2PW7A

Crystal structure of staphylococcal nuclease variant v66y/p117g/h124l/s128a at 100k
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
130
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKVEKYGPEASAFTKKMYENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic study of hydration of an internal cavity in engineered proteins with buried polar or ionizable groups.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 37
structure length 130
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2pw7A00
4EQPA 2EYMA 2OF1A 2EYHA 3QOLA 4R8NA 5IODA 5NUCA 4N9TA 2F0WA 2OXPA 2PZUA 1TR5A 2KHSA 2F0NA 1EZ8A 1SYBA 1KABA 4IUNA 3P1HA 4IZ8A 4WRDA 5E3FA 4DFAA 2RBMA 3NQTA 4KY7A 3TP8A 1JORA 4K2KA 3PMFA 1JOQA 2F0PA 4QMGA 2F0SA 5F2DA 4HMJA 4K6DA 5CGKA 4RKBA 4DGZA 1EZ6A 2EY2A 3D4DA 2SNSA 3BDLA 3HEJA 5IGCA 5C3XA 2F0MA 5IGFA 3SXHA 4EQOA 1ENAA 4KJNA 2F0LA 3D4WA 4KJOA 4EQNA 5IGGA 2F0GA 5IGBA 1EY5A 1U9RA 2F0HA 3EJIA 4B9WA 5CV4A 2EYFA 2PW7A 3C1FA 1EY0A 3P75A 4F7XA 5KIXA 2F0OA 1KAAA 4N9PA 4PNYA 4QB4A 4ZQ3A 3TMEA 5C4ZA 4KD3A 5IGDA 5M9OA 5C5LA 1SNPA 4E6IA 1STBA 4K14A 1AEXA 3NP8A 1STNA 3S9WA 5EGTA 3U9OA 1TQOA 4ZUJA 3DMUA 2HQEA 2EYOA 3T16A 2PQEA 5CV6A 1EYAA 5I9PA 5CV5A 5HURA 3DHQA 2RDFA 3D8GA 4K8JA 2F0IA 2F0EA 1SYDA 5C3WA 1KDCA 2EY6A 4NP5A 3MVVA 4PMBA 2F0TA 4K5WA 5EKLA 1JOKA 5C5MA 5IOCA 4WORA 3LX0A 1NSNS 2WACA 4I65A 5IGEA 1EY9A 1SNCA 1TT2A 1SNOA 4ID6A 1SNMA 4ME5A 4DU9A 5HGTA 2LKVA 4K2LA 2PZWA 4ODGA 4ZUIA 3D6CA 3NXWA 1KDBA 1JOOA 3OSOA 3E5SA 2F0QA 4K8IA 3TP7A 5J22A 4K5XA 5CV8A 4PMCA 2F0UA 5JAVA 3TP5A 4F8MA 5CC4A 2EY1A 1F2YA 4EVOA 3RUZA 1A3VA 1A3UA 4KV6A 4LAAA 3EVQA 4DF7A 3H6MA 5KGUA 3MZ5A 3SK5A 3OMCA 1A2TA 5EKKA 3TP6A 5DEHA 5K5PA 5CV7A 3EROA 4OL7A 5CV9A 1EY7A 3SR1A 1EY6A 2F0JA 5E1FA 1STGA 1F2MA 1EQVA 2F0VA 1RKNA 1F2ZA 2EYLA 5KYLA 1EY4A 1SNQA 4B9XA 4KHVA 4RKLA 2F0DA 5JOBA 1EYCA 5I6YA 4NDXA 3NUCA 3NK9A 1ENCA 2F3WA 4J6HA 2SNMA 3HZXA 4J1MA 2QDBA 3R3OA 3SK4A 3SK8A 1SYFA 1EYDA 2NUCA 3MHBA 5I6WA 4K5VA 5J39A 2OEOA 4S3SA 3OMGA 1STYA 2ENBA 4HTHA 5CR3A 3VA5A 3QB3A 5KYIA 1SYEA 3SHLA 3QOJA 1A2UA 4NKLA 1A3TA 2M00A 4IALA 3NHHA 4KTAA 3BDCA 4QF4A 1NUCA 3OWFA 2O4XA 3T13A 3C1EA 1IHZA 2EYJA 2EXZA 1STAA 2PZTA 3MEHA 3MXPA 4YIJA 2F3VA 2F0KA 4KD4A 1SYGA 4KY5A 5DAUA 4NMZA 2EY5A 5KEEA 1EY8A 5KRUA 4KY6A 4G57A 1SYCA 3SK6A 5ISRA 3ITPA 5C4HA 2EYPA 3ERQA 5C6AA 1SNDA 4HMIA 5J1ZA 2F0FA 2PW5A 2SOBA 4MIUA 2RKSA 2PYKA 4TRDA 1STHA 1KDAA 3V2TA 5I9OA 5IIFA 1II3A 2KQ3A 4H7BA
chains in the Genus database with same CATH superfamily
4FF4A 1PFBA 2G5DA 2N3SA 2PZUA 3CC4A 4JBJA 4OIJA 2JK8A 3NQTA 3M7GA 2K01A 4B3RL 4IOCA 4LUZA 1AW7A 1DZ1A 1QZGA 3R93A 4DR4Q 2UU9Q 3NENA 2A5HA 4KKTA 1I4PA 2ID0A 1EQTA 1MKHA 1X56A 5IYCG 1B50A 1SSOA 3GTLB 2EYFA 1EY0A 1VDZA 2R6GA 5IGDA 1CFMA 2JEAI 5C0XG 1G2TA 1A8VA 3S9WA 3QR8A 4ZUJA 3TS2A 2YTYA 2IT1A 2RCFA 2WFWA 3CCUA 4XQJA 4B08A 2NN6G 3K5LA 2ZM6L 1HUNA 3W3AA 1S5CD 1KQSA 3AYHB 2Q8IB 1ESFA 1ESRA 1HH2P 2PZWA 4JOIA 4ODGA 4ZUIA 1SJHD 5C44G 2NVXH 3AEVA 1H95A 1H9RA 4TKOB 3A7LA 4DK3C 5JAVA 4A3DB 3ICEA 4BA2I 1BQQT 1A3VA 4F87A 4C1NK 3OIQA 1AN8A 1HQRD 2QF7A 5CV9A 2F0JA 1SR3A 1BUVT 4JI7L 2SEBD 1EY4A 1MBYA 1I6HB 1E1TA 1LTBD 1U4LA 4OX9L 2UXCQ 4NDXA 4R4TA 4ZLTF 3HZXA 5IYDH 4PZ8A 4H44C 3HOWB 3K7UC 4EX5A 1LT4D 3PO2G 1TS5A 5KYIA 1B7YB 3KJOA 3I90A 4JOIC 5IT9c 3X3NA 3S16B 1VQCA 3C1EA 2O5JC 1O7IA 1PH4A 2EXZA 1FYCA 1ZEQX 3RLFA 4DPGA 1EY8A 3N52A 4FF1A 3KF6B 4QY7A 4A3MH 4B3MQ 1IYJB 4FXGC 1SNDA 1DYQA 4JI3L 1E3PA 2J7ZA 1I4XA 2PYKA 4IO9A 4H7BA 4RAUC 4DXFA 1GM5A 2HQLA 3LWUA 2K4KA 3TN2A 1WTWA 1XMOL 1KABA 4IZ8A 3P1HA 2ZM6Q 3A8JE 1LTTD 3PF4A 3S2HH 4HMJA 3KLSX 1YHAA 3HKZG 2SNSA 1EU3A 2WB1E 3OW7A 5IGCA 5GAEC 1DOKA 3J7AF 1NNXA 5COYA 4I7ZC 1U9RA 1XPOA 4BA1I 1A15A 3TSSA 4RHSA 1VQAA 2G9HD 4JV5L 4CKEA 1T5EA 2R7ZB 1OXTA 3FPPA 5K36G 1AEXA 3MXUA 4CJ1B 3IFTA 4CJ2C 4KHPQ 1IL8A 4YWMA 2L9HA 3I7FA 1NCVA 3DHQA 1MSHA 3MVVA 1KRSA 2BOSA 2ICIA 1JOKA 1WCMG 3PUXA 3LX0A 4GKKL 1WTRA 2YTVA 1LTAD 4JBKA 5TSSA 1MSGA 1QG7A 3MTSA 4UDUC 1F77A 3H91A 3TP5A 1F2YA 1NAPA 1FR3A 1TWFH 4P71A 5EBCA 2BDOA 4GN4B 3WOEA 2N55A 1S72A 3CC2A 1Y1WB 2MNAA 4RKLA 1XMOQ 4LF7L 2KA7A 4DR5Q 1H9MA 4Y7NB 4FP5D 3HOUG 2HDLA 2NVTH 1MJCA 1EYDA 1SYFA 5I6WA 1UE1A 1EFWA 4YHHL 4X66L 4S3SA 1VQOA 1SMYC 4B3TL 2AKWB 2EIFA 4JPBW 1NUCA 3T13A 2O4XA 3NBIA 5FLXL 1I94L 2RDHA 3BYTB 1JJGA 2XSCA 3STBD 1Y14B 3H09A 1ONLA 2P5ZX 1PH8A 3M4YA 2XN9C 1PH3A 1IBML 1JB7A 1YVCA 4EQPA 2OF1A 1EIGA 5LMNL 1FVIA 4IUNA 5GQOA 2B2WC 4XIGS 5D3IB 1X32A 4DV2Q 1N36Q 4JW0A 3PMFA 1ML0D 3PCOB 2EY2A 3BJUA 3S1QB 4H02A 1LT3D 4KKUA 2CVRA 1W6KA 5FLMG 4EQNA 1O7LA 2Z4IA 1BR9A 2F0HA 4ZCKA 2B2YA 3VR3A 4HJ9A 1WTVA 2Z9HA 3T1YQ 3KJPA 2LFNA 1KAAA 4N9PA 5C4ZA 1WTOA 1QCBD 1HA6A 3A0JA 2XWJB 3S1MB 1GOZA 3CHBD 2B8GA 2EYOA 1S5BD 4DV3Q 2N88A 2RDFA 5JJZA 5C3WA 1SYDA 1WCMB 2XRSD 4YY3Q 1B70B 2NYZD 1KHIA 2VQFQ 2ZJQA 3KYHC 2R92H 2K1BA 1Y1VH 1SNMA 4PG3A 3GTJB 3NTHA 3K57A 2ZTCA 3L7ZC 4YY3L 4RCOA 1U0LA 2Z8LA 4H0LC 5AFWA 1I4RA 2QCPX 1GXDC 4XYOA 3K7AH 1TWGH 4CHTB 3B6YA 5K36H 2UUAL 2NTTA 1K8GA 2RCNA 4C3JB 2CCZA 1X6OA 1STGA 3MEFA 3UDXA 3J7YW 1AZQA 1H9SB 3NEMA 4DR4L 1TY2A 5JOBA 2WKCA 1L0WA 5JJLA 1XNRL 2SNMA 2AHOB 2L15A 1JJ2A 3J80E 2Q2HA 4GLVB 3PUVA 4QGUA 4OO1I 3RNUA 1X65A 4NKLA 4DV1L 1VQ5A 1A3TA 5E7NA 1E0BA 4QF4A 2B2UC 1ILPA 4XXEA 3BDOA 5E4XA 2KBNA 1GUOA 4AYBB 4RGNA 2L5TA 4KY5A 5JVG3 2EOTA 4CGYB 5KRUA 4U673 1PH1A 2OQ0A 4KN4C 4R4IA 5IP9G 4A3KB 4TQUS 5C0XI 1PMRA 5BR8Q 3QOLA 2LY7A 4O2DA 2E8GA 1F2LA 2ICEC 4X3SA 4KY7A 1CA6A 2BDNA 1JOQA 1H9KA 2A68D 2ZJPA 4K6DA 1PRTC 4RKBA 2OTLA 4BBSG 1XPUA 1SROA 3UE1A 2PNHA 2F0MA 2JXMB 1VF5C 1YI2A 3SXHA 3S14H 2JYOA 4JI1Q 3M4OH 2VUMH 4YCUA 2WB1G 2E2JB 1B53A 1SDFA 4P73A 4QJFA 3OTOL 3F2DA 1FGUA 1ICWA 3DMUA 5IT9L 4JYAL 4JI5Q 1CK1A 5CYUA 2XTIA 5I4DA 3S2HB 3JC66 5KNCA 1D8LA 2F0IA 3AB9A 1X3QA 4C3IH 2LXKA 2AWNA 2VXWA 1VQIA 4K5WA 2EVBA 2D0OA 2B63H 2OT2A 2LMCB 4OELB 1CA5A 3PIPA 4PV1C 5CMDA 3D3RA 5LMUL 4RFBA 4A3JH 3NELA 1VQFA 4PMCA 4U68A 4BBSB 5CC4A 2MUYA 2RHSB 3QIAA 1ASYA 1LTRD 1WVLA 1BCPF 3ND8A 2JA9A 4DV5Q 2ZTDA 4OWXB 3PIP3 2VS1A 4C3IG 1D1IA 2A6HD 3K59A 1D1KA 3LNNA 3PO2B 1XYIA 4OO1H 3SEBA 2DY7A 4ZAIA 4FF2A 1C7YA 4BBRG 2LS01 1SE8A 2KHIA 1QVCA 1LTID 2QW7A 2X69A 4IPGA 2JA6B 4JG2A 1L1OB 2ATWA 1R4PB 4A3BH 1ZKOA 5DM73 1J5EL 3GP7A 1L1OA 3HOXB 2K50A 3MXPA 3WWVA 1KRTA 3ULLA 5C44B 1UE5A 4OONA 2NVXB 5C6AA 3N6RA 2IJ0A 3CP0A 4TRDA 4A3GB 1CKOA 3BG3A 4ZKBB 2FFKB 2JSOA 3H3VC 5C4XG 3TS0A 1LTLA 3GV6A 5E3FA 5IE8A 1HZ9A 2LXJA 3A56A 3SDZA 5FK9C 5E4WC 3I73A 1EIYB 2GVAA 1X54A 5C3XA 3CD6A 1N9WA 4PQXA 2VQEQ 4BS9A 4DV7Q 2VB2X 4KJOA 1K73C 1MJEA 1CSQA 1Y8PB 1W6JA 1CHQD 4UY8C 1MIUA 1K0RA 2K75A 3TREA 3HRZC 3JAMc 4QCLA 4GKJQ 3U4ZA 4R8IA 1STBA 4X64Q 1OO9B 2HDMA 3I4NB 4A3CG 3EIVA 3I70A 1HTPA 2H4OA 3K80C 1RF2D 1U5KA 1VQ4A 2UXCL 1QUQA 4Q5VA 4IFDJ 3J81L 1DD2A 2KEDA 4X64L 5JJIA 3ER0A 4WJ3M 4PMWA 1OXSC 2A19A 3HS0C 1IL2A 5HGTA 4A3EH 1TWCH 1QNUA 1J5EQ 4B3RQ 2PPBC 5CV8A 2TSSA 3IFDA 3FDTA 2HIVA 1QNKA 1HFNA 3J81c 4AYBG 1T9HA 2IX0A 2KUMA 1YNXA 3CC7A 5DEHA 4LFCL 4LF4L 3C2PA 4DR2L 3DWAA 1EUJA 3CCMA 2PI2E 4GLXA 3S1NH 1G91A 2I0QA 2PMZB 1NBWA 2CQOA 3SK4A 2QDBA 2Y0SE 3K81C 2NUCA 5A2QE 4G7OC 2H1EA 3BS1A 2HT1A 1IXRA 5T1GA 5JPMC 1Y8NB 3UI2A 4IALA 2NWGA 5M5WB 1VQ6A 2EYJA 1STAA 4UP7A 4Z9CB 1S5FD 4DV6Q 5D3DA 3GTQB 1J9OA 1VQKA 5ELNA 2JA6H 4QIWE 2UUBL 2EYMA 1LYLA 4APVA 2VUMB 2NTSA 1TS4A 3BU2A 3DWPA 4N9TA 3CMEA 4CDCC 1S40A 1KTKA 1HNZL 4KK7A 1IBKQ 1BBUA 1E7ZA 1PRTD 1EFID 4ZRZA 1QILA 1CQVA 3TZDA 3S24A 1EIHA 1LT6D 2C5CA 2IW3A 3HEJA 2K5VA 1LLRD 2Q8TA 5BN3A 3D31A 5AJ3Q 1YNJC 5IGGA 1Z7TA 2K7VA 4OWTB 2GN5A 3E9HA 4DAYA 4A76A 4O42A 3S15H 2D5DA 2NVQH 3M3YB 3TZUA 1Z9FA 4DAYB 5I9PA 5H1SE 5HURA 1YIJA 3S1RB 2XGTA 3HKSA 1CKNB 2KOLA 3JAML 2VUMG 1RTOA 5IOCA 4ZKCB 4OO1G 4X6AH 2ZXRA 2JP1A 2OCEA 1B3QA 2Y0SB 3HKZB 5C4JH 3CMAA 4XT1B 3TP7A 4DV0L 1Q8KA 3KF8B 2VY3A 4OXPA 2JA8G 3M4OB 5CBAE 3AQQA 4DV6L 2CW0D 4V0BA 4A3EB 1STEA 2O2LD 1BCPC 4Y52H 1X3PA 3KUPA 5CV7A 2Z1CA 4CKBA 2V4DA 3W5OA 3OOCA 3T51B 1EWIA 4RMFA 3CCQA 2F0DA 3CKIB 1RIPA 2HCCA 3VYTA 2WAQG 1ILQA 2R7DA 3MFGA 3R3OA 3FKIB 3MHBA 1WTXA 1HNXL 4K5VA 2E75C 1LTSD 2XWBB 3NWSA 1GVPA 2JA5B 5M3FG 3HOXG 4A3KH 1K8OA 4BY7G 1GJXA 1PHJA 1SJED 4HIDA 4KD4A 1R9TH 1SLJA 4DR5L 5ISRA 4BXXH 5C4HA 3NQIA 3I8ZA 1GUGA 2TMPA 3IKJA 1HUMA 1II3A 3SK5A 2R93B 5JJKA 1DONA 2E2HB 1WFQA 1EEID 2OXPA 3QWNA 4QIWB 1WTQA 1V1OA 4C3JG 1VQLA 2H5XA 2L0CA 4DK0A 1DJRD 4BY7B 2RBMA 5ELDA 1J8IA 5I2XA 1JORA 3D6WA 3WOFA 3PUWA 2PQAB 2EPBA 2L4NA 2F4IA 3S1QH 1MI2A 4CDFC 3CCRA 3RMHA 3GTGB 4A3GH 4HCSA 3NSWA 3H0GG 4LK1C 1YITA 2Z6KC 1Q7YC 1X3EA 1GUNA 4JI7Q 2OTJA 1P16A 1QUQB 1N32Q 2QGQA 4G4KA 1PFSA 3TBIB 3RZDH 4PNYA 2M2LA 1I5FA 4IPHA 5C5LA 2QDLA 1XPRA 2RVLA 3D0FA 3OWEB 1YNNC 4WFN3 2B2WA 1PYWD 1EYAA 4NB3A 4UHVA 5FLMH 4K8JA 4B3SQ 2DNCA 3K5NA 3F1ZA 3GTGH 3HOVH 5LHY1 1KLUD 1NR2A 3T1YL 1QVGA 4JI5L 3S1MH 5IGEA 5M3FH 4DU9A 1Q46A 4Y7NH 3K6OA 5ELBA 2Z6KA 3E5SA 4K5XA 4CDEC 1K8AC 3GQBA 4YHHQ 1K3BC 4F8MA 3H3VH 2MP1A 4RA8A 3O13A 2V1CC 3MZ5A 1AE2A 3URYA 5EKKA 1W3SA 2RF4A 4N8X1 1EY7A 2Z4HA 5E1FA 4CJ0B 1F2ZA 5KYLA 1RCVD 3DM3A 3STBC 4HN7A 4LWCA 3NE5B 2K14A 2IHFA 3K0YA 4AYBE 5IP9H 4J8QA 1SXTA 1VQNA 1PFMA 1TS2A 3S2DH 3OMGA 2HD3A 4YCVA 1C48A 1PH5A 5IP7G 1KAWA 5LMNW 4KTAA 1S5ED 2I07B 1HZCA 1HXYD 5IYCH 4DV2L 2HIXA 1IBKL 2IPKD 4DNTB 1YHQA 4A3LH 1F9SA 4G57A 3E9IA 4MIUA 1UNSA 3I55A 1PYBA 2KHJA 3PQIA 5IODA 1G6ZA 2F0WA 4LF6Q 3UDFA 4L5TA 1IW7C 2Z0SA 3NTKA 1EZ8A 2LSSA 1K0SA 4NW2A 2F0PA 3HP3A 1Y1WH 5CGKA 3ONAB 2AQ2B 5BN5A 3K0XA 1O80A 4BBRB 3HOZG 2E2IB 4KJNA 4RHRA 3OHXC 1IW7D 1VQMA 4GNXC 4TVAB 1E2ZA 1HCZA 4J15A 3UE0A 5KIXA 2VQFL 1XNQQ 2Q2TA 2K04A 1KIXA 4QB4A 1JMCA 2G9DA 4DAPA 4HSPA 4E6IA 2UXBL 2EJMA 2JA5H 3KLRA 5HY6A 4DK6C 5IWAL 1L0XB 3TQYA 4FYDA 1CKNA 4MNOA 3S16H 3J81E 1HHVA 2C35B 2QILA 1W2BA 1TWAH 1N32L 1Q90A 2AWOA 4GZYC 3R2TA 2EXDA 4C2MH 2B2VA 1DOLA 1SNOA 4ID6A 1O78A 3CXCA 1TWGB 4AIMA 3CU7A 3ZJYC 1LACA 3NXWA 1CSPA 2F0QA 1VQEA 4EGVA 3GTPH 3RZOB 1L1OC 4IPCA 2KJXA 1IKMA 3A5ZB 2VW9A 1PH6A 4R9WA 2IL8A 4JI3Q 3OMCA 1A2TA 2C9OA 3FVQA 4A3DH 3L9AX 4HJ8A 2HCIA 1WCMH 4LF9Q 4A75A 1EYCA 3HOZB 1UUPA 1EWHA 1E22A 2HHHL 1HR0W 3HKZE 2B63B 4RGMA 1I3QH 2OEOA 3KF6A 2ENBA 3QO2A 2NVQB 3VA5A 5FO9B 3J80i 3CRLC 1NJIC 4C3IB 2VNUD 5C0XJ 2CH4W 1RJTA 2E74C 5C3EH 1SE4A 3OWFA 3DXJC 2CWAA 2FMMA 2A68C 3CCSA 3C46A 2F0KA 1SYGA 3ULJA 3F2CA 3SK6A 2ASBA 2GA4B 1VMPA 1ASZA 2SOBA 2ALYB 4TSSA 2RKSA 5I9OA 2BE5C 4XYQA 3HOWH 1Q82C 4A3LG 1N33L 3S14B 3CPFA 4RG1A 4A3FG 2UXDL 2N8NA 4A93B 2JA7H 3Q24A 5M3MG 4K0KQ 3TP8A 4JCVE 2F0SA 4DUYL 1I6HH 3UDGA 4DGZA 4XT3B 3CRKC 4JV5Q 5G3LD 2NN6H 5GADC 4JI4L 3P75A 4JI8Q 2A8VA 1JCKB 1Z6HA 1SNPA 3G71A 2F4VL 1BBXC 1TQOA 1GUWA 4BXXG 1Q3LA 1EYGA 4NXMQ 3FP9A 2PO4A 3K5OA 4DV1Q 2N78A 4HIMA 4C3HB 5EKIA 5C4XB 2D2CC 4BBRH 1L0YB 4LFAQ 3W1BA 1F9QA 5EKLA 5CBEE 4IN3A 4I65A 3KDFA 1RODA 4JI6L 1EY9A 2BA1A 4DN4M 4GKJL 4A3KG 3CPWA 4KI0A 1NTGA 3BZCA 1DOMA 5JEAJ 3GTMB 2F0UA 2PMZE 4EVOA 5KNDA 5EPLA 1EL0A 4LAAA 4DV7L 3A7AB 2FXQA 3FHWA 4EQ5A 5M3MB 1NMGA 3EROA 4A3IG 5JPNC 4DUZL 3PIO3 3AU7A 1HQMC 1PXUA 2B2TC 2YYZA 3Q6SA 2UXDQ 1PYSB 5J3BA 4YCWA 4B3SL 1N36L 3ERSX 1PFNA 1SE2A 1PRTB 2F1MA 3GD7A 1V1QA 1V1PA 5J39A 2R92B 5A35A 2YV5A 1SFOB 3PIOA 3S2DB 3G4SA 1TWHH 5JEAG 3CCJA 3NBHA 2ES2A 4DAVA 4N8FA 1BXTA 1SYCA 2NZOA 2WAQB 3I3CA 1JWMD 1TVXA 4Q0FA 4BY7H 5IIFA 5K5PA 1P8LA 3T1HL 2B2TA 5D14A 2YTXA 1PH7A 1UE7A 3GTKH 1AFPA 2PQAA 1VS0A 1B9NA 4JVZA 4LF4Q 2NN6I 3JAMi 4LF8L 2BH8A 1K83B 4R4OA 4A3JG 1PTOF 1Y8OB 1PH9A 1BDOA 4QUCA 3V96A 3MFYA 3VR6A 4HAEA 2F0LA 2NVYB 4DV0Q 3L2PA 3PO3B 3VDYA 3C1FA 1JC7A 1X55A 4IFDI 4C1NI 1VQ9A 3H0GB 5M5XB 4KD3A 2M9VA 2E2JH 3RZDB 1KD1C 3RLOA 1KNAA 3FRPB 4ME3A 1DCZA 4BY1H 1G2SA 4A3FH 3TRZA 2K33A 2UUCQ 3D8GA 1UAPA 2JA7B 4XQNA 3PF5A 1F9RA 1U4PA 4PMBA 2F0TA 3GTMH 4JI2Q 4P2CB 3G7LA 4OHJA 4AQYL 2AUKA 1S5DD 3MA2B 1VCIA 2R61A 4X62L 1KC8C 1BBWA 3D6CA 1KDBA 4BBSH 2J4XA 3DEOA 1YNND 4A3JB 3KFUA 2NB0A 1PZID 2I5MX 4QUFA 2WINB 2FHTA 3KOJA 1XNRQ 4IJHA 1G51A 1DXMA 2D0PA 1Y69U 2UXBQ 1JR0D 1QWYA 1F2MA 1EQVA 2EQSA 3PO3G 2PI2A 3T4AC 3A54A 3A5UA 2B63G 3S15B 1F9PA 1CZGA 3HOUB 4ILWA 1TS3A 4HJ7A 2KECA 2A69C 3I4LA 4OIKA 2YU9H 3VA7A 3T53B 5ELCA 4G7ZC 3E0EA 2I5LX 3DEPA 4DUZQ 4JI1L 4DK1A 1E1OA 3GTLH 1B44D 4GN3B 1BVSA 2JA8B 2QKIC 4X65Q 3MAQA 4FXDA 5M5YB 2A69D 1KDAA 3IL8A 4DAMA 3PSIA 4UP9A 1CUKA 2UU9L 2EE1A 1CT1D 1TWAB 2MQHA 1ZYRD 1TR5A 4GKKQ 4OX9Q 4WRDA 4DXGA 1VF7A 3QG1A 4GLAC 4XTCS 3J81j 4K2KA 5DM63 2JJQA 2B3GA 3GTOH 2B39A 3HOYB 2NVYH 1I50H 1XMQQ 3BDLA 3FPUB 4AQYQ 4LUOA 3S1RH 3PGZA 3EBEA 1FGBD 3RN2A 4IUPA 2KCCA 4LFCQ 1HNXQ 4ULLA 1GHKA 1B1ZA 2K5WA 4BY1G 5IGBA 4FO2A 3M3YH 4F7XA 1I3QB 2DJGC 1PTOB 4A3MG 1U4MA 1CZWA 3I4MB 4CKCA 2IX3A 1YEZA 4JI6Q 3ND9A 3KK7A 4A3EG 4IUUA 2E5LL 3MXNA 4JBWA 1Q86C 3NP8A 1BNZA 1BOSA 3HGBA 3RLNA 2AMCB 4KLKA 1HFGA 5EBDA 3Q22A 3M9BA 2JN4A 1V43A 3CCVA 4X3UA 5IYBH 1OTCA 1N8RC 2IX1A 2R7ZG 2B8FA 3DWQA 2BH2A 2WV6D 1XTCD 2NBFA 1VQGA 2A73B 4PZ7A 1K3RA 1TWHB 3HOYG 1HJPA 2KCMA 3H6MA 3H0GH 4POGA 5T1IA 2MHVA 2A6EC 4OL7A 1TU2B 5IYBG 1YJ9A 4JBMA 3V05A 1E2VA 2F0VA 2R93G 4GNXB 3M85A 1GUSA 4WJ4A 1QZHA 3H3VI 4IFDG 2R92G 4KHVA 3E0JA 1UWVA 4IUTA 3V2TA 5KNBA 3SK8A 2KENA 4JYAQ 5IY0A 3PUYA 1GKHA 3SHLA 3QOJA 3RR5A 2AUJD 3BDCA 4IOAA 4MZ9A 2CKZB 4IUQA 4HIOA 3RN5A 2WAQE 1IHZA 1SE3A 2PZTA 4ALPA 2R93H 1YZ6A 3HOWG 2RDGA 5I2YA 2WIIB 4CBVA 3J7ZC 1JWSD 3NPPA 5J1ZA 1HR0L 1N34L 2IHEA 1NY4A 2VL6A 3CF5A 4LMQD 1ET9A 3OPOA 4L6TB 1FJGQ 1XXGA 2F0NA 1YJWA 1SN8A 3GV3A 4LF7Q 4C3HG 1HNWL 2Q2IA 4QMGA 3Q8DA 1IBMQ 1Q1BA 1EZ6A 3D4DA 1K9MC 3CCLA 3I4NG 1Y1VG 5IGFA 3DUZA 2ZTEA 3D4WA 2BE5D 4DR3Q 1IBLQ 4B9WA 5CV4A 4DV4Q 1D5MC 1LT5D 3PO3H 4JI2L 2F0OA 4ZQ3A 4G7HC 1E24A 2CQAA 4YWKA 1CKMA 4FXKC 2O5IC 1FD7D 4F88A 1C0AA 3SVMA 3U58A 1E2WA 1G8ZD 3SE0A 2Y0SG 2R7FA 4RGTA 2DUDA 2HHHQ 4L5SA 2K52A 3I72A 1QOHA 4FDBA 1B4OA 5CORA 4OWWB 1GHJA 4LW1A 1JJCB 1EQQA 2E2HH 4R1JA 2WACA 2I5HA 4C3HH 1TT2A 3TEHB 1C4QA 1WTPA 1JOOA 5IWAQ 5FLXc 1DM0B 2DY8A 4ZYSA 1EU4A 5DNFA 1PTOC 3TP6A 5EJWA 4JK1C 4DR1Q 1SNQA 2HUGA 1T5XD 1HNZQ 2XVSA 1IKLA 4ME5A 3FMCA 1ENCA 1B9MA 2GVBA 1HNWQ 1IZ6A 1OXVA 1UEBA 5CR3A 1LABA 1YBYA 4GS3A 2B2VC 1YNJD 1SYEA 3J80L 3GDEA 1A2UA 2L11A 1JB3A 3F2BA 5DLQE 2JA6G 4PZ6A 5M3MH 1SBBB 2RSNA 1V9PA 4MN3A 1EOVA 4RH6A 5EPJA 5C0XH 4P75A 3SGIA 1QE6A 4MTKA 3ITPA 3ERQA 4NPSA 3S17H 2F0FA 3AMUA 1QJOA 1FNUA 2YU9B 1IYVA 4QQBX 2EYHA 4R8NA 1JICA 1ZYRC 4NXML 1XNQL 4UAIA 1PDQA 1B3AA 2NZHA 5C3EG 4H13C 1PTOH 1FNWA 4A3CH 2IY5B 5IP7H 3FEWX 1RHPA 1R4QB 1PLFA 2K05A 1CQFA 3ZYYX 3I4MG 3Q0AA 1TKWB 4P74A 3EJIA 3I91A 3R8BA 4MTNA 2WKDA 4HJAA 1RTNA 2FJ2A 4DUYQ 3CAMA 5EGTA 3GTPB 2E76C 2PCFB 3BVZA 2HQEA 1TWCB 2I46A 4RCNA 4KN7C 1LTGD 4C2MB 4HSVA 1AE3A 4A93H 3KF8A 3PUZA 4A3FB 4DNRB 4JI4Q 4NP5A 3K7AB 4DR3L 1IBLL 1LO5D 4BY1B 1C8CA 2Q2UA 4MHEA 3W2DA 2JA7G 4M1UB 3GTJH 3D4RA 4K0KL 2UUAQ 5J22A 1PZKD 1AZPA 2A1AA 2EY1A 3RUZA 1X3GA 5JEAH 3GO5A 3G6EA 1Z47A 5LL6S 5KGUA 5C3EB 2A6ED 5M5WH 3NTIA 5AJ3L 3SR1A 1SAPA 4A93G 3E6ZX 1EWCA 4LFAL 1C9OA 1H9JA 1VMCA 2FMCA 2QEJC 2KCNA 2OQKA 1XMQL 1QVFA 5I6YA 2F4VQ 3NK9A 2F3WA 4J6HA 5ELFA 4LF8Q 1D5ZC 3HOZH 1YJNA 2KEEA 2DGYA 3J81i 4HTHA 2MO0A 1UEAB 1NE3A 3QB3A 3J7AV 4A3IB 2JEBI 3I2ZA 2M00A 1B2TA 2K5NA 5M3FB 1HPCA 1HZAA 3I4OA 5LMUQ 3KBGA 5ELOA 3MEHA 3J7A5 4RGOS 3VR2A 1ENFA 4O0AA 3H15A 2OWOA 3RZOH 4KY6A 2CWPA 2CHBD 2MGSA 5JVH3 3K5MA 2K5DA 4HMIA 3EFXD 3I56A 1STHA 4X66Q 1MHWC 2KQ3A 2K5HA 3K58A 1D6EC 1SMYD 3VYSA 4DV4L 2KHSA 2K6AA 1S4ZA 5IT9E 2A6HC 1JT8A 5M5XH 4DFAA 2EJGC 2XRQD 3A8KE 1FL0A 2WP8J 3K8AA 4X3TA 3PV0A 2JQOA 1DGSA 5FJ8G 1UE6A 2J0TD 4KHPL 5EQ0A 1CM9A 2N49A 4EQOA 4HIKA 2SDFA 5HGQA 3EQLC 1EY5A 1JE4A 1GO3E 4FF3A 1M1KC 1G6PA 1LM0A 2PW7A 2E2DC 1EQRA 3U50C 5L37A 1N34Q 4ABNA 1TIID 3MXGA 2EJFC 2DN8A 4YWLA 1WOCA 1O7YA 5C4XH 1XTDA 3MWYW 1TXYA 4HCEA 1Q81C 1KDCA 4L5QA 1A62A 4K6LA 1PA6A 1VQDA 1HTLD 4HR7B 2QA4A 1G291 1OXXK 2R3ZA 1VQPA 4WORA 1SNCA 3VYUA 1WD1A 3E3XA 3P20A 2DNEA 2PNRC 1J6QA 3W1GA 4L8JA 2UUBQ 4KKSA 3M4PA 4X65L 3HOXH 3QJYA 4DF7A 5LL6X 1RD9D 3KLSA 4A3BB 1CTMA 3BZDB 1RKNA 2K5QA 3U4VA 3VR5A 3NBHB 1X9NA 1K28A 1PH2A 4BWGB 3NUCA 2IWHA 2R7ZH 3DLLA 4HJ5A 1VQJA 3OTOQ 4DA2A 4RWSC 1STYA 2VZAA 4KHZA 1V1PB 1EEFD 4OEMB 2MFIA 3NHHA 5GAHC 2RA4A 1IYUA 4LFBL 1VQ8A 5KEEA 2ZJRA 4A3DG 4NMZA 2EY5A 4LF6L 2MO1A 2B29A 3OW2A 2EYPA 3F2UA 1TWFB 4LF5Q 3I4MH 4IFDH 3EN2A 4AH6A 4DKAC 4DR1L 5NUCA 1O7ZA 1TY0A 1SYBA 2VQEL 5IYDG 1HR0Q 3X3MA 4A3BG 4HEDA 4UPAA 3Q23A 1ZXTA 5BN4A 3JAME 2L1BA 1PRTF 4NXNL 1K8MA 1I4QA 1WYDA 3AFQA 1VQ7A 3HOYH 3GTOB 4B3TQ 3VYRA 2Z6BA 1OXUA 4A4IA 4JI0L 1D2BA 4DV3L 2AQ1B 2VB3X 1X3FA 2XNAC 3A74A 2X6GA 4FVMA 1NMFA 3LGJA 1EOTA 3OIPA 1BCPB 1XX8A 1Q12A 1XJVA 1XWEA 3A8IE 3M4QA 4L63B 1LV9A 4LF9L 3T16A 1HZBA 5LMNQ 2PQEA 3BVGA 5CV6A 4GOPA 4DR7L 3CW2C 5D65A 2EY6A 4GOPB 5FOBB 4A3IH 1VQHA 2ZT9C 2QEXA 4CDDC 2AQ3B 3KLWA 1HA5A 1NR4A 1NSNS 5G3LF 1L2FA 1MGSA 4UP8A 3R2IA 2LKVA 1SEBD 2ZXPA 3VR4A 1KXLA 4LFBQ 2B2YC 3HG9A 3OSOA 4DR2Q 3CCEA 1WI5A 1CI3M 1GD7A 2L55A 1A63A 2KCTA 4R4QA 1A3UA 4KV6A 3EVQA 2E2IH 1BKBA 1RDPD 1SMXA 3KDFB 1EIFA 4A3MB 1EY6A 3C3LA 1I50B 2X6LA 2EYLA 3HFZB 4GOPC 2A74C 1I6VC 2RQXA 4B9XA 1JWUD 3FKIH 3F8TA 4XDXA 1Q1EA 2E5LQ 4J1MA 5FO8B 3TDQA 2D62A 1I94Q 1QB5D 3T56B 1M90C 4IUVA 2EDGA 2K03A 5A2QL 1KLGD 1PTOD 1S3OA 4JI0Q 5M5YH 3P7JA 4X3KA 4IURA 2JA8H 4KMUC 2F3VA 5DAUA 4JI8L 1PVOA 1Q8IA 4IPDA 3KBXA 3GTQH 5C4JB 3FKIG 2UUCL 1ICFB 4JC0A 2PW5A 1D5XC 4L5RC 3IAYA 3UDIA 2CW0C 5FO7B 4C56C 1WD0A 2XIWA 2D9UA 3AFPA 3G6JB 1U4RA 2MPMA 4DR7Q 3HOUH 2BA0A 4X62Q 1GUTA 2JA5G 3IRBA 1CHPD 3G48A 3L3OC 5F2DA 3HOVG 1PZJD 3RD4A 1K83H 3U9SA 3BVMA 2FINB 2B2UA 2DJFC 2F3IA 2F52A 2MJ8A 3S1NB 4QL5A 1ENAA 5FKAC 1FNVA 1BF4A 4R4CA 4DV5L 1A6XA 4OGQC 2WB1B 3GTKB 3DM1A 2F0GA 1FJGL 1B8AA 1ET6A 4LJZC 3BZKA 3EA6A 1SRUA 4DR6L 1KNEA 1KL9A 2RSOA 4FNFA 3TMEA 1BO0A 5M9OA 4XQQA 3S17B 4O1NA 4K14A 3H94A 5FLXE 1STNA 5GAGC 3U9OA 4NXNQ 3NWTA 3HOVB 3MXNB 4V190 4C3JH 3BYYB 2NZ1D 1I4HA 5CV5A 2RHQB 5C44H 3A55A 2F0EA 1AP0A 1WJJA 1WTHA 1SFOH 4IJLA 5C5MA 1N33Q 1A0IA 5ELEA 5GROA 1D7QA 4K2LA 4GN5A 1Y1VB 4GNXA 4K8IA 5FJ8H 1JE5A 1I4GA 3I4NH 2L12A 4IQZA 2CH4A 4I7AA 4POFA 1BCPD 1RL2A 3M7NA 3J80c 2JE6I 2Q8RE 3CQZB 3T1HQ 3PO2H 2K28A 4LUVA 4LNQA 3ULPA 4B3ML 1H9SA 2NVTB 5EPKA 1V8QA 4LF5L 1VQBA 2KVMA 4WJWA 1PV4A 1M4VA 2K32A 1HRJA 3LWEA 1JQYD 1YHBA 1MD2D 2EZVA 1R9TB 3MC0B 2F03A 4YIJA 3OYYA 2CFMA 5BR8L 4DR6Q 4A3GG 1LUZA 4M8AA 3CQZH 3L0OA 5EAYA 4ZK9B 4P72A 3WDNA 2ZXOA 1AH9A 1Y1WG 1M8AA 4DNIA 2BCOA
chains in the Genus database with same CATH topology
4FF4A 1PFBA 2PZUA 4OIJA 3NQTA 3M7GA 2K01A 1AW7A 1DZ1A 3R93A 2A5HA 4KKTA 1I4PA 2ID0A 1EQTA 1B50A 1SSOA 3GTLB 2EYFA 1EY0A 1VDZA 2R6GA 5IGDA 1CFMA 2JEAI 5C0XG 1G2TA 3S9WA 4ZUJA 2IT1A 4XQJA 4B08A 2NN6G 3K5LA 1HUNA 3W3AA 1S5CD 2Q8IB 1ESFA 1ESRA 2PZWA 4ODGA 4ZUIA 1SJHD 1H9RA 4TKOB 3A7LA 5JAVA 4A3DB 4BA2I 1BQQT 1A3VA 4F87A 4C1NK 3OIQA 1AN8A 1HQRD 2QF7A 5CV9A 2F0JA 1BUVT 2SEBD 1EY4A 1MBYA 1I6HB 1LTBD 1U4LA 4NDXA 4ZLTF 3HZXA 4H44C 3HOWB 1LT4D 1TS5A 5KYIA 3I90A 3X3NA 3S16B 2O5JC 3C1EA 2EXZA 1FYCA 1ZEQX 3RLFA 1EY8A 3N52A 4FF1A 4FXGC 1SNDA 1DYQA 2J7ZA 1I4XA 2PYKA 4H7BA 4RAUC 4DXFA 3LWUA 3TN2A 1WTWA 1KABA 4IZ8A 3P1HA 3A8JE 1LTTD 4HMJA 3KLSX 2SNSA 1EU3A 3OW7A 5IGCA 1DOKA 3J7AF 5COYA 4I7ZC 1U9RA 4BA1I 1A15A 3TSSA 4RHSA 2G9HD 4CKEA 1T5EA 2R7ZB 1OXTA 3FPPA 5K36G 1AEXA 3MXUA 4CJ1B 3IFTA 4CJ2C 1IL8A 2L9HA 1NCVA 3DHQA 1MSHA 3MVVA 2BOSA 2ICIA 1JOKA 3PUXA 3LX0A 1WTRA 1LTAD 5TSSA 1MSGA 1QG7A 3MTSA 4UDUC 1F77A 3H91A 3TP5A 1F2YA 1NAPA 1FR3A 5EBCA 2BDOA 3WOEA 2N55A 1Y1WB 4RKLA 2KA7A 1H9MA 4Y7NB 4FP5D 2HDLA 1SYFA 1EYDA 5I6WA 4S3SA 1SMYC 1NUCA 3T13A 2O4XA 3NBIA 5FLXL 2RDHA 3BYTB 2XSCA 3H09A 1ONLA 3M4YA 2XN9C 4EQPA 2OF1A 1EIGA 4IUNA 2B2WC 4XIGS 5D3IB 1X32A 3PMFA 1ML0D 2EY2A 3S1QB 1LT3D 4KKUA 2CVRA 1W6KA 4EQNA 1O7LA 2Z4IA 1BR9A 2F0HA 3VR3A 2B2YA 1WTVA 2LFNA 1KAAA 4N9PA 5C4ZA 1WTOA 1QCBD 1HA6A 2XWJB 3S1MB 1GOZA 3CHBD 2B8GA 2EYOA 1S5BD 2N88A 2RDFA 5JJZA 5C3WA 1SYDA 1WCMB 2XRSD 2NYZD 2K1BA 1SNMA 3GTJB 3NTHA 3K57A 3L7ZC 4RCOA 5AFWA 2Z8LA 4H0LC 1I4RA 2QCPX 1GXDC 4XYOA 4CHTB 5K36H 2NTTA 4C3JB 1STGA 3J7YW 1AZQA 1H9SB 1TY2A 5JOBA 2WKCA 2SNMA 3J80E 3PUVA 4OO1I 4NKLA 1A3TA 1E0BA 4QF4A 2B2UC 1ILPA 4XXEA 3BDOA 5E4XA 4AYBB 1GUOA 4RGNA 2L5TA 4KY5A 5JVG3 2EOTA 4CGYB 5KRUA 4U673 4KN4C 4A3KB 4TQUS 5C0XI 1PMRA 3QOLA 2LY7A 1F2LA 2ICEC 4X3SA 4KY7A 1CA6A 2BDNA 1JOQA 1H9KA 2A68D 4K6DA 1PRTC 4RKBA 2F0MA 2JXMB 1VF5C 3SXHA 2JYOA 2E2JB 1B53A 1SDFA 1ICWA 3DMUA 5IT9L 1CK1A 5CYUA 5I4DA 3S2HB 5KNCA 2F0IA 3AB9A 1X3QA 2AWNA 2VXWA 4K5WA 2EVBA 2OT2A 2LMCB 1CA5A 4PV1C 5CMDA 3D3RA 4RFBA 4PMCA 4U68A 4BBSB 5CC4A 2MUYA 3QIAA 1LTRD 1WVLA 1BCPF 3ND8A 3PIP3 4C3IG 1D1IA 2A6HD 3K59A 1D1KA 3LNNA 3PO2B 1XYIA 4OO1H 3SEBA 2DY7A 4ZAIA 4FF2A 2LS01 1LTID 2X69A 2JA6B 1R4PB 1ZKOA 5DM73 3GP7A 3HOXB 3MXPA 5C44B 2NVXB 5C6AA 3N6RA 2IJ0A 4TRDA 4A3GB 3BG3A 4ZKBB 2FFKB 2JSOA 3H3VC 3GV6A 5E3FA 3A56A 3SDZA 5FK9C 5E4WC 3I73A 5C3XA 4PQXA 4BS9A 2VB2X 4KJOA 1Y8PB 1W6JA 1CHQD 3HRZC 4QCLA 4R8IA 1STBA 1OO9B 2HDMA 3I4NB 3I70A 1HTPA 2H4OA 1RF2D 4Q5VA 4IFDJ 3J81L 1DD2A 2KEDA 4PMWA 1OXSC 3HS0C 5HGTA 1QNUA 2PPBC 5CV8A 2TSSA 3IFDA 3FDTA 1HFNA 1QNKA 2IX0A 2KUMA 5DEHA 3C2PA 3DWAA 1G91A 2PMZB 3SK4A 2QDBA 2NUCA 5A2QE 4G7OC 2H1EA 3BS1A 5T1GA 5JPMC 1Y8NB 3UI2A 4IALA 2NWGA 5M5WB 2EYJA 1STAA 4Z9CB 1S5FD 5D3DA 3GTQB 1J9OA 2EYMA 2VUMB 2NTSA 1TS4A 4N9TA 3DWPA 1KTKA 4KK7A 1PRTD 1EFID 4ZRZA 1QILA 1CQVA 3TZDA 1EIHA 1LT6D 2C5CA 2IW3A 3HEJA 1LLRD 2Q8TA 5BN3A 3D31A 1YNJC 5IGGA 1Z7TA 2K7VA 4DAYA 4O42A 2D5DA 3M3YB 3TZUA 5I9PA 5HURA 3S1RB 2KOLA 3JAML 1RTOA 5IOCA 4ZKCB 4OO1G 2ZXRA 2JP1A 2Y0SB 3HKZB 4XT1B 3TP7A 3M4OB 5CBAE 2CW0D 4V0BA 4A3EB 1STEA 2O2LD 1BCPC 1X3PA 3KUPA 5CV7A 2Z1CA 4CKBA 2V4DA 3OOCA 3T51B 2F0DA 3CKIB 2HCCA 3VYTA 1ILQA 3MFGA 3R3OA 3FKIB 3MHBA 1WTXA 4K5VA 2E75C 1LTSD 2XWBB 3NWSA 2JA5B 1K8OA 1GJXA 1SJED 4KD4A 5ISRA 5C4HA 3NQIA 3I8ZA 1GUGA 2TMPA 3IKJA 1HUMA 1II3A 3SK5A 2R93B 1DONA 2E2HB 1EEID 2OXPA 3QWNA 4QIWB 1WTQA 1V1OA 4C3JG 4BY7B 4DK0A 2L0CA 1DJRD 2RBMA 5ELDA 1J8IA 5I2XA 1JORA 3D6WA 3WOFA 3PUWA 2EPBA 2L4NA 2F4IA 1MI2A 3RMHA 3GTGB 4HCSA 3NSWA 4LK1C 1GUNA 4G4KA 3TBIB 4PNYA 2M2LA 5C5LA 2RVLA 3OWEB 1YNNC 4WFN3 2B2WA 1PYWD 1EYAA 4K8JA 2DNCA 3K5NA 5LHY1 1KLUD 1NR2A 5IGEA 4DU9A 3K6OA 5ELBA 3E5SA 4K5XA 3GQBA 4F8MA 2MP1A 4RA8A 3O13A 3MZ5A 3URYA 5EKKA 1EY7A 2Z4HA 5E1FA 4CJ0B 1F2ZA 5KYLA 1RCVD 4HN7A 3NE5B 3K0YA 4J8QA 1SXTA 1PFMA 1TS2A 3OMGA 1C48A 4KTAA 1S5ED 2I07B 1HXYD 2IPKD 4DNTB 1F9SA 4G57A 4MIUA 1UNSA 5IODA 1G6ZA 2F0WA 1IW7C 3NTKA 1EZ8A 4NW2A 2F0PA 3HP3A 5CGKA 3ONAB 2AQ2B 5BN5A 1O80A 4BBRB 2E2IB 4KJNA 4RHRA 3OHXC 1IW7D 1E2ZA 1HCZA 5KIXA 2K04A 4QB4A 2G9DA 4DAPA 4HSPA 4E6IA 2EJMA 3KLRA 1L0XB 4FYDA 3J81E 1HHVA 2QILA 1Q90A 2AWOA 4GZYC 3R2TA 2B2VA 1DOLA 1SNOA 4ID6A 1O78A 1TWGB 3CU7A 1LACA 3NXWA 2F0QA 4EGVA 3RZOB 1IKMA 2KJXA 4R9WA 2IL8A 3OMCA 1A2TA 2C9OA 3FVQA 3L9AX 2HCIA 1EYCA 3HOZB 1UUPA 1EWHA 2B63B 4RGMA 2OEOA 2ENBA 3QO2A 2NVQB 3VA5A 5FO9B 3CRLC 4C3IB 2VNUD 5C0XJ 1RJTA 2E74C 1SE4A 3OWFA 3DXJC 2FMMA 3C46A 2A68C 2F0KA 1SYGA 3SK6A 2GA4B 1VMPA 2SOBA 4TSSA 2RKSA 5I9OA 2BE5C 4XYQA 3S14B 4A93B 3Q24A 3TP8A 2F0SA 4DGZA 4XT3B 3CRKC 5G3LD 2NN6H 3P75A 1JCKB 1Z6HA 1SNPA 1BBXC 1TQOA 1GUWA 1Q3LA 2PO4A 3K5OA 4C3HB 5EKIA 5C4XB 2D2CC 1L0YB 1F9QA 5EKLA 5CBEE 4IN3A 4I65A 1RODA 1EY9A 2BA1A 4DN4M 4KI0A 1DOMA 5JEAJ 3GTMB 2F0UA 4EVOA 5KNDA 5EPLA 1EL0A 4LAAA 3A7AB 5M3MB 3EROA 5JPNC 3PIO3 3AU7A 1HQMC 1PXUA 2B2TC 2YYZA 3Q6SA 1PFNA 1SE2A 1PRTB 2F1MA 3GD7A 1V1PA 5J39A 2R92B 5A35A 1SFOB 3S2DB 5JEAG 3NBHA 4DAVA 1BXTA 1SYCA 2WAQB 3I3CA 1JWMD 1TVXA 4Q0FA 5IIFA 5K5PA 2B2TA 5D14A 1AFPA 1B9NA 2NN6I 1K83B 1PTOF 1Y8OB 1BDOA 4QUCA 3V96A 3MFYA 3VR6A 4HAEA 2F0LA 2NVYB 3PO3B 3C1FA 1JC7A 4IFDI 4C1NI 3H0GB 5M5XB 4KD3A 2M9VA 3RZDB 1KNAA 3FRPB 1DCZA 1G2SA 2K33A 3D8GA 1UAPA 2JA7B 4XQNA 1F9RA 1U4PA 4PMBA 2F0TA 4P2CB 3G7LA 4OHJA 2AUKA 1S5DD 3MA2B 1VCIA 2R61A 3D6CA 1KDBA 2J4XA 3DEOA 1YNND 4A3JB 2NB0A 1PZID 4QUFA 2WINB 2FHTA 1DXMA 1Y69U 1JR0D 1QWYA 1F2MA 1EQVA 3T4AC 3A54A 3S15B 1F9PA 1CZGA 3HOUB 4ILWA 1TS3A 2KECA 2A69C 3I4LA 4OIKA 3VA7A 3T53B 5ELCA 4G7ZC 3DEPA 4DK1A 1B44D 2JA8B 2QKIC 3MAQA 4FXDA 5M5YB 2A69D 1KDAA 3IL8A 2EE1A 1CT1D 1TWAB 1ZYRD 1TR5A 4WRDA 4DXGA 1VF7A 3QG1A 4XTCS 4K2KA 5DM63 3HOYB 2B39A 3BDLA 3FPUB 1FGBD 4IUPA 2KCCA 4ULLA 1GHKA 1B1ZA 2K5WA 5IGBA 4FO2A 4F7XA 1I3QB 1PTOB 1U4MA 1CZWA 3I4MB 4CKCA 2IX3A 3ND9A 3KK7A 4IUUA 3MXNA 4JBWA 3NP8A 1BNZA 1BOSA 3HGBA 1HFGA 5EBDA 3Q22A 1V43A 4X3UA 2IX1A 2B8FA 3DWQA 2WV6D 1XTCD 2NBFA 2A73B 1TWHB 3H6MA 5T1IA 2MHVA 2A6EC 4OL7A 1TU2B 3V05A 1E2VA 2F0VA 3M85A 1GUSA 4IFDG 4KHVA 3E0JA 4IUTA 3V2TA 5KNBA 3SK8A 3PUYA 3SHLA 3QOJA 2AUJD 3BDCA 4IUQA 1IHZA 1SE3A 2PZTA 2RDGA 5I2YA 2WIIB 4CBVA 1JWSD 3NPPA 5J1ZA 4LMQD 1ET9A 3OPOA 4L6TB 1XXGA 2F0NA 3GV3A 4C3HG 4QMGA 1Q1BA 1EZ6A 3D4DA 5IGFA 3DUZA 3D4WA 2BE5D 4B9WA 5CV4A 1D5MC 1LT5D 2F0OA 4ZQ3A 4G7HC 2CQAA 4FXKC 2O5IC 1FD7D 4F88A 3SVMA 1E2WA 1G8ZD 3SE0A 4RGTA 1QOHA 3I72A 1B4OA 5CORA 1GHJA 2WACA 1TT2A 1C4QA 1WTPA 1JOOA 1DM0B 2DY8A 4ZYSA 1EU4A 5DNFA 1PTOC 3TP6A 5EJWA 4JK1C 1SNQA 2HUGA 1T5XD 2XVSA 1IKLA 4ME5A 3FMCA 1ENCA 1B9MA 1OXVA 5CR3A 1LABA 2B2VC 1YNJD 1SYEA 3J80L 1A2UA 2L11A 1JB3A 1SBBB 2RSNA 4MN3A 4RH6A 5EPJA 5C0XH 1QE6A 3ITPA 3ERQA 3AMUA 2F0FA 1QJOA 1FNUA 2YU9B 1IYVA 2EYHA 4R8NA 1JICA 1ZYRC 4UAIA 1PDQA 1B3AA 4H13C 1PTOH 1FNWA 3FEWX 1RHPA 1R4QB 1PLFA 2K05A 1CQFA 3ZYYX 3Q0AA 1TKWB 3EJIA 3I91A 3R8BA 2WKDA 1RTNA 2FJ2A 5EGTA 3GTPB 2E76C 2PCFB 3BVZA 2HQEA 1TWCB 2I46A 4RCNA 4KN7C 1LTGD 4C2MB 4HSVA 3KF8A 3PUZA 4A3FB 4DNRB 4NP5A 3K7AB 1LO5D 4BY1B 1C8CA 4MHEA 3W2DA 4M1UB 3D4RA 5J22A 1PZKD 1AZPA 2EY1A 3RUZA 5JEAH 3GO5A 1Z47A 5LL6S 5KGUA 5C3EB 2A6ED 3NTIA 3SR1A 1SAPA 3E6ZX 1EWCA 1H9JA 1VMCA 2FMCA 2QEJC 2KCNA 5I6YA 3NK9A 2F3WA 4J6HA 5ELFA 1D5ZC 2KEEA 4HTHA 1UEAB 3QB3A 3J7AV 4A3IB 2JEBI 2M00A 1B2TA 5M3FB 1HPCA 3KBGA 3MEHA 4RGOS 3VR2A 1ENFA 4KY6A 2CHBD 2MGSA 5JVH3 3K5MA 2K5DA 4HMIA 3EFXD 1STHA 2KQ3A 3K58A 1D6EC 1SMYD 3VYSA 2KHSA 2K6AA 1S4ZA 5IT9E 2A6HC 4DFAA 2EJGC 2XRQD 3A8KE 2WP8J 4X3TA 3PV0A 2J0TD 5EQ0A 1CM9A 4EQOA 2SDFA 3EQLC 1EY5A 1JE4A 4FF3A 2PW7A 2E2DC 4ABNA 1TIID 3MXGA 2EJFC 2DN8A 1O7YA 3MWYW 4HCEA 1KDCA 4K6LA 1HTLD 4HR7B 1G291 1OXXK 2R3ZA 4WORA 1SNCA 3VYUA 1WD1A 3P20A 2DNEA 2PNRC 4L8JA 4KKSA 3QJYA 4DF7A 5LL6X 1RD9D 3KLSA 4A3BB 1CTMA 3BZDB 1RKNA 2K5QA 3VR5A 4BWGB 3NUCA 2IWHA 4DA2A 4RWSC 1STYA 4KHZA 1V1PB 1EEFD 3NHHA 2RA4A 1IYUA 5KEEA 4NMZA 2EY5A 2EYPA 3F2UA 1TWFB 4IFDH 5NUCA 1O7ZA 1TY0A 1SYBA 3X3MA 4HEDA 3Q23A 1ZXTA 5BN4A 3JAME 2L1BA 1PRTF 1K8MA 1I4QA 3GTOB 3VYRA 1OXUA 1D2BA 2AQ1B 2VB3X 2XNAC 2X6GA 4FVMA 1EOTA 3OIPA 1BCPB 1XX8A 1Q12A 1XWEA 3A8IE 4L63B 1LV9A 3T16A 2PQEA 3BVGA 5CV6A 5D65A 2EY6A 5FOBB 2ZT9C 2AQ3B 1HA5A 1NR4A 1NSNS 5G3LF 1MGSA 3R2IA 2LKVA 1SEBD 2ZXPA 3VR4A 2B2YC 3HG9A 3OSOA 1CI3M 2L55A 1A3UA 4KV6A 3EVQA 1RDPD 4A3MB 1EY6A 3C3LA 1I50B 2X6LA 2EYLA 2A74C 1I6VC 2RQXA 4B9XA 1JWUD 4XDXA 1Q1EA 4J1MA 5FO8B 3TDQA 2D62A 1QB5D 3T56B 4IUVA 2EDGA 2K03A 5A2QL 1KLGD 1PTOD 3P7JA 4X3KA 4IURA 4KMUC 2F3VA 5DAUA 1Q8IA 3KBXA 5C4JB 2PW5A 1D5XC 3IAYA 2CW0C 5FO7B 4C56C 1WD0A 2XIWA 2D9UA 3G6JB 1U4RA 2MPMA 2BA0A 1GUTA 5F2DA 1CHPD 3L3OC 1PZJD 3RD4A 3U9SA 3BVMA 2FINB 2B2UA 2MJ8A 3S1NB 1ENAA 5FKAC 1FNVA 1BF4A 1A6XA 4OGQC 2WB1B 3GTKB 3DM1A 2F0GA 1ET6A 4LJZC 3EA6A 1KNEA 2RSOA 4FNFA 3TMEA 1BO0A 5M9OA 4XQQA 3S17B 4O1NA 4K14A 3H94A 5FLXE 1STNA 3U9OA 3NWTA 3HOVB 4V190 3BYYB 2NZ1D 1I4HA 5CV5A 3A55A 2F0EA 1AP0A 5C5MA 5ELEA 4K2LA 1Y1VB 4K8IA 1I4GA 2L12A 4IQZA 1BCPD 3M7NA 2JE6I 2Q8RE 3CQZB 2K28A 1H9SA 2NVTB 5EPKA 1V8QA 2KVMA 4WJWA 1M4VA 2K32A 1HRJA 3LWEA 1JQYD 1MD2D 2EZVA 1R9TB 3MC0B 2F03A 4YIJA 4M8AA 4ZK9B 3WDNA 2ZXOA 1M8AA 2BCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EQP A;  2EYM A;  2OF1 A;  2EYH A;  3QOL A;  4R8N A;  5IOD A;  5NUC A;  4N9T A;  2F0W A;  2OXP A;  2PZU A;  1TR5 A;  2KHS A;  2F0N A;  1EZ8 A;  1SYB A;  1KAB A;  4IUN A;  3P1H A;  4IZ8 A;  4WRD A;  5E3F A;  4DFA A;  2RBM A;  3NQT A;  4KY7 A;  3TP8 A;  1JOR A;  4K2K A;  3PMF A;  1JOQ A;  2F0P A;  4QMG A;  2F0S A;  5F2D A;  4HMJ A;  4K6D A;  5CGK A;  4RKB A;  4DGZ A;  1EZ6 A;  2EY2 A;  3D4D A;  2SNS A;  3BDL A;  3HEJ A;  5IGC A;  5C3X A;  2F0M A;  5IGF A;  3SXH A;  4EQO A;  1ENA A;  4KJN A;  2F0L A;  3D4W A;  4KJO A;  4EQN A;  5IGG A;  2F0G A;  5IGB A;  1EY5 A;  1U9R A;  2F0H A;  3EJI A;  4B9W A;  5CV4 A;  2EYF A;  2PW7 A;  3C1F A;  1EY0 A;  3P75 A;  4F7X A;  5KIX A;  2F0O A;  1KAA A;  4N9P A;  4PNY A;  4QB4 A;  4ZQ3 A;  3TME A;  5C4Z A;  4KD3 A;  5IGD A;  5M9O A;  5C5L A;  1SNP A;  4E6I A;  1STB A;  4K14 A;  1AEX A;  3NP8 A;  1STN A;  3S9W A;  5EGT A;  3U9O A;  1TQO A;  4ZUJ A;  3DMU A;  2HQE A;  2EYO A;  3T16 A;  2PQE A;  5CV6 A;  1EYA A;  5I9P A;  5CV5 A;  5HUR A;  3DHQ A;  2RDF A;  3D8G A;  4K8J A;  2F0I A;  2F0E A;  1SYD A;  5C3W A;  1KDC A;  2EY6 A;  4NP5 A;  3MVV A;  4PMB A;  2F0T A;  4K5W A;  5EKL A;  1JOK A;  5C5M A;  5IOC A;  4WOR A;  3LX0 A;  1NSN S;  2WAC A;  4I65 A;  5IGE A;  1EY9 A;  1SNC A;  1TT2 A;  1SNO A;  4ID6 A;  1SNM A;  4ME5 A;  4DU9 A;  5HGT A;  2LKV A;  4K2L A;  2PZW A;  4ODG A;  4ZUI A;  3D6C A;  3NXW A;  1KDB A;  1JOO A;  3OSO A;  3E5S A;  2F0Q A;  4K8I A;  3TP7 A;  5J22 A;  4K5X A;  5CV8 A;  4PMC A;  2F0U A;  5JAV A;  3TP5 A;  4F8M A;  5CC4 A;  2EY1 A;  1F2Y A;  4EVO A;  3RUZ A;  1A3V A;  1A3U A;  4KV6 A;  4LAA A;  3EVQ A;  4DF7 A;  3H6M A;  5KGU A;  3MZ5 A;  3SK5 A;  3OMC A;  1A2T A;  5EKK A;  3TP6 A;  5DEH A;  5K5P A;  5CV7 A;  3ERO A;  4OL7 A;  5CV9 A;  1EY7 A;  3SR1 A;  1EY6 A;  2F0J A;  5E1F A;  1STG A;  1F2M A;  1EQV A;  2F0V A;  1RKN A;  1F2Z A;  2EYL A;  5KYL A;  1EY4 A;  1SNQ A;  4B9X A;  4KHV A;  4RKL A;  2F0D A;  5JOB A;  1EYC A;  5I6Y A;  4NDX A;  3NUC A;  3NK9 A;  1ENC A;  2F3W A;  4J6H A;  2SNM A;  3HZX A;  4J1M A;  2QDB A;  3R3O A;  3SK4 A;  3SK8 A;  1SYF A;  1EYD A;  2NUC A;  3MHB A;  5I6W A;  4K5V A;  5J39 A;  2OEO A;  4S3S A;  3OMG A;  1STY A;  2ENB A;  4HTH A;  5CR3 A;  3VA5 A;  3QB3 A;  5KYI A;  1SYE A;  3SHL A;  3QOJ A;  1A2U A;  4NKL A;  1A3T A;  2M00 A;  4IAL A;  3NHH A;  4KTA A;  3BDC A;  4QF4 A;  1NUC A;  3OWF A;  2O4X A;  3T13 A;  3C1E A;  1IHZ A;  2EYJ A;  2EXZ A;  1STA A;  2PZT A;  3MEH A;  3MXP A;  4YIJ A;  2F3V A;  2F0K A;  4KD4 A;  1SYG A;  4KY5 A;  5DAU A;  4NMZ A;  2EY5 A;  5KEE A;  1EY8 A;  5KRU A;  4KY6 A;  4G57 A;  1SYC A;  3SK6 A;  5ISR A;  3ITP A;  5C4H A;  2EYP A;  3ERQ A;  5C6A A;  1SND A;  4HMI A;  5J1Z A;  2F0F A;  2PW5 A;  2SOB A;  4MIU A;  2RKS A;  2PYK A;  4TRD A;  1STH A;  1KDA A;  3V2T A;  5I9O A;  5IIF A;  1II3 A;  2KQ3 A;  4H7B A; 
#chains in the Genus database with same CATH topology
 4FF4 A;  1PFB A;  2G5D A;  2N3S A;  2PZU A;  3CC4 A;  4JBJ A;  4OIJ A;  2JK8 A;  3NQT A;  3M7G A;  2K01 A;  4B3R L;  4IOC A;  4LUZ A;  1AW7 A;  1DZ1 A;  1QZG A;  3R93 A;  4DR4 Q;  2UU9 Q;  3NEN A;  2A5H A;  4KKT A;  1I4P A;  2ID0 A;  1EQT A;  1MKH A;  1X56 A;  5IYC G;  1B50 A;  1SSO A;  3GTL B;  2EYF A;  1EY0 A;  1VDZ A;  2R6G A;  5IGD A;  1CFM A;  2JEA I;  5C0X G;  1G2T A;  1A8V A;  3S9W A;  3QR8 A;  4ZUJ A;  3TS2 A;  2YTY A;  2IT1 A;  2RCF A;  2WFW A;  3CCU A;  4XQJ A;  4B08 A;  2NN6 G;  3K5L A;  2ZM6 L;  1HUN A;  3W3A A;  1S5C D;  1KQS A;  3AYH B;  2Q8I B;  1ESF A;  1ESR A;  1HH2 P;  2PZW A;  4JOI A;  4ODG A;  4ZUI A;  1SJH D;  5C44 G;  2NVX H;  3AEV A;  1H95 A;  1H9R A;  4TKO B;  3A7L A;  4DK3 C;  5JAV A;  4A3D B;  3ICE A;  4BA2 I;  1BQQ T;  1A3V A;  4F87 A;  4C1N K;  3OIQ A;  1AN8 A;  1HQR D;  2QF7 A;  5CV9 A;  2F0J A;  1SR3 A;  1BUV T;  4JI7 L;  2SEB D;  1EY4 A;  1MBY A;  1I6H B;  1E1T A;  1LTB D;  1U4L A;  4OX9 L;  2UXC Q;  4NDX A;  4R4T A;  4ZLT F;  3HZX A;  5IYD H;  4PZ8 A;  4H44 C;  3HOW B;  3K7U C;  4EX5 A;  1LT4 D;  3PO2 G;  1TS5 A;  5KYI A;  1B7Y B;  3KJO A;  3I90 A;  4JOI C;  5IT9 c;  3X3N A;  3S16 B;  1VQC A;  3C1E A;  2O5J C;  1O7I A;  1PH4 A;  2EXZ A;  1FYC A;  1ZEQ X;  3RLF A;  4DPG A;  1EY8 A;  3N52 A;  4FF1 A;  3KF6 B;  4QY7 A;  4A3M H;  4B3M Q;  1IYJ B;  4FXG C;  1SND A;  1DYQ A;  4JI3 L;  1E3P A;  2J7Z A;  1I4X A;  2PYK A;  4IO9 A;  4H7B A;  4RAU C;  4DXF A;  1GM5 A;  2HQL A;  3LWU A;  2K4K A;  3TN2 A;  1WTW A;  1XMO L;  1KAB A;  4IZ8 A;  3P1H A;  2ZM6 Q;  3A8J E;  1LTT D;  3PF4 A;  3S2H H;  4HMJ A;  3KLS X;  1YHA A;  3HKZ G;  2SNS A;  1EU3 A;  2WB1 E;  3OW7 A;  5IGC A;  5GAE C;  1DOK A;  3J7A F;  1NNX A;  5COY A;  4I7Z C;  1U9R A;  1XPO A;  4BA1 I;  1A15 A;  3TSS A;  4RHS A;  1VQA A;  2G9H D;  4JV5 L;  4CKE A;  1T5E A;  2R7Z B;  1OXT A;  3FPP A;  5K36 G;  1AEX A;  3MXU A;  4CJ1 B;  3IFT A;  4CJ2 C;  4KHP Q;  1IL8 A;  4YWM A;  2L9H A;  3I7F A;  1NCV A;  3DHQ A;  1MSH A;  3MVV A;  1KRS A;  2BOS A;  2ICI A;  1JOK A;  1WCM G;  3PUX A;  3LX0 A;  4GKK L;  1WTR A;  2YTV A;  1LTA D;  4JBK A;  5TSS A;  1MSG A;  1QG7 A;  3MTS A;  4UDU C;  1F77 A;  3H91 A;  3TP5 A;  1F2Y A;  1NAP A;  1FR3 A;  1TWF H;  4P71 A;  5EBC A;  2BDO A;  4GN4 B;  3WOE A;  2N55 A;  1S72 A;  3CC2 A;  1Y1W B;  2MNA A;  4RKL A;  1XMO Q;  4LF7 L;  2KA7 A;  4DR5 Q;  1H9M A;  4Y7N B;  4FP5 D;  3HOU G;  2HDL A;  2NVT H;  1MJC A;  1EYD A;  1SYF A;  5I6W A;  1UE1 A;  1EFW A;  4YHH L;  4X66 L;  4S3S A;  1VQO A;  1SMY C;  4B3T L;  2AKW B;  2EIF A;  4JPB W;  1NUC A;  3T13 A;  2O4X A;  3NBI A;  5FLX L;  1I94 L;  2RDH A;  3BYT B;  1JJG A;  2XSC A;  3STB D;  1Y14 B;  3H09 A;  1ONL A;  2P5Z X;  1PH8 A;  3M4Y A;  2XN9 C;  1PH3 A;  1IBM L;  1JB7 A;  1YVC A;  4EQP A;  2OF1 A;  1EIG A;  5LMN L;  1FVI A;  4IUN A;  5GQO A;  2B2W C;  4XIG S;  5D3I B;  1X32 A;  4DV2 Q;  1N36 Q;  4JW0 A;  3PMF A;  1ML0 D;  3PCO B;  2EY2 A;  3BJU A;  3S1Q B;  4H02 A;  1LT3 D;  4KKU A;  2CVR A;  1W6K A;  5FLM G;  4EQN A;  1O7L A;  2Z4I A;  1BR9 A;  2F0H A;  4ZCK A;  2B2Y A;  3VR3 A;  4HJ9 A;  1WTV A;  2Z9H A;  3T1Y Q;  3KJP A;  2LFN A;  1KAA A;  4N9P A;  5C4Z A;  1WTO A;  1QCB D;  1HA6 A;  3A0J A;  2XWJ B;  3S1M B;  1GOZ A;  3CHB D;  2B8G A;  2EYO A;  1S5B D;  4DV3 Q;  2N88 A;  2RDF A;  5JJZ A;  5C3W A;  1SYD A;  1WCM B;  2XRS D;  4YY3 Q;  1B70 B;  2NYZ D;  1KHI A;  2VQF Q;  2ZJQ A;  3KYH C;  2R92 H;  2K1B A;  1Y1V H;  1SNM A;  4PG3 A;  3GTJ B;  3NTH A;  3K57 A;  2ZTC A;  3L7Z C;  4YY3 L;  4RCO A;  1U0L A;  2Z8L A;  4H0L C;  5AFW A;  1I4R A;  2QCP X;  1GXD C;  4XYO A;  3K7A H;  1TWG H;  4CHT B;  3B6Y A;  5K36 H;  2UUA L;  2NTT A;  1K8G A;  2RCN A;  4C3J B;  2CCZ A;  1X6O A;  1STG A;  3MEF A;  3UDX A;  3J7Y W;  1AZQ A;  1H9S B;  3NEM A;  4DR4 L;  1TY2 A;  5JOB A;  2WKC A;  1L0W A;  5JJL A;  1XNR L;  2SNM A;  2AHO B;  2L15 A;  1JJ2 A;  3J80 E;  2Q2H A;  4GLV B;  3PUV A;  4QGU A;  4OO1 I;  3RNU A;  1X65 A;  4NKL A;  4DV1 L;  1VQ5 A;  1A3T A;  5E7N A;  1E0B A;  4QF4 A;  2B2U C;  1ILP A;  4XXE A;  3BDO A;  5E4X A;  2KBN A;  1GUO A;  4AYB B;  4RGN A;  2L5T A;  4KY5 A;  5JVG 3;  2EOT A;  4CGY B;  5KRU A;  4U67 3;  1PH1 A;  2OQ0 A;  4KN4 C;  4R4I A;  5IP9 G;  4A3K B;  4TQU S;  5C0X I;  1PMR A;  5BR8 Q;  3QOL A;  2LY7 A;  4O2D A;  2E8G A;  1F2L A;  2ICE C;  4X3S A;  4KY7 A;  1CA6 A;  2BDN A;  1JOQ A;  1H9K A;  2A68 D;  2ZJP A;  4K6D A;  1PRT C;  4RKB A;  2OTL A;  4BBS G;  1XPU A;  1SRO A;  3UE1 A;  2PNH A;  2F0M A;  2JXM B;  1VF5 C;  1YI2 A;  3SXH A;  3S14 H;  2JYO A;  4JI1 Q;  3M4O H;  2VUM H;  4YCU A;  2WB1 G;  2E2J B;  1B53 A;  1SDF A;  4P73 A;  4QJF A;  3OTO L;  3F2D A;  1FGU A;  1ICW A;  3DMU A;  5IT9 L;  4JYA L;  4JI5 Q;  1CK1 A;  5CYU A;  2XTI A;  5I4D A;  3S2H B;  3JC6 6;  5KNC A;  1D8L A;  2F0I A;  3AB9 A;  1X3Q A;  4C3I H;  2LXK A;  2AWN A;  2VXW A;  1VQI A;  4K5W A;  2EVB A;  2D0O A;  2B63 H;  2OT2 A;  2LMC B;  4OEL B;  1CA5 A;  3PIP A;  4PV1 C;  5CMD A;  3D3R A;  5LMU L;  4RFB A;  4A3J H;  3NEL A;  1VQF A;  4PMC A;  4U68 A;  4BBS B;  5CC4 A;  2MUY A;  2RHS B;  3QIA A;  1ASY A;  1LTR D;  1WVL A;  1BCP F;  3ND8 A;  2JA9 A;  4DV5 Q;  2ZTD A;  4OWX B;  3PIP 3;  2VS1 A;  4C3I G;  1D1I A;  2A6H D;  3K59 A;  1D1K A;  3LNN A;  3PO2 B;  1XYI A;  4OO1 H;  3SEB A;  2DY7 A;  4ZAI A;  4FF2 A;  1C7Y A;  4BBR G;  2LS0 1;  1SE8 A;  2KHI A;  1QVC A;  1LTI D;  2QW7 A;  2X69 A;  4IPG A;  2JA6 B;  4JG2 A;  1L1O B;  2ATW A;  1R4P B;  4A3B H;  1ZKO A;  5DM7 3;  1J5E L;  3GP7 A;  1L1O A;  3HOX B;  2K50 A;  3MXP A;  3WWV A;  1KRT A;  3ULL A;  5C44 B;  1UE5 A;  4OON A;  2NVX B;  5C6A A;  3N6R A;  2IJ0 A;  3CP0 A;  4TRD A;  4A3G B;  1CKO A;  3BG3 A;  4ZKB B;  2FFK B;  2JSO A;  3H3V C;  5C4X G;  3TS0 A;  1LTL A;  3GV6 A;  5E3F A;  5IE8 A;  1HZ9 A;  2LXJ A;  3A56 A;  3SDZ A;  5FK9 C;  5E4W C;  3I73 A;  1EIY B;  2GVA A;  1X54 A;  5C3X A;  3CD6 A;  1N9W A;  4PQX A;  2VQE Q;  4BS9 A;  4DV7 Q;  2VB2 X;  4KJO A;  1K73 C;  1MJE A;  1CSQ A;  1Y8P B;  1W6J A;  1CHQ D;  4UY8 C;  1MIU A;  1K0R A;  2K75 A;  3TRE A;  3HRZ C;  3JAM c;  4QCL A;  4GKJ Q;  3U4Z A;  4R8I A;  1STB A;  4X64 Q;  1OO9 B;  2HDM A;  3I4N B;  4A3C G;  3EIV A;  3I70 A;  1HTP A;  2H4O A;  3K80 C;  1RF2 D;  1U5K A;  1VQ4 A;  2UXC L;  1QUQ A;  4Q5V A;  4IFD J;  3J81 L;  1DD2 A;  2KED A;  4X64 L;  5JJI A;  3ER0 A;  4WJ3 M;  4PMW A;  1OXS C;  2A19 A;  3HS0 C;  1IL2 A;  5HGT A;  4A3E H;  1TWC H;  1QNU A;  1J5E Q;  4B3R Q;  2PPB C;  5CV8 A;  2TSS A;  3IFD A;  3FDT A;  2HIV A;  1QNK A;  1HFN A;  3J81 c;  4AYB G;  1T9H A;  2IX0 A;  2KUM A;  1YNX A;  3CC7 A;  5DEH A;  4LFC L;  4LF4 L;  3C2P A;  4DR2 L;  3DWA A;  1EUJ A;  3CCM A;  2PI2 E;  4GLX A;  3S1N H;  1G91 A;  2I0Q A;  2PMZ B;  1NBW A;  2CQO A;  3SK4 A;  2QDB A;  2Y0S E;  3K81 C;  2NUC A;  5A2Q E;  4G7O C;  2H1E A;  3BS1 A;  2HT1 A;  1IXR A;  5T1G A;  5JPM C;  1Y8N B;  3UI2 A;  4IAL A;  2NWG A;  5M5W B;  1VQ6 A;  2EYJ A;  1STA A;  4UP7 A;  4Z9C B;  1S5F D;  4DV6 Q;  5D3D A;  3GTQ B;  1J9O A;  1VQK A;  5ELN A;  2JA6 H;  4QIW E;  2UUB L;  2EYM A;  1LYL A;  4APV A;  2VUM B;  2NTS A;  1TS4 A;  3BU2 A;  3DWP A;  4N9T A;  3CME A;  4CDC C;  1S40 A;  1KTK A;  1HNZ L;  4KK7 A;  1IBK Q;  1BBU A;  1E7Z A;  1PRT D;  1EFI D;  4ZRZ A;  1QIL A;  1CQV A;  3TZD A;  3S24 A;  1EIH A;  1LT6 D;  2C5C A;  2IW3 A;  3HEJ A;  2K5V A;  1LLR D;  2Q8T A;  5BN3 A;  3D31 A;  5AJ3 Q;  1YNJ C;  5IGG A;  1Z7T A;  2K7V A;  4OWT B;  2GN5 A;  3E9H A;  4DAY A;  4A76 A;  4O42 A;  3S15 H;  2D5D A;  2NVQ H;  3M3Y B;  3TZU A;  1Z9F A;  4DAY B;  5I9P A;  5H1S E;  5HUR A;  1YIJ A;  3S1R B;  2XGT A;  3HKS A;  1CKN B;  2KOL A;  3JAM L;  2VUM G;  1RTO A;  5IOC A;  4ZKC B;  4OO1 G;  4X6A H;  2ZXR A;  2JP1 A;  2OCE A;  1B3Q A;  2Y0S B;  3HKZ B;  5C4J H;  3CMA A;  4XT1 B;  3TP7 A;  4DV0 L;  1Q8K A;  3KF8 B;  2VY3 A;  4OXP A;  2JA8 G;  3M4O B;  5CBA E;  3AQQ A;  4DV6 L;  2CW0 D;  4V0B A;  4A3E B;  1STE A;  2O2L D;  1BCP C;  4Y52 H;  1X3P A;  3KUP A;  5CV7 A;  2Z1C A;  4CKB A;  2V4D A;  3W5O A;  3OOC A;  3T51 B;  1EWI A;  4RMF A;  3CCQ A;  2F0D A;  3CKI B;  1RIP A;  2HCC A;  3VYT A;  2WAQ G;  1ILQ A;  2R7D A;  3MFG A;  3R3O A;  3FKI B;  3MHB A;  1WTX A;  1HNX L;  4K5V A;  2E75 C;  1LTS D;  2XWB B;  3NWS A;  1GVP A;  2JA5 B;  5M3F G;  3HOX G;  4A3K H;  1K8O A;  4BY7 G;  1GJX A;  1PHJ A;  1SJE D;  4HID A;  4KD4 A;  1R9T H;  1SLJ A;  4DR5 L;  5ISR A;  4BXX H;  5C4H A;  3NQI A;  3I8Z A;  1GUG A;  2TMP A;  3IKJ A;  1HUM A;  1II3 A;  3SK5 A;  2R93 B;  5JJK A;  1DON A;  2E2H B;  1WFQ A;  1EEI D;  2OXP A;  3QWN A;  4QIW B;  1WTQ A;  1V1O A;  4C3J G;  1VQL A;  2H5X A;  2L0C A;  4DK0 A;  1DJR D;  4BY7 B;  2RBM A;  5ELD A;  1J8I A;  5I2X A;  1JOR A;  3D6W A;  3WOF A;  3PUW A;  2PQA B;  2EPB A;  2L4N A;  2F4I A;  3S1Q H;  1MI2 A;  4CDF C;  3CCR A;  3RMH A;  3GTG B;  4A3G H;  4HCS A;  3NSW A;  3H0G G;  4LK1 C;  1YIT A;  2Z6K C;  1Q7Y C;  1X3E A;  1GUN A;  4JI7 Q;  2OTJ A;  1P16 A;  1QUQ B;  1N32 Q;  2QGQ A;  4G4K A;  1PFS A;  3TBI B;  3RZD H;  4PNY A;  2M2L A;  1I5F A;  4IPH A;  5C5L A;  2QDL A;  1XPR A;  2RVL A;  3D0F A;  3OWE B;  1YNN C;  4WFN 3;  2B2W A;  1PYW D;  1EYA A;  4NB3 A;  4UHV A;  5FLM H;  4K8J A;  4B3S Q;  2DNC A;  3K5N A;  3F1Z A;  3GTG H;  3HOV H;  5LHY 1;  1KLU D;  1NR2 A;  3T1Y L;  1QVG A;  4JI5 L;  3S1M H;  5IGE A;  5M3F H;  4DU9 A;  1Q46 A;  4Y7N H;  3K6O A;  5ELB A;  2Z6K A;  3E5S A;  4K5X A;  4CDE C;  1K8A C;  3GQB A;  4YHH Q;  1K3B C;  4F8M A;  3H3V H;  2MP1 A;  4RA8 A;  3O13 A;  2V1C C;  3MZ5 A;  1AE2 A;  3URY A;  5EKK A;  1W3S A;  2RF4 A;  4N8X 1;  1EY7 A;  2Z4H A;  5E1F A;  4CJ0 B;  1F2Z A;  5KYL A;  1RCV D;  3DM3 A;  3STB C;  4HN7 A;  4LWC A;  3NE5 B;  2K14 A;  2IHF A;  3K0Y A;  4AYB E;  5IP9 H;  4J8Q A;  1SXT A;  1VQN A;  1PFM A;  1TS2 A;  3S2D H;  3OMG A;  2HD3 A;  4YCV A;  1C48 A;  1PH5 A;  5IP7 G;  1KAW A;  5LMN W;  4KTA A;  1S5E D;  2I07 B;  1HZC A;  1HXY D;  5IYC H;  4DV2 L;  2HIX A;  1IBK L;  2IPK D;  4DNT B;  1YHQ A;  4A3L H;  1F9S A;  4G57 A;  3E9I A;  4MIU A;  1UNS A;  3I55 A;  1PYB A;  2KHJ A;  3PQI A;  5IOD A;  1G6Z A;  2F0W A;  4LF6 Q;  3UDF A;  4L5T A;  1IW7 C;  2Z0S A;  3NTK A;  1EZ8 A;  2LSS A;  1K0S A;  4NW2 A;  2F0P A;  3HP3 A;  1Y1W H;  5CGK A;  3ONA B;  2AQ2 B;  5BN5 A;  3K0X A;  1O80 A;  4BBR B;  3HOZ G;  2E2I B;  4KJN A;  4RHR A;  3OHX C;  1IW7 D;  1VQM A;  4GNX C;  4TVA B;  1E2Z A;  1HCZ A;  4J15 A;  3UE0 A;  5KIX A;  2VQF L;  1XNQ Q;  2Q2T A;  2K04 A;  1KIX A;  4QB4 A;  1JMC A;  2G9D A;  4DAP A;  4HSP A;  4E6I A;  2UXB L;  2EJM A;  2JA5 H;  3KLR A;  5HY6 A;  4DK6 C;  5IWA L;  1L0X B;  3TQY A;  4FYD A;  1CKN A;  4MNO A;  3S16 H;  3J81 E;  1HHV A;  2C35 B;  2QIL A;  1W2B A;  1TWA H;  1N32 L;  1Q90 A;  2AWO A;  4GZY C;  3R2T A;  2EXD A;  4C2M H;  2B2V A;  1DOL A;  1SNO A;  4ID6 A;  1O78 A;  3CXC A;  1TWG B;  4AIM A;  3CU7 A;  3ZJY C;  1LAC A;  3NXW A;  1CSP A;  2F0Q A;  1VQE A;  4EGV A;  3GTP H;  3RZO B;  1L1O C;  4IPC A;  2KJX A;  1IKM A;  3A5Z B;  2VW9 A;  1PH6 A;  4R9W A;  2IL8 A;  4JI3 Q;  3OMC A;  1A2T A;  2C9O A;  3FVQ A;  4A3D H;  3L9A X;  4HJ8 A;  2HCI A;  1WCM H;  4LF9 Q;  4A75 A;  1EYC A;  3HOZ B;  1UUP A;  1EWH A;  1E22 A;  2HHH L;  1HR0 W;  3HKZ E;  2B63 B;  4RGM A;  1I3Q H;  2OEO A;  3KF6 A;  2ENB A;  3QO2 A;  2NVQ B;  3VA5 A;  5FO9 B;  3J80 i;  3CRL C;  1NJI C;  4C3I B;  2VNU D;  5C0X J;  2CH4 W;  1RJT A;  2E74 C;  5C3E H;  1SE4 A;  3OWF A;  3DXJ C;  2CWA A;  2FMM A;  2A68 C;  3CCS A;  3C46 A;  2F0K A;  1SYG A;  3ULJ A;  3F2C A;  3SK6 A;  2ASB A;  2GA4 B;  1VMP A;  1ASZ A;  2SOB A;  2ALY B;  4TSS A;  2RKS A;  5I9O A;  2BE5 C;  4XYQ A;  3HOW H;  1Q82 C;  4A3L G;  1N33 L;  3S14 B;  3CPF A;  4RG1 A;  4A3F G;  2UXD L;  2N8N A;  4A93 B;  2JA7 H;  3Q24 A;  5M3M G;  4K0K Q;  3TP8 A;  4JCV E;  2F0S A;  4DUY L;  1I6H H;  3UDG A;  4DGZ A;  4XT3 B;  3CRK C;  4JV5 Q;  5G3L D;  2NN6 H;  5GAD C;  4JI4 L;  3P75 A;  4JI8 Q;  2A8V A;  1JCK B;  1Z6H A;  1SNP A;  3G71 A;  2F4V L;  1BBX C;  1TQO A;  1GUW A;  4BXX G;  1Q3L A;  1EYG A;  4NXM Q;  3FP9 A;  2PO4 A;  3K5O A;  4DV1 Q;  2N78 A;  4HIM A;  4C3H B;  5EKI A;  5C4X B;  2D2C C;  4BBR H;  1L0Y B;  4LFA Q;  3W1B A;  1F9Q A;  5EKL A;  5CBE E;  4IN3 A;  4I65 A;  3KDF A;  1ROD A;  4JI6 L;  1EY9 A;  2BA1 A;  4DN4 M;  4GKJ L;  4A3K G;  3CPW A;  4KI0 A;  1NTG A;  3BZC A;  1DOM A;  5JEA J;  3GTM B;  2F0U A;  2PMZ E;  4EVO A;  5KND A;  5EPL A;  1EL0 A;  4LAA A;  4DV7 L;  3A7A B;  2FXQ A;  3FHW A;  4EQ5 A;  5M3M B;  1NMG A;  3ERO A;  4A3I G;  5JPN C;  4DUZ L;  3PIO 3;  3AU7 A;  1HQM C;  1PXU A;  2B2T C;  2YYZ A;  3Q6S A;  2UXD Q;  1PYS B;  5J3B A;  4YCW A;  4B3S L;  1N36 L;  3ERS X;  1PFN A;  1SE2 A;  1PRT B;  2F1M A;  3GD7 A;  1V1Q A;  1V1P A;  5J39 A;  2R92 B;  5A35 A;  2YV5 A;  1SFO B;  3PIO A;  3S2D B;  3G4S A;  1TWH H;  5JEA G;  3CCJ A;  3NBH A;  2ES2 A;  4DAV A;  4N8F A;  1BXT A;  1SYC A;  2NZO A;  2WAQ B;  3I3C A;  1JWM D;  1TVX A;  4Q0F A;  4BY7 H;  5IIF A;  5K5P A;  1P8L A;  3T1H L;  2B2T A;  5D14 A;  2YTX A;  1PH7 A;  1UE7 A;  3GTK H;  1AFP A;  2PQA A;  1VS0 A;  1B9N A;  4JVZ A;  4LF4 Q;  2NN6 I;  3JAM i;  4LF8 L;  2BH8 A;  1K83 B;  4R4O A;  4A3J G;  1PTO F;  1Y8O B;  1PH9 A;  1BDO A;  4QUC A;  3V96 A;  3MFY A;  3VR6 A;  4HAE A;  2F0L A;  2NVY B;  4DV0 Q;  3L2P A;  3PO3 B;  3VDY A;  3C1F A;  1JC7 A;  1X55 A;  4IFD I;  4C1N I;  1VQ9 A;  3H0G B;  5M5X B;  4KD3 A;  2M9V A;  2E2J H;  3RZD B;  1KD1 C;  3RLO A;  1KNA A;  3FRP B;  4ME3 A;  1DCZ A;  4BY1 H;  1G2S A;  4A3F H;  3TRZ A;  2K33 A;  2UUC Q;  3D8G A;  1UAP A;  2JA7 B;  4XQN A;  3PF5 A;  1F9R A;  1U4P A;  4PMB A;  2F0T A;  3GTM H;  4JI2 Q;  4P2C B;  3G7L A;  4OHJ A;  4AQY L;  2AUK A;  1S5D D;  3MA2 B;  1VCI A;  2R61 A;  4X62 L;  1KC8 C;  1BBW A;  3D6C A;  1KDB A;  4BBS H;  2J4X A;  3DEO A;  1YNN D;  4A3J B;  3KFU A;  2NB0 A;  1PZI D;  2I5M X;  4QUF A;  2WIN B;  2FHT A;  3KOJ A;  1XNR Q;  4IJH A;  1G51 A;  1DXM A;  2D0P A;  1Y69 U;  2UXB Q;  1JR0 D;  1QWY A;  1F2M A;  1EQV A;  2EQS A;  3PO3 G;  2PI2 A;  3T4A C;  3A54 A;  3A5U A;  2B63 G;  3S15 B;  1F9P A;  1CZG A;  3HOU B;  4ILW A;  1TS3 A;  4HJ7 A;  2KEC A;  2A69 C;  3I4L A;  4OIK A;  2YU9 H;  3VA7 A;  3T53 B;  5ELC A;  4G7Z C;  3E0E A;  2I5L X;  3DEP A;  4DUZ Q;  4JI1 L;  4DK1 A;  1E1O A;  3GTL H;  1B44 D;  4GN3 B;  1BVS A;  2JA8 B;  2QKI C;  4X65 Q;  3MAQ A;  4FXD A;  5M5Y B;  2A69 D;  1KDA A;  3IL8 A;  4DAM A;  3PSI A;  4UP9 A;  1CUK A;  2UU9 L;  2EE1 A;  1CT1 D;  1TWA B;  2MQH A;  1ZYR D;  1TR5 A;  4GKK Q;  4OX9 Q;  4WRD A;  4DXG A;  1VF7 A;  3QG1 A;  4GLA C;  4XTC S;  3J81 j;  4K2K A;  5DM6 3;  2JJQ A;  2B3G A;  3GTO H;  2B39 A;  3HOY B;  2NVY H;  1I50 H;  1XMQ Q;  3BDL A;  3FPU B;  4AQY Q;  4LUO A;  3S1R H;  3PGZ A;  3EBE A;  1FGB D;  3RN2 A;  4IUP A;  2KCC A;  4LFC Q;  1HNX Q;  4ULL A;  1GHK A;  1B1Z A;  2K5W A;  4BY1 G;  5IGB A;  4FO2 A;  3M3Y H;  4F7X A;  1I3Q B;  2DJG C;  1PTO B;  4A3M G;  1U4M A;  1CZW A;  3I4M B;  4CKC A;  2IX3 A;  1YEZ A;  4JI6 Q;  3ND9 A;  3KK7 A;  4A3E G;  4IUU A;  2E5L L;  3MXN A;  4JBW A;  1Q86 C;  3NP8 A;  1BNZ A;  1BOS A;  3HGB A;  3RLN A;  2AMC B;  4KLK A;  1HFG A;  5EBD A;  3Q22 A;  3M9B A;  2JN4 A;  1V43 A;  3CCV A;  4X3U A;  5IYB H;  1OTC A;  1N8R C;  2IX1 A;  2R7Z G;  2B8F A;  3DWQ A;  2BH2 A;  2WV6 D;  1XTC D;  2NBF A;  1VQG A;  2A73 B;  4PZ7 A;  1K3R A;  1TWH B;  3HOY G;  1HJP A;  2KCM A;  3H6M A;  3H0G H;  4POG A;  5T1I A;  2MHV A;  2A6E C;  4OL7 A;  1TU2 B;  5IYB G;  1YJ9 A;  4JBM A;  3V05 A;  1E2V A;  2F0V A;  2R93 G;  4GNX B;  3M85 A;  1GUS A;  4WJ4 A;  1QZH A;  3H3V I;  4IFD G;  2R92 G;  4KHV A;  3E0J A;  1UWV A;  4IUT A;  3V2T A;  5KNB A;  3SK8 A;  2KEN A;  4JYA Q;  5IY0 A;  3PUY A;  1GKH A;  3SHL A;  3QOJ A;  3RR5 A;  2AUJ D;  3BDC A;  4IOA A;  4MZ9 A;  2CKZ B;  4IUQ A;  4HIO A;  3RN5 A;  2WAQ E;  1IHZ A;  1SE3 A;  2PZT A;  4ALP A;  2R93 H;  1YZ6 A;  3HOW G;  2RDG A;  5I2Y A;  2WII B;  4CBV A;  3J7Z C;  1JWS D;  3NPP A;  5J1Z A;  1HR0 L;  1N34 L;  2IHE A;  1NY4 A;  2VL6 A;  3CF5 A;  4LMQ D;  1ET9 A;  3OPO A;  4L6T B;  1FJG Q;  1XXG A;  2F0N A;  1YJW A;  1SN8 A;  3GV3 A;  4LF7 Q;  4C3H G;  1HNW L;  2Q2I A;  4QMG A;  3Q8D A;  1IBM Q;  1Q1B A;  1EZ6 A;  3D4D A;  1K9M C;  3CCL A;  3I4N G;  1Y1V G;  5IGF A;  3DUZ A;  2ZTE A;  3D4W A;  2BE5 D;  4DR3 Q;  1IBL Q;  4B9W A;  5CV4 A;  4DV4 Q;  1D5M C;  1LT5 D;  3PO3 H;  4JI2 L;  2F0O A;  4ZQ3 A;  4G7H C;  1E24 A;  2CQA A;  4YWK A;  1CKM A;  4FXK C;  2O5I C;  1FD7 D;  4F88 A;  1C0A A;  3SVM A;  3U58 A;  1E2W A;  1G8Z D;  3SE0 A;  2Y0S G;  2R7F A;  4RGT A;  2DUD A;  2HHH Q;  4L5S A;  2K52 A;  3I72 A;  1QOH A;  4FDB A;  1B4O A;  5COR A;  4OWW B;  1GHJ A;  4LW1 A;  1JJC B;  1EQQ A;  2E2H H;  4R1J A;  2WAC A;  2I5H A;  4C3H H;  1TT2 A;  3TEH B;  1C4Q A;  1WTP A;  1JOO A;  5IWA Q;  5FLX c;  1DM0 B;  2DY8 A;  4ZYS A;  1EU4 A;  5DNF A;  1PTO C;  3TP6 A;  5EJW A;  4JK1 C;  4DR1 Q;  1SNQ A;  2HUG A;  1T5X D;  1HNZ Q;  2XVS A;  1IKL A;  4ME5 A;  3FMC A;  1ENC A;  1B9M A;  2GVB A;  1HNW Q;  1IZ6 A;  1OXV A;  1UEB A;  5CR3 A;  1LAB A;  1YBY A;  4GS3 A;  2B2V C;  1YNJ D;  1SYE A;  3J80 L;  3GDE A;  1A2U A;  2L11 A;  1JB3 A;  3F2B A;  5DLQ E;  2JA6 G;  4PZ6 A;  5M3M H;  1SBB B;  2RSN A;  1V9P A;  4MN3 A;  1EOV A;  4RH6 A;  5EPJ A;  5C0X H;  4P75 A;  3SGI A;  1QE6 A;  4MTK A;  3ITP A;  3ERQ A;  4NPS A;  3S17 H;  2F0F A;  3AMU A;  1QJO A;  1FNU A;  2YU9 B;  1IYV A;  4QQB X;  2EYH A;  4R8N A;  1JIC A;  1ZYR C;  4NXM L;  1XNQ L;  4UAI A;  1PDQ A;  1B3A A;  2NZH A;  5C3E G;  4H13 C;  1PTO H;  1FNW A;  4A3C H;  2IY5 B;  5IP7 H;  3FEW X;  1RHP A;  1R4Q B;  1PLF A;  2K05 A;  1CQF A;  3ZYY X;  3I4M G;  3Q0A A;  1TKW B;  4P74 A;  3EJI A;  3I91 A;  3R8B A;  4MTN A;  2WKD A;  4HJA A;  1RTN A;  2FJ2 A;  4DUY Q;  3CAM A;  5EGT A;  3GTP B;  2E76 C;  2PCF B;  3BVZ A;  2HQE A;  1TWC B;  2I46 A;  4RCN A;  4KN7 C;  1LTG D;  4C2M B;  4HSV A;  1AE3 A;  4A93 H;  3KF8 A;  3PUZ A;  4A3F B;  4DNR B;  4JI4 Q;  4NP5 A;  3K7A B;  4DR3 L;  1IBL L;  1LO5 D;  4BY1 B;  1C8C A;  2Q2U A;  4MHE A;  3W2D A;  2JA7 G;  4M1U B;  3GTJ H;  3D4R A;  4K0K L;  2UUA Q;  5J22 A;  1PZK D;  1AZP A;  2A1A A;  2EY1 A;  3RUZ A;  1X3G A;  5JEA H;  3GO5 A;  3G6E A;  1Z47 A;  5LL6 S;  5KGU A;  5C3E B;  2A6E D;  5M5W H;  3NTI A;  5AJ3 L;  3SR1 A;  1SAP A;  4A93 G;  3E6Z X;  1EWC A;  4LFA L;  1C9O A;  1H9J A;  1VMC A;  2FMC A;  2QEJ C;  2KCN A;  2OQK A;  1XMQ L;  1QVF A;  5I6Y A;  2F4V Q;  3NK9 A;  2F3W A;  4J6H A;  5ELF A;  4LF8 Q;  1D5Z C;  3HOZ H;  1YJN A;  2KEE A;  2DGY A;  3J81 i;  4HTH A;  2MO0 A;  1UEA B;  1NE3 A;  3QB3 A;  3J7A V;  4A3I B;  2JEB I;  3I2Z A;  2M00 A;  1B2T A;  2K5N A;  5M3F B;  1HPC A;  1HZA A;  3I4O A;  5LMU Q;  3KBG A;  5ELO A;  3MEH A;  3J7A 5;  4RGO S;  3VR2 A;  1ENF A;  4O0A A;  3H15 A;  2OWO A;  3RZO H;  4KY6 A;  2CWP A;  2CHB D;  2MGS A;  5JVH 3;  3K5M A;  2K5D A;  4HMI A;  3EFX D;  3I56 A;  1STH A;  4X66 Q;  1MHW C;  2KQ3 A;  2K5H A;  3K58 A;  1D6E C;  1SMY D;  3VYS A;  4DV4 L;  2KHS A;  2K6A A;  1S4Z A;  5IT9 E;  2A6H C;  1JT8 A;  5M5X H;  4DFA A;  2EJG C;  2XRQ D;  3A8K E;  1FL0 A;  2WP8 J;  3K8A A;  4X3T A;  3PV0 A;  2JQO A;  1DGS A;  5FJ8 G;  1UE6 A;  2J0T D;  4KHP L;  5EQ0 A;  1CM9 A;  2N49 A;  4EQO A;  4HIK A;  2SDF A;  5HGQ A;  3EQL C;  1EY5 A;  1JE4 A;  1GO3 E;  4FF3 A;  1M1K C;  1G6P A;  1LM0 A;  2PW7 A;  2E2D C;  1EQR A;  3U50 C;  5L37 A;  1N34 Q;  4ABN A;  1TII D;  3MXG A;  2EJF C;  2DN8 A;  4YWL A;  1WOC A;  1O7Y A;  5C4X H;  1XTD A;  3MWY W;  1TXY A;  4HCE A;  1Q81 C;  1KDC A;  4L5Q A;  1A62 A;  4K6L A;  1PA6 A;  1VQD A;  1HTL D;  4HR7 B;  2QA4 A;  1G29 1;  1OXX K;  2R3Z A;  1VQP A;  4WOR A;  1SNC A;  3VYU A;  1WD1 A;  3E3X A;  3P20 A;  2DNE A;  2PNR C;  1J6Q A;  3W1G A;  4L8J A;  2UUB Q;  4KKS A;  3M4P A;  4X65 L;  3HOX H;  3QJY A;  4DF7 A;  5LL6 X;  1RD9 D;  3KLS A;  4A3B B;  1CTM A;  3BZD B;  1RKN A;  2K5Q A;  3U4V A;  3VR5 A;  3NBH B;  1X9N A;  1K28 A;  1PH2 A;  4BWG B;  3NUC A;  2IWH A;  2R7Z H;  3DLL A;  4HJ5 A;  1VQJ A;  3OTO Q;  4DA2 A;  4RWS C;  1STY A;  2VZA A;  4KHZ A;  1V1P B;  1EEF D;  4OEM B;  2MFI A;  3NHH A;  5GAH C;  2RA4 A;  1IYU A;  4LFB L;  1VQ8 A;  5KEE A;  2ZJR A;  4A3D G;  4NMZ A;  2EY5 A;  4LF6 L;  2MO1 A;  2B29 A;  3OW2 A;  2EYP A;  3F2U A;  1TWF B;  4LF5 Q;  3I4M H;  4IFD H;  3EN2 A;  4AH6 A;  4DKA C;  4DR1 L;  5NUC A;  1O7Z A;  1TY0 A;  1SYB A;  2VQE L;  5IYD G;  1HR0 Q;  3X3M A;  4A3B G;  4HED A;  4UPA A;  3Q23 A;  1ZXT A;  5BN4 A;  3JAM E;  2L1B A;  1PRT F;  4NXN L;  1K8M A;  1I4Q A;  1WYD A;  3AFQ A;  1VQ7 A;  3HOY H;  3GTO B;  4B3T Q;  3VYR A;  2Z6B A;  1OXU A;  4A4I A;  4JI0 L;  1D2B A;  4DV3 L;  2AQ1 B;  2VB3 X;  1X3F A;  2XNA C;  3A74 A;  2X6G A;  4FVM A;  1NMF A;  3LGJ A;  1EOT A;  3OIP A;  1BCP B;  1XX8 A;  1Q12 A;  1XJV A;  1XWE A;  3A8I E;  3M4Q A;  4L63 B;  1LV9 A;  4LF9 L;  3T16 A;  1HZB A;  5LMN Q;  2PQE A;  3BVG A;  5CV6 A;  4GOP A;  4DR7 L;  3CW2 C;  5D65 A;  2EY6 A;  4GOP B;  5FOB B;  4A3I H;  1VQH A;  2ZT9 C;  2QEX A;  4CDD C;  2AQ3 B;  3KLW A;  1HA5 A;  1NR4 A;  1NSN S;  5G3L F;  1L2F A;  1MGS A;  4UP8 A;  3R2I A;  2LKV A;  1SEB D;  2ZXP A;  3VR4 A;  1KXL A;  4LFB Q;  2B2Y C;  3HG9 A;  3OSO A;  4DR2 Q;  3CCE A;  1WI5 A;  1CI3 M;  1GD7 A;  2L55 A;  1A63 A;  2KCT A;  4R4Q A;  1A3U A;  4KV6 A;  3EVQ A;  2E2I H;  1BKB A;  1RDP D;  1SMX A;  3KDF B;  1EIF A;  4A3M B;  1EY6 A;  3C3L A;  1I50 B;  2X6L A;  2EYL A;  3HFZ B;  4GOP C;  2A74 C;  1I6V C;  2RQX A;  4B9X A;  1JWU D;  3FKI H;  3F8T A;  4XDX A;  1Q1E A;  2E5L Q;  4J1M A;  5FO8 B;  3TDQ A;  2D62 A;  1I94 Q;  1QB5 D;  3T56 B;  1M90 C;  4IUV A;  2EDG A;  2K03 A;  5A2Q L;  1KLG D;  1PTO D;  1S3O A;  4JI0 Q;  5M5Y H;  3P7J A;  4X3K A;  4IUR A;  2JA8 H;  4KMU C;  2F3V A;  5DAU A;  4JI8 L;  1PVO A;  1Q8I A;  4IPD A;  3KBX A;  3GTQ H;  5C4J B;  3FKI G;  2UUC L;  1ICF B;  4JC0 A;  2PW5 A;  1D5X C;  4L5R C;  3IAY A;  3UDI A;  2CW0 C;  5FO7 B;  4C56 C;  1WD0 A;  2XIW A;  2D9U A;  3AFP A;  3G6J B;  1U4R A;  2MPM A;  4DR7 Q;  3HOU H;  2BA0 A;  4X62 Q;  1GUT A;  2JA5 G;  3IRB A;  1CHP D;  3G48 A;  3L3O C;  5F2D A;  3HOV G;  1PZJ D;  3RD4 A;  1K83 H;  3U9S A;  3BVM A;  2FIN B;  2B2U A;  2DJF C;  2F3I A;  2F52 A;  2MJ8 A;  3S1N B;  4QL5 A;  1ENA A;  5FKA C;  1FNV A;  1BF4 A;  4R4C A;  4DV5 L;  1A6X A;  4OGQ C;  2WB1 B;  3GTK B;  3DM1 A;  2F0G A;  1FJG L;  1B8A A;  1ET6 A;  4LJZ C;  3BZK A;  3EA6 A;  1SRU A;  4DR6 L;  1KNE A;  1KL9 A;  2RSO A;  4FNF A;  3TME A;  1BO0 A;  5M9O A;  4XQQ A;  3S17 B;  4O1N A;  4K14 A;  3H94 A;  5FLX E;  1STN A;  5GAG C;  3U9O A;  4NXN Q;  3NWT A;  3HOV B;  3MXN B;  4V19 0;  4C3J H;  3BYY B;  2NZ1 D;  1I4H A;  5CV5 A;  2RHQ B;  5C44 H;  3A55 A;  2F0E A;  1AP0 A;  1WJJ A;  1WTH A;  1SFO H;  4IJL A;  5C5M A;  1N33 Q;  1A0I A;  5ELE A;  5GRO A;  1D7Q A;  4K2L A;  4GN5 A;  1Y1V B;  4GNX A;  4K8I A;  5FJ8 H;  1JE5 A;  1I4G A;  3I4N H;  2L12 A;  4IQZ A;  2CH4 A;  4I7A A;  4POF A;  1BCP D;  1RL2 A;  3M7N A;  3J80 c;  2JE6 I;  2Q8R E;  3CQZ B;  3T1H Q;  3PO2 H;  2K28 A;  4LUV A;  4LNQ A;  3ULP A;  4B3M L;  1H9S A;  2NVT B;  5EPK A;  1V8Q A;  4LF5 L;  1VQB A;  2KVM A;  4WJW A;  1PV4 A;  1M4V A;  2K32 A;  1HRJ A;  3LWE A;  1JQY D;  1YHB A;  1MD2 D;  2EZV A;  1R9T B;  3MC0 B;  2F03 A;  4YIJ A;  3OYY A;  2CFM A;  5BR8 L;  4DR6 Q;  4A3G G;  1LUZ A;  4M8A A;  3CQZ H;  3L0O A;  5EAY A;  4ZK9 B;  4P72 A;  3WDN A;  2ZXO A;  1AH9 A;  1Y1W G;  1M8A A;  4DNI A;  2BCO A; 
#chains in the Genus database with same CATH homology
 4FF4 A;  1PFB A;  2PZU A;  4OIJ A;  3NQT A;  3M7G A;  2K01 A;  1AW7 A;  1DZ1 A;  3R93 A;  2A5H A;  4KKT A;  1I4P A;  2ID0 A;  1EQT A;  1B50 A;  1SSO A;  3GTL B;  2EYF A;  1EY0 A;  1VDZ A;  2R6G A;  5IGD A;  1CFM A;  2JEA I;  5C0X G;  1G2T A;  3S9W A;  4ZUJ A;  2IT1 A;  4XQJ A;  4B08 A;  2NN6 G;  3K5L A;  1HUN A;  3W3A A;  1S5C D;  2Q8I B;  1ESF A;  1ESR A;  2PZW A;  4ODG A;  4ZUI A;  1SJH D;  1H9R A;  4TKO B;  3A7L A;  5JAV A;  4A3D B;  4BA2 I;  1BQQ T;  1A3V A;  4F87 A;  4C1N K;  3OIQ A;  1AN8 A;  1HQR D;  2QF7 A;  5CV9 A;  2F0J A;  1BUV T;  2SEB D;  1EY4 A;  1MBY A;  1I6H B;  1LTB D;  1U4L A;  4NDX A;  4ZLT F;  3HZX A;  4H44 C;  3HOW B;  1LT4 D;  1TS5 A;  5KYI A;  3I90 A;  3X3N A;  3S16 B;  2O5J C;  3C1E A;  2EXZ A;  1FYC A;  1ZEQ X;  3RLF A;  1EY8 A;  3N52 A;  4FF1 A;  4FXG C;  1SND A;  1DYQ A;  2J7Z A;  1I4X A;  2PYK A;  4H7B A;  4RAU C;  4DXF A;  3LWU A;  3TN2 A;  1WTW A;  1KAB A;  4IZ8 A;  3P1H A;  3A8J E;  1LTT D;  4HMJ A;  3KLS X;  2SNS A;  1EU3 A;  3OW7 A;  5IGC A;  1DOK A;  3J7A F;  5COY A;  4I7Z C;  1U9R A;  4BA1 I;  1A15 A;  3TSS A;  4RHS A;  2G9H D;  4CKE A;  1T5E A;  2R7Z B;  1OXT A;  3FPP A;  5K36 G;  1AEX A;  3MXU A;  4CJ1 B;  3IFT A;  4CJ2 C;  1IL8 A;  2L9H A;  1NCV A;  3DHQ A;  1MSH A;  3MVV A;  2BOS A;  2ICI A;  1JOK A;  3PUX A;  3LX0 A;  1WTR A;  1LTA D;  5TSS A;  1MSG A;  1QG7 A;  3MTS A;  4UDU C;  1F77 A;  3H91 A;  3TP5 A;  1F2Y A;  1NAP A;  1FR3 A;  5EBC A;  2BDO A;  3WOE A;  2N55 A;  1Y1W B;  4RKL A;  2KA7 A;  1H9M A;  4Y7N B;  4FP5 D;  2HDL A;  1SYF A;  1EYD A;  5I6W A;  4S3S A;  1SMY C;  1NUC A;  3T13 A;  2O4X A;  3NBI A;  5FLX L;  2RDH A;  3BYT B;  2XSC A;  3H09 A;  1ONL A;  3M4Y A;  2XN9 C;  4EQP A;  2OF1 A;  1EIG A;  4IUN A;  2B2W C;  4XIG S;  5D3I B;  1X32 A;  3PMF A;  1ML0 D;  2EY2 A;  3S1Q B;  1LT3 D;  4KKU A;  2CVR A;  1W6K A;  4EQN A;  1O7L A;  2Z4I A;  1BR9 A;  2F0H A;  3VR3 A;  2B2Y A;  1WTV A;  2LFN A;  1KAA A;  4N9P A;  5C4Z A;  1WTO A;  1QCB D;  1HA6 A;  2XWJ B;  3S1M B;  1GOZ A;  3CHB D;  2B8G A;  2EYO A;  1S5B D;  2N88 A;  2RDF A;  5JJZ A;  5C3W A;  1SYD A;  1WCM B;  2XRS D;  2NYZ D;  2K1B A;  1SNM A;  3GTJ B;  3NTH A;  3K57 A;  3L7Z C;  4RCO A;  5AFW A;  2Z8L A;  4H0L C;  1I4R A;  2QCP X;  1GXD C;  4XYO A;  4CHT B;  5K36 H;  2NTT A;  4C3J B;  1STG A;  3J7Y W;  1AZQ A;  1H9S B;  1TY2 A;  5JOB A;  2WKC A;  2SNM A;  3J80 E;  3PUV A;  4OO1 I;  4NKL A;  1A3T A;  1E0B A;  4QF4 A;  2B2U C;  1ILP A;  4XXE A;  3BDO A;  5E4X A;  4AYB B;  1GUO A;  4RGN A;  2L5T A;  4KY5 A;  5JVG 3;  2EOT A;  4CGY B;  5KRU A;  4U67 3;  4KN4 C;  4A3K B;  4TQU S;  5C0X I;  1PMR A;  3QOL A;  2LY7 A;  1F2L A;  2ICE C;  4X3S A;  4KY7 A;  1CA6 A;  2BDN A;  1JOQ A;  1H9K A;  2A68 D;  4K6D A;  1PRT C;  4RKB A;  2F0M A;  2JXM B;  1VF5 C;  3SXH A;  2JYO A;  2E2J B;  1B53 A;  1SDF A;  1ICW A;  3DMU A;  5IT9 L;  1CK1 A;  5CYU A;  5I4D A;  3S2H B;  5KNC A;  2F0I A;  3AB9 A;  1X3Q A;  2AWN A;  2VXW A;  4K5W A;  2EVB A;  2OT2 A;  2LMC B;  1CA5 A;  4PV1 C;  5CMD A;  3D3R A;  4RFB A;  4PMC A;  4U68 A;  4BBS B;  5CC4 A;  2MUY A;  3QIA A;  1LTR D;  1WVL A;  1BCP F;  3ND8 A;  3PIP 3;  4C3I G;  1D1I A;  2A6H D;  3K59 A;  1D1K A;  3LNN A;  3PO2 B;  1XYI A;  4OO1 H;  3SEB A;  2DY7 A;  4ZAI A;  4FF2 A;  2LS0 1;  1LTI D;  2X69 A;  2JA6 B;  1R4P B;  1ZKO A;  5DM7 3;  3GP7 A;  3HOX B;  3MXP A;  5C44 B;  2NVX B;  5C6A A;  3N6R A;  2IJ0 A;  4TRD A;  4A3G B;  3BG3 A;  4ZKB B;  2FFK B;  2JSO A;  3H3V C;  3GV6 A;  5E3F A;  3A56 A;  3SDZ A;  5FK9 C;  5E4W C;  3I73 A;  5C3X A;  4PQX A;  4BS9 A;  2VB2 X;  4KJO A;  1Y8P B;  1W6J A;  1CHQ D;  3HRZ C;  4QCL A;  4R8I A;  1STB A;  1OO9 B;  2HDM A;  3I4N B;  3I70 A;  1HTP A;  2H4O A;  1RF2 D;  4Q5V A;  4IFD J;  3J81 L;  1DD2 A;  2KED A;  4PMW A;  1OXS C;  3HS0 C;  5HGT A;  1QNU A;  2PPB C;  5CV8 A;  2TSS A;  3IFD A;  3FDT A;  1HFN A;  1QNK A;  2IX0 A;  2KUM A;  5DEH A;  3C2P A;  3DWA A;  1G91 A;  2PMZ B;  3SK4 A;  2QDB A;  2NUC A;  5A2Q E;  4G7O C;  2H1E A;  3BS1 A;  5T1G A;  5JPM C;  1Y8N B;  3UI2 A;  4IAL A;  2NWG A;  5M5W B;  2EYJ A;  1STA A;  4Z9C B;  1S5F D;  5D3D A;  3GTQ B;  1J9O A;  2EYM A;  2VUM B;  2NTS A;  1TS4 A;  4N9T A;  3DWP A;  1KTK A;  4KK7 A;  1PRT D;  1EFI D;  4ZRZ A;  1QIL A;  1CQV A;  3TZD A;  1EIH A;  1LT6 D;  2C5C A;  2IW3 A;  3HEJ A;  1LLR D;  2Q8T A;  5BN3 A;  3D31 A;  1YNJ C;  5IGG A;  1Z7T A;  2K7V A;  4DAY A;  4O42 A;  2D5D A;  3M3Y B;  3TZU A;  5I9P A;  5HUR A;  3S1R B;  2KOL A;  3JAM L;  1RTO A;  5IOC A;  4ZKC B;  4OO1 G;  2ZXR A;  2JP1 A;  2Y0S B;  3HKZ B;  4XT1 B;  3TP7 A;  3M4O B;  5CBA E;  2CW0 D;  4V0B A;  4A3E B;  1STE A;  2O2L D;  1BCP C;  1X3P A;  3KUP A;  5CV7 A;  2Z1C A;  4CKB A;  2V4D A;  3OOC A;  3T51 B;  2F0D A;  3CKI B;  2HCC A;  3VYT A;  1ILQ A;  3MFG A;  3R3O A;  3FKI B;  3MHB A;  1WTX A;  4K5V A;  2E75 C;  1LTS D;  2XWB B;  3NWS A;  2JA5 B;  1K8O A;  1GJX A;  1SJE D;  4KD4 A;  5ISR A;  5C4H A;  3NQI A;  3I8Z A;  1GUG A;  2TMP A;  3IKJ A;  1HUM A;  1II3 A;  3SK5 A;  2R93 B;  1DON A;  2E2H B;  1EEI D;  2OXP A;  3QWN A;  4QIW B;  1WTQ A;  1V1O A;  4C3J G;  4BY7 B;  4DK0 A;  2L0C A;  1DJR D;  2RBM A;  5ELD A;  1J8I A;  5I2X A;  1JOR A;  3D6W A;  3WOF A;  3PUW A;  2EPB A;  2L4N A;  2F4I A;  1MI2 A;  3RMH A;  3GTG B;  4HCS A;  3NSW A;  4LK1 C;  1GUN A;  4G4K A;  3TBI B;  4PNY A;  2M2L A;  5C5L A;  2RVL A;  3OWE B;  1YNN C;  4WFN 3;  2B2W A;  1PYW D;  1EYA A;  4K8J A;  2DNC A;  3K5N A;  5LHY 1;  1KLU D;  1NR2 A;  5IGE A;  4DU9 A;  3K6O A;  5ELB A;  3E5S A;  4K5X A;  3GQB A;  4F8M A;  2MP1 A;  4RA8 A;  3O13 A;  3MZ5 A;  3URY A;  5EKK A;  1EY7 A;  2Z4H A;  5E1F A;  4CJ0 B;  1F2Z A;  5KYL A;  1RCV D;  4HN7 A;  3NE5 B;  3K0Y A;  4J8Q A;  1SXT A;  1PFM A;  1TS2 A;  3OMG A;  1C48 A;  4KTA A;  1S5E D;  2I07 B;  1HXY D;  2IPK D;  4DNT B;  1F9S A;  4G57 A;  4MIU A;  1UNS A;  5IOD A;  1G6Z A;  2F0W A;  1IW7 C;  3NTK A;  1EZ8 A;  4NW2 A;  2F0P A;  3HP3 A;  5CGK A;  3ONA B;  2AQ2 B;  5BN5 A;  1O80 A;  4BBR B;  2E2I B;  4KJN A;  4RHR A;  3OHX C;  1IW7 D;  1E2Z A;  1HCZ A;  5KIX A;  2K04 A;  4QB4 A;  2G9D A;  4DAP A;  4HSP A;  4E6I A;  2EJM A;  3KLR A;  1L0X B;  4FYD A;  3J81 E;  1HHV A;  2QIL A;  1Q90 A;  2AWO A;  4GZY C;  3R2T A;  2B2V A;  1DOL A;  1SNO A;  4ID6 A;  1O78 A;  1TWG B;  3CU7 A;  1LAC A;  3NXW A;  2F0Q A;  4EGV A;  3RZO B;  1IKM A;  2KJX A;  4R9W A;  2IL8 A;  3OMC A;  1A2T A;  2C9O A;  3FVQ A;  3L9A X;  2HCI A;  1EYC A;  3HOZ B;  1UUP A;  1EWH A;  2B63 B;  4RGM A;  2OEO A;  2ENB A;  3QO2 A;  2NVQ B;  3VA5 A;  5FO9 B;  3CRL C;  4C3I B;  2VNU D;  5C0X J;  1RJT A;  2E74 C;  1SE4 A;  3OWF A;  3DXJ C;  2FMM A;  3C46 A;  2A68 C;  2F0K A;  1SYG A;  3SK6 A;  2GA4 B;  1VMP A;  2SOB A;  4TSS A;  2RKS A;  5I9O A;  2BE5 C;  4XYQ A;  3S14 B;  4A93 B;  3Q24 A;  3TP8 A;  2F0S A;  4DGZ A;  4XT3 B;  3CRK C;  5G3L D;  2NN6 H;  3P75 A;  1JCK B;  1Z6H A;  1SNP A;  1BBX C;  1TQO A;  1GUW A;  1Q3L A;  2PO4 A;  3K5O A;  4C3H B;  5EKI A;  5C4X B;  2D2C C;  1L0Y B;  1F9Q A;  5EKL A;  5CBE E;  4IN3 A;  4I65 A;  1ROD A;  1EY9 A;  2BA1 A;  4DN4 M;  4KI0 A;  1DOM A;  5JEA J;  3GTM B;  2F0U A;  4EVO A;  5KND A;  5EPL A;  1EL0 A;  4LAA A;  3A7A B;  5M3M B;  3ERO A;  5JPN C;  3PIO 3;  3AU7 A;  1HQM C;  1PXU A;  2B2T C;  2YYZ A;  3Q6S A;  1PFN A;  1SE2 A;  1PRT B;  2F1M A;  3GD7 A;  1V1P A;  5J39 A;  2R92 B;  5A35 A;  1SFO B;  3S2D B;  5JEA G;  3NBH A;  4DAV A;  1BXT A;  1SYC A;  2WAQ B;  3I3C A;  1JWM D;  1TVX A;  4Q0F A;  5IIF A;  5K5P A;  2B2T A;  5D14 A;  1AFP A;  1B9N A;  2NN6 I;  1K83 B;  1PTO F;  1Y8O B;  1BDO A;  4QUC A;  3V96 A;  3MFY A;  3VR6 A;  4HAE A;  2F0L A;  2NVY B;  3PO3 B;  3C1F A;  1JC7 A;  4IFD I;  4C1N I;  3H0G B;  5M5X B;  4KD3 A;  2M9V A;  3RZD B;  1KNA A;  3FRP B;  1DCZ A;  1G2S A;  2K33 A;  3D8G A;  1UAP A;  2JA7 B;  4XQN A;  1F9R A;  1U4P A;  4PMB A;  2F0T A;  4P2C B;  3G7L A;  4OHJ A;  2AUK A;  1S5D D;  3MA2 B;  1VCI A;  2R61 A;  3D6C A;  1KDB A;  2J4X A;  3DEO A;  1YNN D;  4A3J B;  2NB0 A;  1PZI D;  4QUF A;  2WIN B;  2FHT A;  1DXM A;  1Y69 U;  1JR0 D;  1QWY A;  1F2M A;  1EQV A;  3T4A C;  3A54 A;  3S15 B;  1F9P A;  1CZG A;  3HOU B;  4ILW A;  1TS3 A;  2KEC A;  2A69 C;  3I4L A;  4OIK A;  3VA7 A;  3T53 B;  5ELC A;  4G7Z C;  3DEP A;  4DK1 A;  1B44 D;  2JA8 B;  2QKI C;  3MAQ A;  4FXD A;  5M5Y B;  2A69 D;  1KDA A;  3IL8 A;  2EE1 A;  1CT1 D;  1TWA B;  1ZYR D;  1TR5 A;  4WRD A;  4DXG A;  1VF7 A;  3QG1 A;  4XTC S;  4K2K A;  5DM6 3;  3HOY B;  2B39 A;  3BDL A;  3FPU B;  1FGB D;  4IUP A;  2KCC A;  4ULL A;  1GHK A;  1B1Z A;  2K5W A;  5IGB A;  4FO2 A;  4F7X A;  1I3Q B;  1PTO B;  1U4M A;  1CZW A;  3I4M B;  4CKC A;  2IX3 A;  3ND9 A;  3KK7 A;  4IUU A;  3MXN A;  4JBW A;  3NP8 A;  1BNZ A;  1BOS A;  3HGB A;  1HFG A;  5EBD A;  3Q22 A;  1V43 A;  4X3U A;  2IX1 A;  2B8F A;  3DWQ A;  2WV6 D;  1XTC D;  2NBF A;  2A73 B;  1TWH B;  3H6M A;  5T1I A;  2MHV A;  2A6E C;  4OL7 A;  1TU2 B;  3V05 A;  1E2V A;  2F0V A;  3M85 A;  1GUS A;  4IFD G;  4KHV A;  3E0J A;  4IUT A;  3V2T A;  5KNB A;  3SK8 A;  3PUY A;  3SHL A;  3QOJ A;  2AUJ D;  3BDC A;  4IUQ A;  1IHZ A;  1SE3 A;  2PZT A;  2RDG A;  5I2Y A;  2WII B;  4CBV A;  1JWS D;  3NPP A;  5J1Z A;  4LMQ D;  1ET9 A;  3OPO A;  4L6T B;  1XXG A;  2F0N A;  3GV3 A;  4C3H G;  4QMG A;  1Q1B A;  1EZ6 A;  3D4D A;  5IGF A;  3DUZ A;  3D4W A;  2BE5 D;  4B9W A;  5CV4 A;  1D5M C;  1LT5 D;  2F0O A;  4ZQ3 A;  4G7H C;  2CQA A;  4FXK C;  2O5I C;  1FD7 D;  4F88 A;  3SVM A;  1E2W A;  1G8Z D;  3SE0 A;  4RGT A;  1QOH A;  3I72 A;  1B4O A;  5COR A;  1GHJ A;  2WAC A;  1TT2 A;  1C4Q A;  1WTP A;  1JOO A;  1DM0 B;  2DY8 A;  4ZYS A;  1EU4 A;  5DNF A;  1PTO C;  3TP6 A;  5EJW A;  4JK1 C;  1SNQ A;  2HUG A;  1T5X D;  2XVS A;  1IKL A;  4ME5 A;  3FMC A;  1ENC A;  1B9M A;  1OXV A;  5CR3 A;  1LAB A;  2B2V C;  1YNJ D;  1SYE A;  3J80 L;  1A2U A;  2L11 A;  1JB3 A;  1SBB B;  2RSN A;  4MN3 A;  4RH6 A;  5EPJ A;  5C0X H;  1QE6 A;  3ITP A;  3ERQ A;  3AMU A;  2F0F A;  1QJO A;  1FNU A;  2YU9 B;  1IYV A;  2EYH A;  4R8N A;  1JIC A;  1ZYR C;  4UAI A;  1PDQ A;  1B3A A;  4H13 C;  1PTO H;  1FNW A;  3FEW X;  1RHP A;  1R4Q B;  1PLF A;  2K05 A;  1CQF A;  3ZYY X;  3Q0A A;  1TKW B;  3EJI A;  3I91 A;  3R8B A;  2WKD A;  1RTN A;  2FJ2 A;  5EGT A;  3GTP B;  2E76 C;  2PCF B;  3BVZ A;  2HQE A;  1TWC B;  2I46 A;  4RCN A;  4KN7 C;  1LTG D;  4C2M B;  4HSV A;  3KF8 A;  3PUZ A;  4A3F B;  4DNR B;  4NP5 A;  3K7A B;  1LO5 D;  4BY1 B;  1C8C A;  4MHE A;  3W2D A;  4M1U B;  3D4R A;  5J22 A;  1PZK D;  1AZP A;  2EY1 A;  3RUZ A;  5JEA H;  3GO5 A;  1Z47 A;  5LL6 S;  5KGU A;  5C3E B;  2A6E D;  3NTI A;  3SR1 A;  1SAP A;  3E6Z X;  1EWC A;  1H9J A;  1VMC A;  2FMC A;  2QEJ C;  2KCN A;  5I6Y A;  3NK9 A;  2F3W A;  4J6H A;  5ELF A;  1D5Z C;  2KEE A;  4HTH A;  1UEA B;  3QB3 A;  3J7A V;  4A3I B;  2JEB I;  2M00 A;  1B2T A;  5M3F B;  1HPC A;  3KBG A;  3MEH A;  4RGO S;  3VR2 A;  1ENF A;  4KY6 A;  2CHB D;  2MGS A;  5JVH 3;  3K5M A;  2K5D A;  4HMI A;  3EFX D;  1STH A;  2KQ3 A;  3K58 A;  1D6E C;  1SMY D;  3VYS A;  2KHS A;  2K6A A;  1S4Z A;  5IT9 E;  2A6H C;  4DFA A;  2EJG C;  2XRQ D;  3A8K E;  2WP8 J;  4X3T A;  3PV0 A;  2J0T D;  5EQ0 A;  1CM9 A;  4EQO A;  2SDF A;  3EQL C;  1EY5 A;  1JE4 A;  4FF3 A;  2PW7 A;  2E2D C;  4ABN A;  1TII D;  3MXG A;  2EJF C;  2DN8 A;  1O7Y A;  3MWY W;  4HCE A;  1KDC A;  4K6L A;  1HTL D;  4HR7 B;  1G29 1;  1OXX K;  2R3Z A;  4WOR A;  1SNC A;  3VYU A;  1WD1 A;  3P20 A;  2DNE A;  2PNR C;  4L8J A;  4KKS A;  3QJY A;  4DF7 A;  5LL6 X;  1RD9 D;  3KLS A;  4A3B B;  1CTM A;  3BZD B;  1RKN A;  2K5Q A;  3VR5 A;  4BWG B;  3NUC A;  2IWH A;  4DA2 A;  4RWS C;  1STY A;  4KHZ A;  1V1P B;  1EEF D;  3NHH A;  2RA4 A;  1IYU A;  5KEE A;  4NMZ A;  2EY5 A;  2EYP A;  3F2U A;  1TWF B;  4IFD H;  5NUC A;  1O7Z A;  1TY0 A;  1SYB A;  3X3M A;  4HED A;  3Q23 A;  1ZXT A;  5BN4 A;  3JAM E;  2L1B A;  1PRT F;  1K8M A;  1I4Q A;  3GTO B;  3VYR A;  1OXU A;  1D2B A;  2AQ1 B;  2VB3 X;  2XNA C;  2X6G A;  4FVM A;  1EOT A;  3OIP A;  1BCP B;  1XX8 A;  1Q12 A;  1XWE A;  3A8I E;  4L63 B;  1LV9 A;  3T16 A;  2PQE A;  3BVG A;  5CV6 A;  5D65 A;  2EY6 A;  5FOB B;  2ZT9 C;  2AQ3 B;  1HA5 A;  1NR4 A;  1NSN S;  5G3L F;  1MGS A;  3R2I A;  2LKV A;  1SEB D;  2ZXP A;  3VR4 A;  2B2Y C;  3HG9 A;  3OSO A;  1CI3 M;  2L55 A;  1A3U A;  4KV6 A;  3EVQ A;  1RDP D;  4A3M B;  1EY6 A;  3C3L A;  1I50 B;  2X6L A;  2EYL A;  2A74 C;  1I6V C;  2RQX A;  4B9X A;  1JWU D;  4XDX A;  1Q1E A;  4J1M A;  5FO8 B;  3TDQ A;  2D62 A;  1QB5 D;  3T56 B;  4IUV A;  2EDG A;  2K03 A;  5A2Q L;  1KLG D;  1PTO D;  3P7J A;  4X3K A;  4IUR A;  4KMU C;  2F3V A;  5DAU A;  1Q8I A;  3KBX A;  5C4J B;  2PW5 A;  1D5X C;  3IAY A;  2CW0 C;  5FO7 B;  4C56 C;  1WD0 A;  2XIW A;  2D9U A;  3G6J B;  1U4R A;  2MPM A;  2BA0 A;  1GUT A;  5F2D A;  1CHP D;  3L3O C;  1PZJ D;  3RD4 A;  3U9S A;  3BVM A;  2FIN B;  2B2U A;  2MJ8 A;  3S1N B;  1ENA A;  5FKA C;  1FNV A;  1BF4 A;  1A6X A;  4OGQ C;  2WB1 B;  3GTK B;  3DM1 A;  2F0G A;  1ET6 A;  4LJZ C;  3EA6 A;  1KNE A;  2RSO A;  4FNF A;  3TME A;  1BO0 A;  5M9O A;  4XQQ A;  3S17 B;  4O1N A;  4K14 A;  3H94 A;  5FLX E;  1STN A;  3U9O A;  3NWT A;  3HOV B;  4V19 0;  3BYY B;  2NZ1 D;  1I4H A;  5CV5 A;  3A55 A;  2F0E A;  1AP0 A;  5C5M A;  5ELE A;  4K2L A;  1Y1V B;  4K8I A;  1I4G A;  2L12 A;  4IQZ A;  1BCP D;  3M7N A;  2JE6 I;  2Q8R E;  3CQZ B;  2K28 A;  1H9S A;  2NVT B;  5EPK A;  1V8Q A;  2KVM A;  4WJW A;  1M4V A;  2K32 A;  1HRJ A;  3LWE A;  1JQY D;  1MD2 D;  2EZV A;  1R9T B;  3MC0 B;  2F03 A;  4YIJ A;  4M8A A;  4ZK9 B;  3WDN A;  2ZXO A;  1M8A A;  2BCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...