQZ H;  4NW2 A;  1ZYR D;  1HFG A;  4HCS A;  4MZ9 A;  2F0S A;  2EXD A;  4QCL A;  2DNE A;  2PNH A;  3J7A F;  5CMD A;  5ELC A;  1NR4 A;  3U9O A;  3L7Z C;  2BCO A;  3BDO A;  2JA7 B;  2E8G A;  2YU9 B;  3NPP A;  3OSO A;  1Y1V B;  3AB9 A;  3CRK C;  3LGJ A;  2E5L Q;  3NTK A;  4X6A H;  5IP9 H;  2KCC A;  2NZO A;  3EVQ A;  2KQ3 A;  1MJE A;  1PFM A;  3L0O A;  3PO3 B;  4IZ8 A;  1T9H A;  4OX9 Q;  3P7J A;  3PUW A;  4LW1 A;  2E76 C;  2CVR A;  2JA5 G;  1HXY D;  3SK5 A;  1NTG A;  2H4O A;  1TWF H;  2NN6 I;  3TP6 A;  4I7A A;  4CJ2 C;  1KDC A;  5FO7 B;  2HCC A;  5I4D A;  1EIY B;  1XPU A;  2F0O A;  4RKL A;  4X65 Q;  4XQJ A;  1Y1W H;  1AH9 A;  3HOX H;  4CJ1 B;  4APV A;  1VQ6 A;  2AQ2 B;  1MHW C;  5CV4 A;  4IUU A;  5BN3 A;  2IHE A;  5LL6 S;  2K05 A;  1OTC A;  3BVG A;  1HZ9 A;  3I4N G;  2K32 A;  2KHS A;  1X3G A;  2M2L A;  3J80 c;  1KLU D;  4A3B B;  4QIW B;  1DM0 B;  1X56 A;  4BA1 I;  4U67 3;  2CH4 A;  1JMC A;  1A3V A;  1U5K A;  2M00 A;  3AQQ A;  4L5R C;  3TQY A;  3GTJ H;  2JE6 I;  2Z1C A;  1C8C A;  3GTP H;  4JI1 Q;  2NVX B;  3KLW A;  2A6E C;  1TKW B;  5GAH C;  1O7Y A;  2SNS A;  4OL7 A;  2K01 A;  2TSS A;  3I4L A;  5COR A;  4EGV A;  3J81 i;  2IW3 A;  4DR1 Q;  4KJO A;  4IPH A;  3GTQ H;  4LF4 Q;  4OEM B;  4A3I G;  4UP9 A;  2NUC A;  4Z9C B;  1SMY C;  3L9A X;  1QE6 A;  4YWL A;  1ML0 D;  2AKW B;  3DUZ A;  1FNW A;  3WOF A;  3UDG A;  3PUV A;  2YTV A;  2WII B;  2NTT A;  4F8M A;  1NMG A;  4RMF A;  5HY6 A;  2PMZ B;  1JB3 A;  2JA6 B;  2FMM A;  4MNO A;  4BBS B;  5IYB G;  1CSP A;  4AYB B;  1U4R A;  4UPA A;  3X3N A;  5FLM H;  1HNX L;  1HPC A;  1WVL A;  3BZD B;  5D65 A;  3QG1 A;  1H9R A;  3K0X A;  1VQB A;  4LFB Q;  2VW9 A;  4HIK A;  1VQN A;  4YWK A;  4WJW A;  4N8X 1;  3TEH B;  3FKI H;  1WTV A;  5K36 H;  2E74 C;  3A7L A;  1BR9 A;  1VQG A;  2FMC A;  4HSP A;  4UAI A;  5C0X H;  1TS4 A;  3UE1 A;  1SE3 A;  4DNT B;  5EGT A;  2D0P A;  3K58 A;  1JE4 A;  1BBX C;  4R8N A;  1O7Z A;  3RLN A;  4ZUI A;  4UHV A;  1B53 A;  1DON A;  4LF9 Q;  1X55 A;  4DV1 L;  4RA8 A;  4C1N I;  4YCV A;  1PTO H;  4B3M L;  3OPO A;  5CV8 A;  3M4Y A;  4M8A A;  4A3D H;  1YNJ D;  1IYU A;  1TS5 A;  2K33 A;  4Q0F A;  1LM0 A;  4A3G G;  2MUY A;  5CBE E;  1ONL A;  3E6Z X;  4L63 B;  2N88 A;  3K5L A;  1VQJ A;  1ASZ A;  1Q8K A;  3I7F A;  1MJC A;  1LLR D;  1PH8 A;  2NB0 A;  2R7Z B;  2O2L D;  2L0C A;  5JVH 3;  1Z47 A;  4K5X A;  2N8N A;  2RHS B;  3K6O A;  1YIT A;  4DR2 L;  3CME A;  1SJE D;  1I6V C;  5IYC G;  3GTL B;  4DN4 M;  1HR0 L;  3FPP A;  2NVQ H;  2WV6 D;  4HMJ A;  4G7Z C;  1K3R A;  4C3J B;  3K80 C;  4EQO A;  4BXX G;  1EFW A;  1C48 A;  4JBM A;  1WTO A;  4RGM A;  3VR3 A;  1UE6 A;  3I70 A;  1Q1B A;  2CKZ B;  4HMI A;  4O0A A;  3JC6 6;  1UWV A;  5D3I B;  4H44 C;  4XIG S;  1SNP A;  3CCQ A;  5M3M H;  1GUO A;  1EWH A;  2OQK A;  2Q8R E;  4KTA A;  3F1Z A;  4I65 A;  2RCN A;  3L3O C;  4FVM A;  1VQ8 A;  2Q2T A;  2TMP A;  2HDM A;  2XGT A;  5KNB A;  1HNW Q;  1B2T A;  1M8A A;  4MN3 A;  2RDG A;  1PZJ D;  3I73 A;  3MZ5 A;  3W2D A;  1S4Z A;  2R6G A;  1WFQ A;  2KEN A;  2N55 A;  4B3R Q;  3M4O H;  3S14 B;  1FVI A;  3GO5 A;  2F4I A;  2UUB L;  1YVC A;  1BDO A;  2L4N A;  2JA7 G;  3K7A H;  2I5M X;  1Y1V G;  5C0X J;  2F0W A;  1IW7 C;  5E1F A;  3R93 A;  1O7L A;  1L0X B;  4OO1 I;  5BN4 A;  1S5E D;  1EIG A;  5KNC A;  4DPG A;  1NAP A;  3PO3 G;  1TWH B;  1J6Q A;  2ENB A;  3JAM i;  1STG A;  5JAV A;  1I6H H;  2BDN A;  2IX1 A;  1FNU A;  1PHJ A;  2F0Q A;  3HKZ B;  3CP0 A;  4CGY B;  5EQ0 A;  2C35 B;  4RCO A;  1DYQ A;  3PGZ A;  4B3S Q;  4DR4 L;  3G48 A;  4KY6 A;  2Z6K C;  3I55 A;  1IKM A;  2LSS A;  2EZV A;  4K5W A;  3ITP A;  4DKA C;  3CC7 A;  1NE3 A;  2YYZ A;  4ABN A;  3J7A V;  1T5E A;  1RF2 D;  2EY2 A;  2GVA A;  3MXG A;  4IQZ A;  1TWA H;  3FVQ A;  1N34 L;  4OON A;  2CWA A;  4BY1 H;  4FF1 A;  3NEL A;  1NY4 A;  4A3B G;  5CV9 A;  1JCK B;  1N36 Q;  1BF4 A;  1DD2 A;  5C3E B;  4JI3 L;  1FD7 D;  4J8Q A;  4IFD G;  2EJM A;  3HOY B;  2VZA A;  2HHH Q;  4QB4 A;  3GTK B;  4DAM A;  4ILW A;  5KRU A;  5M5X H;  1SE2 A;  2ASB A;  3I2Z A;  4K6D A;  4YCU A;  1X54 A;  3H15 A;  3TDQ A;  2HD3 A;  1TVX A;  3TBI B;  4N8F A;  2JJQ A;  1EYA A;  5ELN A;  5FJ8 G;  4C56 C;  2AQ3 B;  2QEJ C;  2X6G A;  1SBB B;  1WYD A;  3HKS A;  2V4D A;  1SYC A;  2ZTC A;  1KAA A;  4X3U A;  1QIL A;  4A93 H;  1STB A;  4A75 A;  5IGB A;  2N49 A;  1LTS D;  2JA6 G;  3GV6 A;  1VDZ A;  4BBS G;  1BCP D;  4DV6 Q;  2H5X A;  1FNV A;  3KK7 A;  3UDI A;  4AYB G;  1GM5 A;  5GAE C;  1HNZ Q;  3N6R A;  3NTH A;  1W6K A;  1GHK A;  3EA6 A;  3OOC A;  2I46 A;  2SEB D;  1J5E L;  1BKB A;  4DUZ L;  4DR5 Q;  1LT4 D;  4RFB A;  3STB C;  1WD0 A;  4NXM Q;  1DJR D;  2NVY B;  2JEB I;  3BVZ A;  1CQV A;  1GHJ A;  1H9J A;  2F0L A;  3FP9 A;  1SR3 A;  1KIX A;  2H1E A;  3WOE A;  2Q2H A;  3M9B A;  1GD7 A;  1EY9 A;  1JQY D;  3VA7 A;  2B2Y C;  3NP8 A;  3TS0 A;  1JE5 A;  5EJW A;  4DK1 A;  3HOV B;  5HGT A;  4QL5 A;  1OXV A;  4KKT A;  1YNN C;  3I72 A;  5J22 A;  1FGU A;  4LF5 Q;  3S15 H;  2EY5 A;  2NN6 G;  1SNQ A;  2UXB L;  3CKI B;  1D6E C;  3HOU H;  2B2Y A;  1GKH A;  1UEB A;  2D2C C;  1K8M A;  3KF8 A;  4J6H A;  4A3C G;  5IGC A;  4DNR B;  2CH4 W;  1BQQ T;  4GKJ Q;  2R7Z G;  3SHL A;  3S1M H;  4ZYS A;  1E1T A;  2ZXO A;  4XYQ A;  2B63 G;  1IBK L;  1Y14 B;  2EE1 A;  4JV5 L;  4OWT B;  1MD2 D;  2E5L L;  1M90 C;  1S5B D;  5C44 B;  4H02 A;  3CCJ A;  1VQ7 A;  2EVB A;  4C3J G;  3TRE A;  3GTO B;  4XYO A;  4OXP A;  2BE5 D;  4C2M B;  3NEN A;  3H0G H;  1HRJ A;  3QO2 A;  4N9T A;  3ULJ A;  1E24 A;  2E2H B;  4GOP C;  4JI0 Q;  1QWY A;  1PH3 A;  4DXF A;  3X3M A;  2R93 H;  2A6H C;  4PMB A;  1X3F A;  1U4M A;  5C4H A;  2VL6 A;  4A3K G;  2UXD Q;  4P71 A;  3DEO A;  3DWA A;  1VQ5 A;  4OIK A;  4C3I B;  3HOW H;  1PRT F;  1QUQ A;  2KEC A;  3ER0 A;  4P72 A;  1GUT A;  3NBI A;  1PLF A;  5IGD A;  3SK8 A;  5J1Z A;  4GOP A;  2RQX A;  2K1B A;  4NB3 A;  1HR0 W;  1HZA A;  4ZCK A;  1P16 A;  2JYO A;  4NP5 A;  4OEL B;  1R4P B;  2Z0S A;  1XNQ Q;  3AMU A;  2XIW A;  4JI2 Q;  5CV5 A;  3NQI A;  4IJL A;  1VF7 A;  3V05 A;  4O2D A;  2FFK B;  4GN4 B;  2F3W A;  5F2D A;  1IBL Q;  2VNU D;  1XX8 A;  3I4M H;  1BBU A;  3C46 A;  4KN7 C;  2KA7 A;  1I50 H;  1MBY A;  1QG7 A;  2DJG C;  1IL2 A;  4R4C A;  4F88 A;  3S1N H;  1D8L A;  5LMN Q;  4P2C B;  1TR5 A;  4JI5 Q;  1PH7 A;  3KJP A;  4AQY Q;  5IIF A;  4KD4 A;  3J81 c;  1I3Q B;  1ET6 A;  3BDL A;  2CWP A;  4R4T A;  2F0N A;  3IKJ A;  4PV1 C;  3HKZ G;  4JBJ A;  4QQB X;  1ESR A;  3RZO H;  5D3D A;  1PH9 A;  3HRZ C;  2LFN A;  3A55 A;  1XNR Q;  1NMF A;  1HTP A;  3VYT A;  4A93 G;  1VCI A;  4DA2 A;  2A19 A;  3H91 A;  4BY7 B;  3KF8 B;  2K6A A;  1CM9 A;  3M7G A;  1ROD A;  1WTW A;  1TXY A;  4YHH L;  2OTJ A;  2ZTD A;  4GN5 A;  5LL6 X;  2M9V A;  5ELE A;  3S2D B;  2Z8L A;  1QOH A;  5C3E G;  4X3K A;  2RSN A;  2QCP X;  3S1R H;  4MTN A;  1QZG A;  1AZQ A;  3PO2 B;  1A6X A;  4U68 A;  3HOY G;  2CW0 C;  4ME5 A;  3CCS A;  3C3L A;  2F0E A;  4GS3 A;  4RWS C;  2A6E D;  1I94 Q;  4UY8 C;  4LFA Q;  3BVM A;  1B8A A;  4DR7 L;  5LHY 1;  3B6Y A;  2IX3 A;  2RCF A;  1RL2 A;  2LKV A;  2KCN A;  1V1Q A;  1SMY D;  2CFM A;  1TS2 A;  1D2B A;  4GKK Q;  3S2H B;  5LMN W;  2MPM A;  4A3M B;  4K8I A;  1F2Y A;  4LF7 Q;  1B3A A;  3CQZ B;  3MC0 B;  1EUJ A;  2FJ2 A;  2PMZ E;  2IX0 A;  3M3Y H;  1TWC H;  5ISR A;  5AFW A;  1X6O A;  1PMR A;  3TZU A;  1R9T H;  1QUQ B;  4AYB E;  2DJF C;  1KQS A;  4WOR A;  4L6T B;  1PTO C;  2HIV A;  2BA1 A;  4JI8 Q;  4GOP B;  1EY0 A;  2JN4 A;  2JEA I;  5C0X I;  3VYU A;  3U58 A;  1LTL A;  3D6C A;  3VR5 A;  1ICF B;  1NUC A;  1HFN A;  1WCM H;  1S72 A;  5DEH A;  1SXT A;  4A3L G;  4K5V A;  1STE A;  1KNE A;  5E4X A;  1CUK A;  2G9H D;  1PH2 A;  1AFP A;  1B3Q A;  1TWF B;  3M85 A;  2AUK A;  4JVZ A;  2DNC A;  2UUC L;  2PI2 A;  2EYM A;  4DV4 Q;  4OO1 G;  2JA8 H;  1UE5 A;  3RN2 A;  2MQH A;  1A62 A;  1XMQ L;  5M5Y H; 
#chains in the Genus database with same CATH homology
 4XQQ A;  1VMP A;  3A8I E;  3NE5 B;  3FDT A;  1X3P A;  1V43 A;  5A2Q E;  1R4Q B;  2G9D A;  4XT1 B;  4ZQ3 A;  1VF5 C;  1EQV A;  2ICI A;  4HSV A;  4WRD A;  5EPL A;  3PIP 3;  1OXU A;  1DOK A;  4ZUJ A;  3DWQ A;  3GTJ B;  2QDB A;  3GTP B;  1PTO F;  2F0F A;  3OW7 A;  3IFD A;  5G3L D;  2IWH A;  2O5J C;  3GTQ B;  1E2V A;  1QNU A;  5KEE A;  2F1M A;  4OIJ A;  1XWE A;  3A8J E;  4H7B A;  1U4L A;  3MAQ A;  2D62 A;  5I2X A;  5C5M A;  2DY7 A;  4E6I A;  3I8Z A;  3OIP A;  3SR1 A;  2B8G A;  2F0K A;  4C3I G;  5T1I A;  1CZW A;  4JK1 C;  2RA4 A;  1GUS A;  1RTN A;  2ZXR A;  5CV7 A;  3PUY A;  1PZI D;  5ELF A;  4FXD A;  4C1N K;  3GP7 A;  5C5L A;  1GUW A;  4Q5V A;  2MJ8 A;  3DXJ C;  1LTG D;  3ND8 A;  1EOT A;  2KJX A;  4ZRZ A;  4KI0 A;  5A2Q L;  5EBD A;  4A3D B;  2IJ0 A;  1LTI D;  1B4O A;  2F0I A;  4FXK C;  1V1O A;  3CRL C;  1HQR D;  2EYL A;  5I6W A;  5IGE A;  5KYI A;  5IOC A;  4KKU A;  1X32 A;  1LAB A;  1U9R A;  1Q12 A;  3Q24 A;  1Y8N B;  2QF7 A;  2SOB A;  3MWY W;  5JEA H;  1CA5 A;  1SSO A;  3OWF A;  4KN4 C;  1TY2 A;  3PV0 A;  2MHV A;  4ZLT F;  2NVQ B;  3UI2 A;  5JOB A;  1A2T A;  3URY A;  5JVG 3;  4C3H G;  1BNZ A;  4QUC A;  3T4A C;  3DMU A;  2RDH A;  2XRS D;  2F0T A;  1OO9 B;  3T53 B;  4XT3 B;  2FHT A;  3TZD A;  3NTI A;  1KNA A;  2E2J B;  4H0L C;  2OT2 A;  3NWT A;  3MXU A;  1RKN A;  1ZYR C;  2B63 B;  3EQL C;  4DAP A;  2AWO A;  5EKL A;  5FO8 B;  3V96 A;  1V8Q A;  2EYO A;  4V0B A;  3K0Y A;  3M4O B;  2CHB D;  2LS0 1;  4DXG A;  2F0G A;  1IL8 A;  1CQF A;  3K7A B;  4FF3 A;  1UAP A;  3E5S A;  3O13 A;  2K5Q A;  3MFG A;  3SDZ A;  4TSS A;  2JSO A;  1RDP D;  1LO5 D;  1I6H B;  3RD4 A;  3NWS A;  4A3K B;  3HGB A;  5IOD A;  1GJX A;  1GOZ A;  3G7L A;  2EPB A;  1YNN D;  1EY7 A;  2DY8 A;  2EY6 A;  3I90 A;  4YIJ A;  2NVT B;  2AQ1 B;  1BUV T;  1Z6H A;  1SEB D;  1A3U A;  2WAC A;  1Q8I A;  5JEA J;  5JPN C;  4BA2 I;  1KTK A;  1D5Z C;  2B2W C;  2ICE C;  3LWE A;  1SNO A;  4PNY A;  3SVM A;  4IUN A;  5CGK A;  3NUC A;  4RHR A;  5M5X B;  2EJF C;  1G2S A;  2X69 A;  1S5C D;  1LAC A;  1B1Z A;  3LNN A;  3NHH A;  1SFO B;  3J7Y W;  4OGQ C;  1CFM A;  2B2W A;  1I4H A;  1SYE A;  1NR2 A;  1OXS C;  1D5X C;  4HCE A;  1SYG A;  1KAB A;  2PZT A;  4A93 B;  1QNK A;  3EJI A;  4K8J A;  1PXU A;  3BYT B;  3VYR A;  1EY6 A;  3R2T A;  1G29 1;  2F0U A;  3IL8 A;  2XVS A;  1SYF A;  2Q8I B;  2MP1 A;  4CKC A;  5KIX A;  1EU3 A;  2XN9 C;  1LT3 D;  2J4X A;  2A69 D;  2L5T A;  5K36 G;  4ULL A;  3VR4 A;  5C0X G;  4KMU C;  3KLR A;  3DHQ A;  3ND9 A;  2NZ1 D;  4R8I A;  4QF4 A;  4QMG A;  4CBV A;  1ICW A;  1V1P A;  3S15 B;  5KGU A;  4KHZ A;  3A54 A;  3G6J B;  4H13 C;  3TSS A;  3V2T A;  1TY0 A;  5EKI A;  5C4J B;  2PW7 A;  2LMC B;  3HZX A;  2GA4 B;  1B9M A;  2I07 B;  3S1M B;  1KDA A;  2RSO A;  2PYK A;  3S9W A;  4ODG A;  2MGS A;  4FNF A;  3MFY A;  4HAE A;  4NKL A;  3T51 B;  5FLX E;  2EY1 A;  2PQE A;  3H0G B;  3Q0A A;  3C1F A;  3T56 B;  1PRT C;  3BDC A;  1EYC A;  2R93 B;  4X3S A;  2KOL A;  3MXN A;  5ELB A;  2ZXP A;  3QJY A;  1D5M C;  3WDN A;  4ZKC B;  3HOW B;  3BS1 A;  5EKK A;  4RHS A;  1JOK A;  4O1N A;  3OWE B;  5BN5 A;  2XWJ B;  4I7Z C;  2Q8T A;  1TS3 A;  2L11 A;  1HA5 A;  3OMG A;  5EPJ A;  4KKS A;  1ZXT A;  1EZ6 A;  3R3O A;  1Q3L A;  4HR7 B;  2XRQ D;  3FRP B;  3OHX C;  1EYD A;  1SNC A;  2F0P A;  3PMF A;  3H09 A;  1I50 B;  2D9U A;  3H94 A;  1S5F D;  3S1N B;  3GV3 A;  4HTH A;  2WKC A;  1SJH D;  3D31 A;  3Q23 A;  5EPK A;  3RZO B;  1V1P B;  4PMW A;  1TII D;  1EFI D;  2BOS A;  3TME A;  2B2T C;  3H3V C;  1I4P A;  2BDO A;  1GXD C;  1WTP A;  4KY7 A;  4PQX A;  2O5I C;  1MGS A;  5FLX L;  2JXM B;  4JBW A;  1Y8P B;  3S1R B;  2EYP A;  3KLS A;  2B2T A;  2OXP A;  5FKA C;  1DCZ A;  3JAM E;  4FO2 A;  1F2L A;  3QB3 A;  3QOJ A;  4RH6 A;  3ZYY X;  3J80 E;  3PIO 3;  4XDX A;  1WTR A;  1G2T A;  4KD3 A;  1BCP C;  3R2I A;  3D6W A;  1TWC B;  2PO4 A;  3FMC A;  1R9T B;  1WTQ A;  3K5N A;  3MHB A;  1SND A;  1D1K A;  1L0Y B;  1PRT B;  1LTT D;  2A68 C;  1RCV D;  4C3H B;  3VA5 A;  5A35 A;  2BA0 A;  1PFB A;  3D4R A;  1WCM B;  4CKB A;  1O80 A;  3DEP A;  1B44 D;  5CBA E;  1STA A;  5DNF A;  1MI2 A;  1JWM D;  1DZ1 A;  1CTM A;  4UDU C;  4F87 A;  2JA8 B;  2EYJ A;  1AZP A;  2PZU A;  5M5Y B;  3HS0 C;  1SDF A;  1ENA A;  4QUF A;  1Y8O B;  2DN8 A;  5CYU A;  2PW5 A;  1EIH A;  3S17 B;  1EY5 A;  1LTB D;  1BCP F;  4G57 A;  3NBH A;  3SK6 A;  2LY7 A;  1DXM A;  3LX0 A;  3SXH A;  5TSS A;  4J1M A;  3ERO A;  3VR6 A;  1C4Q A;  1Y1W B;  2XNA C;  4IUQ A;  3SE0 A;  3HOX B;  1B9N A;  3HOZ B;  2BE5 C;  1G8Z D;  4KJN A;  4IUT A;  2A5H A;  1ZKO A;  1TT2 A;  3I3C A;  2A74 C;  1JC7 A;  3QWN A;  2WIN B;  4R9W A;  1CA6 A;  4ZAI A;  1TQO A;  1HTL D;  2B2V C;  1RJT A;  5I9O A;  2QIL A;  3ONA B;  1AW7 A;  4ZK9 B;  2WB1 B;  4KV6 A;  4L8J A;  1Y69 U;  1RTO A;  1EEF D;  2B2V A;  3P1H A;  4ID6 A;  1LV9 A;  5C6A A;  1JOO A;  1Z7T A;  1VMC A;  1BCP B;  1GUN A;  5J39 A;  4A3J B;  3RLF A;  1FYC A;  4LAA A;  3OMC A;  2VXW A;  1CZG A;  1SYD A;  1W6J A;  1CHP D;  3M7N A;  1BO0 A;  3GQB A;  1AEX A;  3S1Q B;  3KBX A;  1XYI A;  3A7A B;  5C4Z A;  1I4X A;  1JIC A;  2PZW A;  1FR3 A;  2F0H A;  2NTS A;  1RHP A;  3PUZ A;  3U9S A;  3FKI B;  4XQN A;  1II3 A;  1U4P A;  4F7X A;  3A8K E;  5C4X B;  4B9X A;  1D1I A;  1ESF A;  5I2Y A;  2WKD A;  3C1E A;  3GD7 A;  4M1U B;  1IW7 D;  2HCI A;  2PNR C;  1G6Z A;  3N52 A;  1PTO B;  1EEI D;  2L55 A;  4FF2 A;  4IAL A;  4CJ0 B;  2VUM B;  2D5D A;  3TP5 A;  1JOR A;  1J8I A;  3P75 A;  1JWS D;  3RZD B;  3IFT A;  2E75 C;  1EY4 A;  4DFA A;  4EVO A;  5JPM C;  4LMQ D;  3MA2 B;  4RGN A;  2F0D A;  3DWP A;  2R61 A;  3MVV A;  2RKS A;  4IFD H;  3K59 A;  3QOL A;  5M9O A;  4RAU C;  3TP8 A;  1EZ8 A;  3D4W A;  3TP7 A;  2EYF A;  1EL0 A;  2EXZ A;  1TWG B;  4G4K A;  4N9P A;  1KLG D;  4MIU A;  5HUR A;  1O78 A;  5M3M B;  4MHE A;  1PZK D;  2QKI C;  4RGO S;  5IGF A;  1STN A;  1F77 A;  5CV6 A;  3Q6S A;  1MSG A;  4IN3 A;  1J9O A;  1QJO A;  2E2I B;  1UUP A;  3MEH A;  1HUN A;  4KHV A;  1I4Q A;  1BOS A;  1GUG A;  3P20 A;  2SNM A;  2WAQ B;  1KDB A;  2O4X A;  3D8G A;  2F0M A;  1B50 A;  1HUM A;  4EQP A;  1FGB D;  1SNM A;  1F9S A;  3E0J A;  2L9H A;  1EY8 A;  3NK9 A;  3F2U A;  3FEW X;  4B08 A;  1Q1E A;  3NQT A;  4DK0 A;  5C3W A;  2ZT9 C;  1OXX K;  2L1B A;  3CU7 A;  1XTC D;  2OEO A;  1QCB D;  3BG3 A;  1F9P A;  2RBM A;  1HHV A;  1UNS A;  3KLS X;  2NN6 H;  2NWG A;  1MSH A;  5ELD A;  3T13 A;  3HG9 A;  1PRT D;  2IT1 A;  1A2U A;  1IHZ A;  1TWA B;  2K04 A;  3D4D A;  4BY1 B;  4IFD J;  1ZEQ X;  1E2W A;  4RCN A;  3RMH A;  2R3Z A;  1SYB A;  5E4W C;  5DAU A;  1DOL A;  4G7O C;  4DGZ A;  2HUG A;  4XXE A;  1E0B A;  1AP0 A;  4B9W A;  4X3T A;  1H9S A;  3Q22 A;  2PPB C;  2NBF A;  1K8O A;  5K5P A;  1JOQ A;  2XWB B;  1STH A;  1ENF A;  5G3L F;  2C9O A;  4TQU S;  1F9R A;  5CC4 A;  4EQN A;  1X3Q A;  2A6H D;  5FO9 B;  3QIA A;  5T1G A;  1EWC A;  4FP5 D;  2EYH A;  1PYW D;  4A3E B;  5DM7 3;  3HP3 A;  3NSW A;  3VYS A;  2HQE A;  3OIQ A;  4FXG C;  4CHT B;  3BYY B;  5JEA G;  1AN8 A;  5C3X A;  3KBG A;  3J81 E;  1IYV A;  1LTR D;  4HN7 A;  1SE4 A;  4V19 0;  1YNJ C;  2PCF B;  3I91 A;  3MXP A;  2ID0 A;  2J7Z A;  3HOU B;  2HDL A;  1OXT A;  5COY A;  3AU7 A;  1WTX A;  3ERQ A;  2OF1 A;  2KED A;  4DU9 A;  1XXG A;  2A68 D;  5M3F B;  1CT1 D;  2F0V A;  2CW0 D;  4BS9 A;  1H9S B;  3R8B A;  1PDQ A;  4BBR B;  2R92 B;  2K7V A;  2AUJ D;  4FYD A;  4RGT A;  1ILQ A;  4IUR A;  3SEB A;  1H9K A;  1LT6 D;  3LWU A;  1A15 A;  5D14 A;  2F3V A;  1S5D D;  3H6M A;  2B39 A;  4LJZ C;  2F0J A;  2Z4I A;  1JWU D;  4HED A;  4BWG B;  3J81 L;  2Y0S B;  4G7H C;  4DAY A;  1PTO D;  1BXT A;  2KVM A;  1PFN A;  2JA5 B;  4K14 A;  1SAP A;  5NUC A;  3I4M B;  3IAY A;  1IKL A;  2RVL A;  4FF4 A;  1E2Z A;  1ENC A;  1A3T A;  5I6Y A;  4OO1 H;  2B2U C;  1I4R A;  1F9Q A;  2JP1 A;  3K5M A;  3W3A A;  4LK1 C;  5FK9 C;  3DM1 A;  1QB5 D;  3I4N B;  1ILP A;  1CHQ D;  4XTC S;  2EOT A;  2IPK D;  2J0T D;  2B2U A;  1HCZ A;  1I4G A;  2E2D C;  3GTM B;  2AWN A;  1M4V A;  3FPU B;  4KY5 A;  3PUX A;  2VB3 X;  4ZKB B;  1WD1 A;  4NMZ A;  3NXW A;  2K28 A;  3MTS A;  1F2M A;  4KK7 A;  3S16 B;  5EBC A;  2A69 C;  4TRD A;  1K83 B;  5KND A;  4A3I B;  5IT9 E;  1HA6 A;  5E3F A;  5I9P A;  3EFX D;  3HEJ A;  1EQT A;  2K03 A;  3C2P A;  1H9M A;  4K6L A;  5DM6 3;  2NYZ D;  2Z4H A;  4OHJ A;  3M3Y B;  4IUP A;  1F2Z A;  2CQA A;  2K5D A;  2EJG C;  4IUV A;  2EDG A;  1EU4 A;  1NSN S;  1LTA D;  5M5W B;  4CKE A;  1G91 A;  4NDX A;  4K2K A;  2WP8 J;  4K2L A;  2L12 A;  1UEA B;  3A56 A;  1JR0 D;  1TU2 B;  4O42 A;  3SK4 A;  1HQM C;  1NCV A;  5JJZ A;  3CHB D;  1LT5 D;  4A3G B;  2A73 B;  2C5C A;  3KUP A;  3RUZ A;  4DF7 A;  4Y7N B;  2X6L A;  2XSC A;  3K57 A;  4IFD I;  2B8F A;  4PMC A;  2KUM A;  3T16 A;  2K5W A;  3D3R A;  4WFN 3;  4GZY C;  2KEE A;  3GTG B;  5IT9 L;  5IGG A;  3VR2 A;  5FOB B;  2SDF A;  3JAM L;  1Q90 A;  2RDF A;  2F03 A;  3J80 L;  5CR3 A;  1T5X D;  1CK1 A;  3K5O A;  2VB2 X;  4A3F B;  1CI3 M;  1STY A;  4S3S A;  1DOM A;  4RKB A;  1ET9 A;  4DAV A;  5KYL A;  2IL8 A;  1RD9 D;  2FIN B;  4TKO B;  3TN2 A;  4NW2 A;  1ZYR D;  1HFG A;  4HCS A;  2F0S A;  4QCL A;  2DNE A;  3J7A F;  5CMD A;  5ELC A;  3U9O A;  1NR4 A;  3L7Z C;  2BCO A;  3BDO A;  2JA7 B;  2YU9 B;  3NPP A;  3OSO A;  1Y1V B;  3AB9 A;  3CRK C;  3NTK A;  2KCC A;  3EVQ A;  2KQ3 A;  1PFM A;  3PO3 B;  4IZ8 A;  3P7J A;  3PUW A;  2E76 C;  2CVR A;  1HXY D;  3SK5 A;  2H4O A;  2NN6 I;  3TP6 A;  4CJ2 C;  5I4D A;  1KDC A;  5FO7 B;  2HCC A;  2F0O A;  4RKL A;  4XQJ A;  4CJ1 B;  2AQ2 B;  5CV4 A;  4IUU A;  5BN3 A;  5LL6 S;  2K05 A;  3BVG A;  2K32 A;  2KHS A;  2M2L A;  4A3B B;  1KLU D;  4QIW B;  1DM0 B;  4BA1 I;  4U67 3;  1A3V A;  2M00 A;  2JE6 I;  2Z1C A;  1C8C A;  2NVX B;  2A6E C;  1TKW B;  1O7Y A;  2SNS A;  4OL7 A;  2K01 A;  2TSS A;  3I4L A;  5COR A;  4EGV A;  2IW3 A;  4KJO A;  2NUC A;  4Z9C B;  1SMY C;  3L9A X;  1QE6 A;  1ML0 D;  3DUZ A;  1FNW A;  3WOF A;  3PUV A;  2WII B;  2NTT A;  4F8M A;  2PMZ B;  1JB3 A;  2JA6 B;  2FMM A;  4BBS B;  4AYB B;  1U4R A;  3X3N A;  1HPC A;  1WVL A;  3BZD B;  5D65 A;  3QG1 A;  1H9R A;  4WJW A;  5K36 H;  1WTV A;  2E74 C;  3A7L A;  1BR9 A;  2FMC A;  4HSP A;  4UAI A;  5C0X H;  1TS4 A;  1SE3 A;  4DNT B;  5EGT A;  3K58 A;  1JE4 A;  1BBX C;  4R8N A;  1O7Z A;  4ZUI A;  1B53 A;  1DON A;  4RA8 A;  4C1N I;  1PTO H;  3OPO A;  5CV8 A;  3M4Y A;  4M8A A;  1YNJ D;  1IYU A;  1TS5 A;  2K33 A;  4Q0F A;  2MUY A;  5CBE E;  1ONL A;  3E6Z X;  4L63 B;  2N88 A;  3K5L A;  1LLR D;  2R7Z B;  2NB0 A;  2O2L D;  2L0C A;  5JVH 3;  1Z47 A;  4K5X A;  3K6O A;  1SJE D;  1I6V C;  3GTL B;  4DN4 M;  3FPP A;  2WV6 D;  4HMJ A;  4G7Z C;  4C3J B;  4EQO A;  1C48 A;  1WTO A;  4RGM A;  3VR3 A;  3I70 A;  1Q1B A;  4HMI A;  5D3I B;  4H44 C;  4XIG S;  1SNP A;  1GUO A;  1EWH A;  2Q8R E;  4KTA A;  4I65 A;  3L3O C;  4FVM A;  2TMP A;  2HDM A;  5KNB A;  1B2T A;  1M8A A;  4MN3 A;  2RDG A;  1PZJ D;  3I73 A;  3MZ5 A;  3W2D A;  1S4Z A;  2R6G A;  2N55 A;  3S14 B;  3GO5 A;  2F4I A;  1BDO A;  2L4N A;  5C0X J;  2F0W A;  1IW7 C;  5E1F A;  3R93 A;  1L0X B;  1O7L A;  4OO1 I;  5BN4 A;  1S5E D;  1EIG A;  5KNC A;  1NAP A;  1TWH B;  2ENB A;  1STG A;  5JAV A;  2BDN A;  2IX1 A;  1FNU A;  2F0Q A;  3HKZ B;  4CGY B;  5EQ0 A;  4RCO A;  1DYQ A;  4KY6 A;  1IKM A;  2EZV A;  4K5W A;  3ITP A;  2YYZ A;  4ABN A;  3J7A V;  1T5E A;  1RF2 D;  2EY2 A;  3MXG A;  4IQZ A;  3FVQ A;  4FF1 A;  5CV9 A;  1JCK B;  1BF4 A;  1DD2 A;  5C3E B;  1FD7 D;  4J8Q A;  4IFD G;  2EJM A;  3HOY B;  4QB4 A;  3GTK B;  4ILW A;  5KRU A;  1SE2 A;  4K6D A;  3TDQ A;  1TVX A;  3TBI B;  1EYA A;  4C56 C;  2AQ3 B;  2QEJ C;  2X6G A;  1SBB B;  2V4D A;  1SYC A;  1KAA A;  4X3U A;  1QIL A;  1STB A;  5IGB A;  1LTS D;  3GV6 A;  1VDZ A;  1BCP D;  1FNV A;  3KK7 A;  3N6R A;  3NTH A;  1W6K A;  1GHK A;  3EA6 A;  3OOC A;  2I46 A;  2SEB D;  1LT4 D;  4RFB A;  1WD0 A;  1DJR D;  2NVY B;  2JEB I;  3BVZ A;  1CQV A;  1GHJ A;  1H9J A;  2F0L A;  2H1E A;  3WOE A;  1EY9 A;  1JQY D;  3VA7 A;  2B2Y C;  3NP8 A;  4DK1 A;  5EJW A;  3HOV B;  5HGT A;  1OXV A;  4KKT A;  1YNN C;  3I72 A;  5J22 A;  2EY5 A;  2NN6 G;  1SNQ A;  3CKI B;  1D6E C;  2B2Y A;  2D2C C;  1K8M A;  3KF8 A;  4J6H A;  5IGC A;  4DNR B;  1BQQ T;  3SHL A;  4ZYS A;  2ZXO A;  4XYQ A;  2EE1 A;  1MD2 D;  1S5B D;  5C44 B;  2EVB A;  4C3J G;  3GTO B;  4XYO A;  2BE5 D;  4C2M B;  1HRJ A;  3QO2 A;  4N9T A;  2E2H B;  1QWY A;  4DXF A;  3X3M A;  2A6H C;  4PMB A;  1U4M A;  5C4H A;  3DEO A;  3DWA A;  4OIK A;  4C3I B;  1PRT F;  2KEC A;  1GUT A;  3NBI A;  1PLF A;  5IGD A;  3SK8 A;  5J1Z A;  2RQX A;  2K1B A;  2JYO A;  4NP5 A;  1R4P B;  3AMU A;  2XIW A;  5CV5 A;  3NQI A;  1VF7 A;  3V05 A;  2FFK B;  2F3W A;  5F2D A;  2VNU D;  1XX8 A;  3C46 A;  4KN7 C;  2KA7 A;  1MBY A;  1QG7 A;  4F88 A;  4P2C B;  1TR5 A;  5IIF A;  4KD4 A;  1I3Q B;  1ET6 A;  3BDL A;  2F0N A;  3IKJ A;  4PV1 C;  1ESR A;  5D3D A;  3HRZ C;  2LFN A;  3A55 A;  1HTP A;  3VYT A;  1VCI A;  4DA2 A;  3H91 A;  4BY7 B;  2K6A A;  1CM9 A;  3M7G A;  1ROD A;  1WTW A;  5LL6 X;  2M9V A;  5ELE A;  3S2D B;  2Z8L A;  1QOH A;  4X3K A;  2RSN A;  2QCP X;  1A6X A;  1AZQ A;  3PO2 B;  4U68 A;  2CW0 C;  4ME5 A;  3C3L A;  2F0E A;  4RWS C;  2A6E D;  3BVM A;  5LHY 1;  2IX3 A;  2LKV A;  2KCN A;  1D2B A;  1SMY D;  1TS2 A;  3S2H B;  2MPM A;  4A3M B;  4K8I A;  1F2Y A;  1B3A A;  3CQZ B;  3MC0 B;  2FJ2 A;  2IX0 A;  5ISR A;  5AFW A;  3TZU A;  1PMR A;  4WOR A;  4L6T B;  1PTO C;  2BA1 A;  1EY0 A;  2JEA I;  5C0X I;  3VYU A;  3D6C A;  3VR5 A;  1NUC A;  1HFN A;  5DEH A;  1SXT A;  4K5V A;  1STE A;  1KNE A;  5E4X A;  2G9H D;  1AFP A;  1TWF B;  3M85 A;  2AUK A;  2DNC A;  2EYM A;  4OO1 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...