2PW7A

Crystal structure of staphylococcal nuclease variant v66y/p117g/h124l/s128a at 100k
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
130
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKVEKYGPEASAFTKKMYENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystallographic study of hydration of an internal cavity in engineered proteins with buried polar or ionizable groups.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 130
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2pw7A00
3BDLA 1TQOA 4RKLA 4ZQ3A 1A2TA 4HTHA 4ID6A 3SXHA 5IGBA 5K5PA 5KRUA 1SNPA 1EY7A 2OF1A 4K5VA 3OSOA 2F0VA 4ZUJA 1A3VA 3NQTA 4TRDA 1STYA 1F2MA 1EZ6A 2HQEA 2NUCA 4QF4A 4NP5A 1STGA 3VA5A 3MXPA 5C4ZA 4YIJA 1JOOA 2F0DA 4IALA 1EYDA 4K2LA 1EY9A 5KYLA 5HGTA 3TP6A 4EQOA 1JOQA 2F0JA 2EY1A 3D8GA 4OL7A 4HMJA 5JOBA 3EJIA 3DHQA 3EVQA 1A3UA 3H6MA 1SNMA 3MVVA 5CV6A 4E6IA 3OMGA 5CC4A 4B9WA 2F0IA 4HMIA 4KHVA 1ENAA 5CV4A 2RKSA 1AEXA 4IUNA 4RKBA 4KY6A 5DEHA 1EY5A 2OEOA 5EKKA 4KY5A 1EYCA 4DFAA 5KGUA 5CGKA 1JORA 2EYOA 3HEJA 5I9PA 4ODGA 2EYHA 4WORA 1SYGA 2PW5A 2EYFA 2EXZA 5KIXA 2PZUA 3NP8A 1A3TA 1EY0A 2EYLA 2PW7A 1NUCA 1II3A 3EROA 4K8IA 4N9PA 3QOLA 4MIUA 4K8JA 4PMBA 2F0QA 3D4WA 4R8NA 3SK6A 2F3VA 3E5SA 1SYFA 4F7XA 5DAUA 1JOKA 5IGEA 2EYJA 2KHSA 4ZUIA 1KABA 3TP5A 4KJOA 3SHLA 5C3WA 3D4DA 3TP7A 2F0OA 3OMCA 5C4HA 5C5MA 5KEEA 3MHBA 3C1FA 5M9OA 1RKNA 5IODA 5EKLA 1NSNS 3DMUA 3NHHA 4NKLA 5HURA 2EY2A 3P75A 2PYKA 4J6HA 5IOCA 5CV8A 5J22A 3SR1A 2F0PA 3BDCA 4B9XA 1SNCA 2QDBA 3S9WA 4LAAA 1SNOA 3NK9A 3OWFA 2F0HA 4DGZA 3ERQA 2F0WA 2F0SA 2F0NA 5E3FA 2F0EA 5KYIA 2KQ3A 1EY6A 1SNDA 1SNQA 4KV6A 1F2ZA 2LKVA 4NDXA 3P1HA 2F0LA 3SK5A 2OXPA 2PZWA 3LX0A 1EQVA 4KY7A 4NMZA 4PNYA 1STBA 2EY6A 2F0KA 5E1FA 4I65A 3SK8A 5J1ZA 1KDBA 2EY5A 1IHZA 5JAVA 4N9TA 1EY8A 5IGDA 5C6AA 1A2UA 4F8MA 5EGTA 4G57A 5CV9A 3T13A 5IGGA 1STAA 1U9RA 4IZ8A 4KD4A 2RBMA 3RUZA 2O4XA 3MZ5A 4K6DA 4EQNA 4QB4A 2F0UA 3ITPA 1SYBA 5CV5A 4EVOA 4ME5A 5I6YA 1F2YA 3HZXA 2F0TA 3R3OA 4KJNA 2F0GA 3V2TA 2ENBA 1STHA 5IGCA 2RDFA 4KD3A 4EQPA 3QOJA 2SOBA 5NUCA 4PMCA 5C5LA 4S3SA 1EYAA 5C3XA 5I9OA 3D6CA 5CV7A 3NXWA 4KTAA 2WACA 2F0FA 3NUCA 5IIFA 5IGFA 3TMEA 4WRDA 4K14A 1KDAA 3PMFA 4K2KA 3TP8A 5CR3A 1KDCA 1EY4A 5F2DA 1SYEA 2F3WA 1ENCA 2SNMA 2SNSA 3QB3A 1TT2A 4K5XA 4DF7A 5I6WA 5ISRA 3U9OA 4DU9A 2F0MA 1TR5A 3C1EA 1SYCA 5J39A 1KAAA 4K5WA 4J1MA 2M00A 2EYPA 2PZTA 4QMGA 1EZ8A 1STNA 2EYMA 3SK4A 2PQEA 3T16A 3MEHA 1SYDA 4H7BA
chains in the Genus database with same CATH superfamily
2ID0A 2RSOA 1L0WA 4PV1C 1ZEQX 1JJ2A 4J8QA 4FXKC 4HJ9A 1MSGA 1IZ6A 4NP5A 3J81j 1VQ7A 4QQBX 1A0IA 4E6IA 1BCPD 3PUZA 4IUUA 4RKBA 5M3MH 1GXDC 1U4PA 4L63B 1EUJA 5FLXL 4LNQA 5I9PA 2DNCA 1I4XA 1IYVA 2BH8A 1TWHB 3M9BA 4LF9Q 2WAQG 4MIUA 1PFBA 4JI7Q 4R8NA 3LGJA 4RHRA 1N9WA 1YJ9A 3U4ZA 5IGEA 2F0OA 5KEEA 1XYIA 1H9SB 1NSNS 1LM0A 3Q0AA 3NWSA 1HXYD 2CQOA 4A3CH 1KXLA 1EL0A 3UDFA 3NK9A 3OWFA 5E3FA 3N52A 3GTQH 3AB9A 3CHBD 3L2PA 4ME3A 1HTPA 1H9JA 1HNZQ 4RFBA 1WTVA 2GA4B 1YNJD 1QUQB 3A56A 1VQDA 4U68A 1RIPA 1YJNA 1JC7A 3J81c 1I6VC 3S15H 3FDTA 2HIVA 4C56C 3J80c 4ILWA 4I7ZC 5KNBA 2EDGA 1PH2A 2B2UC 1S5CD 4DR6L 4CJ0B 1LT3D 4OWXB 2E2IH 4JBKA 1EYAA 3Q6SA 2UUCL 3D6CA 4PZ8A 1UWVA 4CKCA 3DEPA 3VA7A 2A73B 3T56B 1B3AA 2Z6BA 1E2WA 3CPFA 3A55A 4EQ5A 1OXXK 1U4LA 1E2ZA 1PFMA 2F0MA 5LMNQ 4OO1G 1SYCA 4RGMA 2PZTA 2VQFL 1GJXA 3MXNB 3K0XA 1CA6A 4BXXG 4H02A 3SXHA 1W6KA 5J3BA 2B63G 2M9VA 4K5VA 3MC0B 4C2MB 1BDOA 1FL0A 1STYA 1VQLA 1QWYA 4A3KG 1TWCB 1E0BA 2IHEA 3T1YL 2VL6A 4X64L 3Q23A 1WTPA 3W5OA 3DXJC 1BQQT 1I4QA 3KK7A 3LWEA 4DR1L 5CV6A 4DR3Q 1HNXQ 4L5TA 1DOKA 3HKZE 2ZT9C 3R8BA 2IY5B 5CV4A 1VQ6A 1BBWA 4BBRB 1K8GA 4HSVA 2M2LA 2CWPA 4YHHQ 4A3JB 3RZOB 1NCVA 2NZ1D 1KQSA 5IYBH 4JI8L 4OX9L 3X3NA 5T1GA 4DV7L 2QILA 4L8JA 3K8AA 1CUKA 3VR2A 4B3TQ 2K5VA 4OO1I 1WD0A 4GKJQ 1M1KC 2JA6B 1Q90A 1V43A 1AN8A 4C3IH 1TS3A 1ET6A 1NBWA 1L1OA 1YHAA 3A8JE 2ZTDA 3S24A 1VMCA 1XMOL 1IL8A 4JW0A 1YHQA 3P20A 5FKAC 5FO9B 1HJPA 2PYKA 3K80C 2Q2HA 3SR1A 4O2DA 5FK9C 2KENA 4RCNA 1BR9A 2KEEA 4C1NK 1E22A 5DM63 3H15A 4DV0Q 5M5WB 2E2DC 1KD1C 2EXDA 4HSPA 3W1BA 3HOYH 4BA1I 2C35B 2K14A 1SLJA 4BY1H 2N49A 2A5HA 1NJIC 2KUMA 4FVMA 2BA1A 4X65Q 5EGTA 1TWHH 5IGGA 2ES2A 4KD4A 2RBMA 4DV1Q 1EIYB 1DM0B 4FYDA 1JWUD 2IW3A 1K73C 4L5RC 3L9AX 2P5ZX 3GTOB 3PO3H 1BUVT 4RHSA 4LF4L 1Q86C 4DF7A 2HDLA 4B3ML 3NBIA 1PLFA 1F9QA 1IW7C 1PVOA 4QMGA 3URYA 3CW2C 1FD7D 4RGNA 3S1NH 2CCZA 1GUGA 3L0OA 3EIVA 3S1MB 1BKBA 3TN2A 1MI2A 1CZGA 1EY7A 1LUZA 2LSSA 3J7A5 1SMYC 3HOZG 4GKKL 3H3VC 2WB1B 3OIQA 4AH6A 4LF6L 2IWHA 2OT2A 1XJVA 2F0DA 3KJPA 5HGTA 2JK8A 3A74A 2F0JA 1W6JA 2KECA 5FLMH 3I2ZA 1N34L 3J7AF 1D5XC 3RLFA 1R4PB 1VQAA 2D2CC 2FMCA 4DAYB 4IUNA 2Q2TA 4JI1L 1EYCA 1XWEA 5DLQE 2JXMB 1LTBD 1AZPA 5IT9c 1XPRA 1Q1EA 3G48A 3FP9A 1HHVA 2RDGA 3A8KE 1B4OA 3U9SA 1MBYA 3K7AB 2K7VA 3QOLA 5LL6S 1CT1D 3SK6A 2HIXA 2JSOA 1LTID 4KHZA 3T1HL 1Y1WB 4TQUS 4HIKA 3LNNA 4WFN3 1ML0D 1DZ1A 5C3EG 3H94A 1HRJA 2DJGC 2VUMG 3E0JA 1IXRA 3K6OA 1NMFA 2KOLA 2IX3A 1ASZA 4KHPQ 4DK6C 4DR6Q 4G7OC 4FF4A 4LF8L 4QUFA 4JPBW 2UUCQ 2ZTCA 3KOJA 1PZID 1N8RC 3OTOL 3RZOH 2IX1A 3M3YB 5T1IA 1IHZA 3HS0C 3GTMH 3EFXD 5CV9A 3T13A 3DWPA 5C0XG 1WTRA 2MFIA 1I4HA 2K5NA 2JA6H 1JQYD 4XT1B 2VQFQ 1MD2D 3F1ZA 1Y8NB 3KLWA 3GD7A 4TVAB 3HOXB 4DA2A 2CH4A 2ENBA 1FJGQ 1YNNC 3K81C 4Z9CB 1KTKA 5C3XA 3QG1A 3ZYYX 5LMUL 3VR4A 3NUCA 2KHJA 1IW7D 3T1YQ 1QNKA 4X64Q 1DYQA 1FVIA 1M90C 4RG1A 3PUWA 5M5WH 4DR1Q 2CW0C 4J1MA 5CMDA 1XPOA 1SMYD 2QDLA 1AFPA 1EZ8A 1STNA 3CCMA 2CQAA 4NPSA 1TQOA 4RKLA 4DAPA 1A2TA 2WP8J 2A68C 4JI8Q 2WINB 4OX9Q 5I2XA 5C0XI 4DV7Q 2JA8G 1LABA 4QF4A 3MXPA 5C4ZA 1RODA 3CCQA 4JI0Q 1GO3E 2N88A 3HFZB 3M4PA 5IYCH 2OQ0A 5M3FH 5E4XA 3DWAA 3FHWA 2AUKA 2OWOA 2A19A 1HFGA 3HOUG 4L5QA 1VQGA 2AQ3B 3LWUA 1WCMB 2DNEA 3BG3A 4BA2I 3T51B 3MXNA 2MNAA 4XQQA 3G6EA 3BYTB 2NVYB 1NUCA 4N9PA 1OO9B 4DV4L 3D4WA 3S1MH 4A3IG 2F3VA 1XTDA 1SYFA 5C4XB 1RJTA 2R7FA 3CCJA 1OXSC 2MHVA 4KJOA 5C3WA 4C3HH 1C9OA 1ICWA 2K5WA 4LWCA 1ZYRC 4POGA 3DMUA 3OWEB 2R93B 1JE5A 1LT4D 4NKLA 1V1QA 4J6HA 5J22A 1J8IA 3FKIG 3PIO3 2A69C 4R1JA 2R6GA 1SROA 2F0LA 2Z6KA 2KCMA 1P16A 4KY7A 1STBA 2AWNA 3SK8A 4AIMA 4P72A 4P74A 4GNXC 3A0JA 4BBSB 1C7YA 4IPDA 1G51A 1Z9FA 4LF4Q 1WTHA 5JJZA 1Y8OB 1A2UA 2N55A 1U9RA 4IZ8A 4B3MQ 3K7AH 2VB3X 1FR3A 1YNND 1Q46A 2F0UA 3KDFA 1L0YB 4UAIA 3A5ZB 2JYOA 5DM73 3M7GA 1AZQA 1H9KA 1HCZA 1X65A 3Q8DA 3STBC 1YIJA 1VQ8A 4S3SA 4IFDG 3HOVG 2I07B 1DCZA 4GKKQ 4APVA 4ZYSA 4LF6Q 2R3ZA 4JI7L 3W2DA 2CW0D 1VQKA 4JI6L 2ICIA 1XXGA 3QWNA 1CSQA 4NXNL 5IP9H 2A68D 2EYPA 3D3RA 3CAMA 2AQ1B 1X54A 2C5CA 4HJ7A 3M3YH 4JI1Q 2RF4A 2K52A 5IGBA 1M8AA 2RA4A 3OHXC 1STEA 5ELNA 4JI4Q 3FPPA 2ZXPA 4ZUJA 3K5NA 1F2MA 3VA5A 3DM1A 4IJHA 1I50B 4ULLA 1GM5A 1XTCD 1VS0A 4JI5L 3T1HQ 1GD7A 1R9TB 3EJIA 3TZUA 2K1BA 1BCPF 4IFDI 1AEXA 1EU3A 3FPUB 3KF8A 1Q1BA 4ZK9B 4DFAA 4DAMA 1YVCA 3H0GG 1CHQD 1L0XB 1D8LA 1RDPD 2NN6G 1PH5A 1C0AA 5GAEC 1L1OB 1QG7A 1GHKA 4A3MG 2O2LD 2JA7G 3OTOQ 4R9WA 4F7XA 2AUJD 2I5MX 4ZUIA 4DK1A 1EIFA 1EWIA 3D4DA 4UP8A 5A35A 2HT1A 2J4XA 3CCSA 3TRZA 5LMNL 2A69D 5M9OA 4DV3Q 1HQRD 2WFWA 3EA6A 1K3RA 5HURA 2NBFA 5AJ3L 4IOCA 2UU9L 3ER0A 5IOCA 1E1TA 4A3GH 5EBCA 4A3DG 5K36G 3I91A 3HKZG 2F0WA 4C3JG 5H1SE 2B2UA 3DWQA 5LMUQ 2R92G 1MSHA 1WCMH 1CHPD 1PHJA 4O42A 5EQ0A 4KN7C 3TS2A 4MNOA 4IPGA 4MTNA 3MAQA 1H9MA 2PNRC 4DR3L 2L15A 1GVPA 3STBD 2UXDL 1J6QA 4CDEC 2NN6I 1SYBA 5CV5A 5C4XH 1F2YA 3RD4A 2K04A 2RDFA 4GLXA 5C5LA 4X6AH 4R8IA 3JAML 4KTAA 2R93H 2F0FA 4M8AA 1SXTA 3OYYA 4BY7G 1KDCA 2J7ZA 1TVXA 1PTOC 3QB3A 5ISRA 1B2TA 3H3VH 3NPPA 3N6RA 4BBSH 1C4QA 3ICEA 1CSPA 3PO2G 1QE6A 2AMCB 3ULJA 1KNEA 4JCVE 3G6JB 1EYGA 2DGYA 2QF7A 3S16B 1NNXA 4A93G 3GTJB 5C44B 3NTIA 3PIPA 1B8AA 4DV4Q 3NQIA 2BE5C 2L5TA 4YIJA 4K2LA 2MUYA 1D1IA 3D31A 1CKNA 2K05A 3I4MG 3MFYA 3I4OA 4JV5Q 5CC4A 4JC0A 4DV1L 2RKSA 1UAPA 2PQAA 3BZCA 2JEBI 4A3LG 4HCEA 2LFNA 2LS01 2L0CA 1XNQL 4C3IB 2WB1E 2VW9A 2EYLA 4XIGS 3O13A 2KHIA 4OELB 3VR5A 3CCRA 3RN5A 5IP7G 3CF5A 2HHHL 2NTSA 5DAUA 2CHBD 1VDZA 4DUYL 3TSSA 5L37A 2ZJQA 1G91A 4AYBG 2WV6D 3RLOA 1R4QB 3WWVA 2UXCL 5FJ8H 4ZKBB 5IODA 1HZ9A 1I50H 4U673 1Y1VG 2UUBL 3HOYB 4Y52H 2QA4A 3CP0A 1F9RA 3NSWA 2B2WA 1R9TH 1OTCA 1EU4A 2XVSA 4BY1B 2KQ3A 4CHTB 4NDXA 4NMZA 3LX0A 5IWAL 4P73A 5BN4A 1TXYA 2EQSA 3WDNA 3NE5B 1PH6A 2MP1A 1MJEA 1IBKL 1WFQA 4DUZQ 4JI6Q 3AU7A 1PV4A 1ZKOA 2A6EC 2RCFA 3C2PA 4QY7A 4JI2L 4PG3A 3RUZA 4F87A 4NXNQ 1SJHD 5CYUA 2KCTA 2K5DA 2Q2IA 3S1RB 2F0GA 4XYOA 3PO3B 1VQOA 1B50A 2CVRA 2VY3A 4LUZA 1PTOD 1A6XA 1TWAB 2NYZD 4JI3L 1GUWA 5E4WC 4HAEA 4P71A 1B9NA 1EY4A 3S1NB 1SYEA 2R7DA 4JI5Q 5M5XH 1K9MC 1D7QA 2F52A 2AQ2B 1IYUA 3BDLA 3I3CA 4KHPL 2BE5D 1I4PA 1KAWA 1BCPB 4N8X1 3X3MA 4KKUA 1NAPA 5FO7B 1QCBD 5FO8B 3AYHB 4HN7A 1A62A 1LV9A 4NB3A 1HR0L 4EQOA 1JOQA 1VCIA 2B2TC 3F8TA 4LF7L 4FXGC 4MTKA 4N8FA 2VB2X 4KY6A 5AJ3Q 4OHJA 2UU9Q 1I3QH 1JWMD 1FJGL 3CXCA 2XRQD 3DUZA 2OCEA 2PNHA 1A3TA 2BOSA 2Z4HA 2ASBA 4L6TB 3HOWG 1HPCA 1LACA 2RCNA 1O80A 3S16H 3I70A 3GTJH 5C44H 1IKMA 4R4OA 1NTGA 4MZ9A 2UXDQ 2Q8TA 4OO1H 1I4GA 4M1UB 3S2DB 3NTHA 2X6GA 3DEOA 4KKTA 4PZ7A 4FF1A 4BXXH 1VF5C 5KYIA 1WTQA 3IAYA 3AFPA 3PIOA 3GTMB 5EBDA 4GN5A 1FYCA 1RHPA 4DV6Q 3TS0A 4JI0L 2GN5A 4UPAA 5C3EB 1UNSA 3ZJYC 3FEWX 3KDFB 2DUDA 4XTCS 1I4RA 4K6DA 4RCOA 3S17B 1PFNA 3NTKA 4A3EB 2QGQA 3C46A 4DV2L 4ME5A 2F0TA 2HCCA 4IN3A 1Z7TA 2E2HB 3I55A 4O0AA 3W1GA 1G2SA 1SEBD 4KI0A 3CMAA 1QNUA 2WACA 2YV5A 4G4KA 4POFA 1IBML 3OPOA 1JWSD 1LYLA 3G4SA 2QCPX 1TKWB 3B6YA 1QZHA 3C1EA 4YWMA 2LY7A 1BO0A 3RNUA 2M00A 4LFAL 2CKZB 5CBAE 1SYDA 2H1EA 4O1NA 2B2WC 1K8MA 1XNQQ 4Y7NB 3SVMA 4MN3A 5M3FB 1ENFA 3A54A 2K5QA 1STGA 2SDFA 3S1RH 5JEAH 2HHHQ 2YTVA 4NXML 1X3EA 4DUYQ 5TSSA 3NEMA 1TWAH 3DHQA 3KF8B 3FRPB 4H0LC 2UXCQ 2CWAA 3JAMc 4CJ1B 4YCVA 4RAUC 4KHVA 1I6HB 1YITA 3FVQA 4RMFA 1VQ4A 2UUBQ 2SEBD 4BS9A 2N8NA 2X6LA 1Y14B 4ZRZA 4JBJA 4PQXA 2EPBA 1II3A 3F2UA 1EEFD 4C3HB 1U4MA 5GQOA 5IWAQ 4JYAL 3M4QA 1D5MC 4HCSA 4OWTB 5JVG3 1EWCA 1IBKQ 1IL2A 5D65A 3PUXA 4GNXA 1QZGA 1C8CA 3QR8A 4UP7A 3HP3A 4QCLA 4JI2Q 4DAVA 3C1FA 3NBHA 3IL8A 4OEMB 4OXPA 3KFUA 1JE4A 3NHHA 4DR7L 3E6ZX 4HEDA 1UE6A 1AE2A 4QIWB 2NB0A 1KHIA 4LF5L 1VQHA 4JI4L 1SNQA 2QKIC 1F2ZA 5EPKA 4JI3Q 3HOZH 1BNZA 2EIFA 1S5ED 2EY6A 3I56A 4JBWA 1TU2B 4RH6A 1BVSA 5C6AA 4FP5D 1S3OA 4A76A 1E1OA 3FKIB 4CDFC 1JT8A 4A3BB 2XSCA 5I6YA 2B2VC 5AFWA 3R3OA 4BBRG 2XN9C 3QOJA 3S1QH 2F4IA 4A3JG 4RA8A 3S2DH 2ZXRA 1NMGA 3ULLA 4WRDA 5FLXc 4K14A 1K8OA 1HR0Q 3CD6A 3OIPA 4LF7Q 4DV3L 1S4ZA 4GN3B 4HMJA 4A3FB 1CFMA 4K0KQ 2PCFB 5C3EH 4HTHA 3VYUA 1PRTF 3CPWA 3IFDA 2ZJPA 1YI2A 5LMNW 3S17H 2K01A 4A3EH 4G7HC 1CKMA 1SE4A 1CKNB 4BWGB 2HDMA 1S5FD 3S2HB 1EY9A 2JE6I 1NR2A 2E2HH 3D8GA 4GOPC 2VZAA 1YNXA 1F9PA 1MHWC 2PQAB 3CU7A 2K50A 4HMIA 3EBEA 4ZCKA 3A7LA 4DKAC 5CGKA 2XGTA 2EYHA 4ZLTF 4OWWB 4C1NI 1XX8A 4H13C 4A75A 1N32L 4PMBA 2E8GA 5IYCG 4HIOA 1X55A 1PRTC 3RR5A 1PH3A 1DD2A 3PF4A 4JBMA 4Y7NH 4A3GB 2F4VQ 2D5DA 1U4RA 1N33L 1VQ5A 2YTXA 3H0GB 1VQBA 1RTOA 3L7ZC 5EKLA 3J81i 4DV2Q 2Y0SB 5A2QE 4LUVA 2EJGC 3J80i 3S9WA 2QDBA 4LAAA 4XDXA 5JJIA 1CI3M 3KYHC 2JA7B 1I6HH 5KNCA 1JICA 5ELEA 3J80E 1EQVA 1JJCB 1KRTA 4DXGA 1TY2A 2JA8H 1KLGD 2WB1G 1GOZA 3KJOA 1IBMQ 4IPCA 1EY8A 2GVAA 2YYZA 3UE0A 1QVFA 4CKBA 4P2CB 3MZ5A 4JV5L 2MO0A 4A3DB 2E76C 3I4LA 2C9OA 4LFAQ 3HGBA 4LFCL 2L11A 2E74C 1G291 4PZ6A 4F88A 5ELOA 3HZXA 3V2TA 4XYQA 2PPBC 2D0PA 2R92B 1STHA 3TDQA 3CRKC 1LTAD 1QVGA 3NWTA 1RCVD 4DN4M 2LXKA 4GS3A 2ICEC 1QOHA 4A4IA 1K3BC 3PMFA 5EPLA 2R7ZB 1O7ZA 2IPKD 1FNUA 2SNSA 1WYDA 4NXMQ 3HRZC 2UUAL 5I6WA 4YWKA 5DNFA 3A8IE 3CCLA 3E3XA 3U4VA 5J39A 4K6LA 1Y1WG 1LTLA 3NELA 3OW2A 5A2QL 4B3SL 1AE3A 3GTKB 3FKIH 5I4DA 4FXDA 4BY7B 2QW7A 5JEAJ 2IJ0A 2NVXB 4A3BH 2DY7A 2TMPA 4JYAQ 1DOLA 3J80L 1EYDA 3E0EA 4DUZL 5I2YA 1A63A 2E75C 1G8ZD 1PZKD 2EZVA 1XPUA 1ENAA 2XNAC 1EY5A 3GTPB 3PF5A 4DR7Q 3I4NG 4A93B 1JORA 3MEFA 2PI2A 4LMQD 1PRTD 2RDHA 4IOAA 5KIXA 3VYTA 3HOXG 4LF5Q 3NP8A 4IUTA 3VYRA 1WOCA 4A3FH 1BBUA 5IYDH 1RD9D 4IFDH 3U50C 1Q81C 2EE1A 4GLVB 3TZDA 5G3LF 4RGTA 1B3QA 4TKOB 1PFSA 1UE1A 2G9HD 1CM9A 3AFQA 1BOSA 3GV3A 3S2HH 2Q2UA 3P75A 1ESFA 5CV8A 3I7FA 3K59A 1EFWA 4DGZA 2QEXA 2IX0A 4Q0FA 2XTIA 1SNDA 2JA5G 2LKVA 4AYBB 3CC2A 1NE3A 4I65A 3A5UA 1EOVA 1FNVA 1FGBD 1ZYRD 5IGDA 1F2LA 2L4NA 1T5EA 1Y1VB 4G57A 3D0FA 1LTGD 1YHBA 2FMMA 5HY6A 2KVMA 4QUCA 3MXGA 1HR0W 4ZKCB 1TWGB 1K28A 2WAQB 4YY3L 1SBBB 2R61A 1O7LA 1PTOF 3H0GH 1WCMG 5ELFA 3IFTA 3K7UC 5M5XB 1ASYA 2NN6H 1EOTA 1LT6D 4Q5VA 4A3MH 3TBIB 4X62L 3CKIB 2JA7H 5FOBB 2MQHA 4XQJA 1YBYA 4DU9A 2XWBB 2B2TA 3KLSX 1KAAA 1JB3A 5IE8A 1NY4A 2PMZB 3UI2A 1CQFA 3FMCA 1J9OA 2EYMA 5DEHA 1X3PA 3SK4A 1BF4A 4ID6A 1SNPA 3K58A 1HZAA 3BVZA 4A3DH 5K36H 1D2BA 1B53A 4C3JH 1X6OA 1FNWA 1N32Q 1PH4A 2R92H 4EGVA 5KYLA 4OIJA 4DV6L 1SE3A 1S5DD 4BBSG 3TEHB 1BXTA 5LL6X 5JOBA 1I3QB 2PI2E 1JCKB 4DR4L 3OMGA 1ET9A 4I7AA 1N33Q 1SE2A 3QO2A 2R7ZH 2F3IA 1PH7A 2OEOA 3ND9A 3BZKA 3H09A 4IUQA 4JVZA 4WORA 2EJMA 1SYGA 1KIXA 1QVCA 2NVQH 2PZUA 2D62A 5KNDA 1BBXC 1TWFB 3L3OC 4K8IA 4GNXB 2IHFA 2B8FA 5LHY1 3I73A 2D0OA 3NBHB 3GTKH 4BY7H 1IBLL 4LUOA 3TP7A 2NVXH 1ESRA 5C5MA 4QJFA 2NVTH 5JVH3 5M5YB 1K83H 2B63B 4XXEA 3BDOA 4LFCQ 2EY2A 5ELCA 4ALPA 5IY0A 3PO2H 2LMCB 4RWSC 2I5LX 3ERQA 3WOFA 4A3KB 2F0EA 5EJWA 3P1HA 4YWLA 3GTPH 4A93H 1HA5A 1HUMA 2EY5A 2L9HA 4F8MA 2B2YC 5G3LD 2ZM6L 2UUAQ 1STAA 2Z9HA 1VMPA 5M3MG 4DNRB 3I4MH 1Y8PB 4DK0A 3IKJA 3SEBA 4OGQC 2KEDA 3GTLB 3PSIA 1K0SA 2E2JB 3J7YW 4QIWE 4DR2L 2E5LL 2VQEQ 2HCIA 3JC66 4EQPA 4B3SQ 4A3LH 1A8VA 4B3RL 1K8AC 2JQOA 2MO1A 1V9PA 2V4DA 2D9UA 5GAHC 5IIFA 3GV6A 3RN2A 5D14A 5IP7H 1AP0A 3BVGA 1X3QA 3U9OA 2ATWA 5JJKA 3I90A 4DV5L 1RL2A 4IURA 3NENA 4A3CG 4WJWA 2MPMA 1TS4A 3BZDB 4H7BA 2ALYB 1B70B 1HQMC 1Y1VH 5EPJA 4LW1A 5ELBA 2K4KA 2OF1A 2TSSA 2GVBA 1HUNA 2NUCA 3K57A 1TWGH 4HR7B 1X3GA 3RZDB 1H95A 1WI5A 2EY1A 1RF2D 4R4TA 1QB5D 3W3AA 4UP9A 1N36L 2OTJA 5EKKA 4KY5A 1XNRQ 1SN8A 2O5IC 2EYOA 4V190 3IRBA 4ODGA 2DY8A 2I5HA 3UDXA 3D6WA 1TY0A 4IFDJ 1HZBA 4AQYQ 2L12A 1T5XD 1K0RA 1SR3A 3ND8A 4QL5A 2JN4A 1DONA 3C3LA 4X66L 1KABA 3TP5A 2JEAI 1VQEA 1GKHA 1E2VA 5EAYA 5C4HA 1MKHA 3MHBA 2K5HA 3SGIA 4HIDA 1D5ZC 1PDQA 4J15A 3HOZB 1MJCA 4K0KL 1WTXA 4KMUC 2B2VA 4KK7A 2F0SA 4YY3Q 2DN8A 1B44D 2NZHA 2FJ2A 1V1OA 5E1FA 1PTOB 4DK3C 5C44G 3TREA 3UDIA 4X62Q 1TWFH 2LXJA 3M4YA 2H5XA 3I72A 1HFNA 2Y0SE 3S1QB 1B1ZA 4EVOA 1PYBA 1VF7A 5GADC 1GHJA 5IYBG 2EJFC 4JOIC 2K33A 2IL8A 4XQNA 5CV7A 4R4CA 5M5YH 5D3IB 2B63H 2A6ED 3E9HA 4C3IG 3MFGA 3TMEA 2HUGA 1V1PA 3KLSA 3HOWH 4A3KH 3BS1A 1AW7A 1Z6HA 2F4VL 4GOPA 2VUMB 1X56A 4DR4Q 1T9HA 1SSOA 1UEBA 3MEHA 3WOEA 1LO5D 5K5PA 1SE8A 1IYJB 4FNFA 3HOYG 3OSOA 3QJYA 4TRDA 2FXQA 4V0BA 3GTLH 4BY1G 1I94L 2E2JH 1GUTA 1JB7A 3EN2A 1I5FA 2K75A 4LFBL 4FO2A 1CZWA 5BN3A 1IBLQ 4JK1C 5C4JB 1SFOB 4B9WA 4QGUA 4CJ2C 1OXUA 1HZCA 2PO4A 3KF6B 5GROA 3HEJA 4YCUA 3PUVA 3GO5A 5GAGC 2Q8RE 2WKDA 4UHVA 1WVLA 5JEAG 3PO3G 4B08A 4CDCC 1YEZA 3F2DA 1MIUA 1WTWA 2ZTEA 2XIWA 4KLKA 1OXTA 3KBGA 1V8QA 2Z0SA 1GUNA 2ZM6Q 3RMHA 2V1CC 1JR0D 4G7ZC 4DNIA 2KCNA 4DNTB 1S72A 3RZDH 4FF3A 1PXUA 1TIID 2F0PA 3BDCA 3R93A 1SNCA 4DR2Q 2E5LQ 2JA8B 1B9MA 3GDEA 1O78A 2B29A 4B3RQ 4WJ3M 1VQJA 4KV6A 3BVMA 3SK5A 2AHOB 1O7YA 4DXFA 5FLMG 1SJED 1X3FA 1VQFA 2A1AA 3EQLC 3CC4A 1XMQL 3AMUA 2RQXA 1EWHA 3HOUB 4DV5Q 4JG2A 4IPHA 3T4AC 1W3SA 4DR5L 2FFKB 1L2FA 1QILA 5IGCA 1U0LA 3M4OB 3PIP3 4AYBE 4A3IB 2RHSB 3V05A 3AQQA 1SDFA 2F3WA 2SNMA 3MTSA 4OONA 4MHEA 1UE5A 1J5EL 1UE7A 3T16A 4ABNA 1N36Q 1PTOH 1Q8IA 1VQNA 4KKSA 2WAQE 4ZQ3A 5KRUA 1Y69U 1G6ZA 2F03A 1S5BD 2B3GA 1U5KA 2F0VA 4WJ4A 2CH4W 2B39A 1NR4A 3NQTA 1Z47A 1DOMA 1EIGA 2HQEA 2L55A 5BN5A 4IALA 4XT3B 2A6HC 3UE1A 4X66Q 3J7ZC 1S40A 4C2MH 1F9SA 2PMZE 3F2CA 2JA6G 1LTSD 2MJ8A 1A3UA 3H6MA 1TWCH 4NW2A 5E7NA 2F0IA 3PQIA 1B7YB 2XWJB 3ONAB 2UXBL 1ILPA 3PCOB 5KGUA 1YJWA 3HOVB 4A3EG 1HNWL 2VUMH 2YTYA 4BBRH 2NTTA 1EY0A 2PW7A 2VXWA 2F0QA 3VDYA 3K0YA 4A3JH 1HH2P 2EYJA 2FHTA 2N3SA 3M7NA 3I4NB 1PZJD 2L1BA 2ZXOA 5C0XH 2KA7A 1JJGA 3SE0A 1DGSA 1SMXA 2FINB 4GN4B 1H9SA 3KLRA 1EFID 2A8VA 5C4JH 1SFOH 1VQIA 2WIIB 3CC7A 1W2BA 1EY6A 1O7IA 2EVBA 1CTMA 1SRUA 1L1OC 1PYSB 5M3FG 2KBNA 4L5SA 4FF2A 5JAVA 2HD3A 1X9NA 1RTNA 1G2TA 1ONLA 1QUQA 1X32A 3GTGB 2K03A 2AKWB 3E9IA 1MGSA 3PV0A 1FGUA 4CGYB 2JA5B 5EKIA 3P7JA 4KJNA 1KLUD 4IJLA 2OTLA 1TS2A 4A3MB 5NUCA 1P8LA 5BR8L 3J81E 1UEAB 1LTTD 2YU9B 1SAPA 1PYWD 1I94Q 1D6EC 1PH1A 1KDAA 1UUPA 3TP8A 3MA2B 5CR3A 3GQBA 4C3HG 5F2DA 4LFBQ 1ENCA 3HG9A 4K5XA 1TT2A 3GTOH 4R4IA 3S14B 1EIHA 5COYA 1XMOQ 4K5WA 1LTRD 2PQEA 3HKZB 3VR3A 4UDUC 2B8GA 4C3JB 2BCOA 4GLAC 1IKLA 1C48A 2A6HD 4YCWA 3HOUH 3OOCA 3UDGA 4IUPA 2VS1A 3HKSA 2OQKA 1EZ6A 2I46A 4LK1C 4X3UA 3OW7A 3TP6A 1PH8A 3ERSX 3M4OH 2WKCA 1VQ9A 1PH9A 4A3IH 1WD1A 2NVQB 2X69A 3G71A 1F77A 3CCEA 1D1KA 1OXVA 2RSNA 4A3BG 2VQEL 2EYFA 2EXZA 4IUVA 2XRSD 3CQZB 1A15A 3J81L 5JJLA 2QEJC 4HJAA 2NVTB 3E5SA 4X3SA 5CBEE 1JOKA 1K83B 2KHSA 1YZ6A 3H91A 3T53B 1XMQQ 5IP9G 1JMCA 3SHLA 4P75A 2N78A 3PO2B 3VR6A 2O5JC 2B2YA 3G7LA 1Y1WH 2BA0A 4B9XA 4DR5Q 1HA6A 1SNOA 4A3FG 2F0HA 5IYDG 2K32A 1CKOA 4UY8C 3KF6A 5ELDA 4LF9L 2KCCA 3GP7A 2OXPA 2PZWA 2BDNA 1QJOA 2F0KA 3ULPA 3I4MB 4DPGA 3HOVH 2RHQB 1LT5D 1Q3LA 1EQQA 4IQZA 1N34Q 2VNUD 3K5OA 3F2BA 1J5EQ 3A7AB 4EQNA 1LLRD 4QB4A 1E24A 2HQLA 1EQTA 1XNRL 2Z4IA 4HIMA 3I4NH 4LJZC 3K5LA 1EQRA 2A74C 2DJFC 3I8ZA 3D4RA 1V1PB 5I9OA 1HNZL 1Q12A 4AQYL 1CK1A 3TQYA 5CORA 4TSSA 3HOXH 3AEVA 3BU2A 2K6AA 4CDDC 5M3MB 4K2KA 1GUOA 4GOPB 2BH2A 3CCVA 2H4OA 2NZOA 1WTOA 1CA5A 4X3KA 1EEID 1GUSA 3JAMi 4A3GG 2UXBQ 4OIKA 3U58A 4X3TA 1ZXTA 3JAME 1HNWQ 2Y0SG 4LF8Q 1HTLD 3PGZA 4RGOS 3GTGH 1A3VA 4CKEA 4ZAIA 2JA5H 1PRTB 1JOOA 4GZYC 4OL7A 1PMRA 2F1MA 2J0TD 3EVQA 3MVVA 3RLNA 1SNMA 5JPNC 2YU9H 5C4XG 3GTQB 1E7ZA 2G9DA 1CQVA 3CRLC 1KC8C 1AH9A 4R4QA 1DJRD 4DAYA 3R2TA 2G5DA 3S14H 3MXUA 2PW5A 2R93G 1BCPC 1M4VA 4H44C 3EROA 1VQMA 4IO9A 4K8JA 1E3PA 3Q24A 1Q82C 3S15B 3DM3A 4KN4C 5IT9E 3QIAA 2NVYH 1HNXL 2R7ZG 5C0XJ 3OMCA 2E2IB 1KNAA 3Q22A 1PA6A 3DLLA 1Q8KA 2Z8LA 1RKNA 3R2IA 1VQPA 3V96A 4YHHL 3MWYW 5JPMC 2F0NA 3KUPA 3M85A 2Z1CA 4JOIA 5BR8Q 3J7AV 1WJJA 1DXMA 4B3TL 4PNYA 4GKJL 3CCUA 3PUYA 5J1ZA 1KDBA 4N9TA 4FDBA 3CQZH 2I0QA 3KBXA 2AWOA 2O4XA 1H9RA 1KRSA 4EX5A 5FLXE 3ITPA 1YNJC 2MGSA 2BDOA 3H3VI 2KJXA 4KD3A 2NWGA 4CBVA 4DV0L 3HOWB 2Z6KC 2SOBA 2JJQA 4PMCA 3SDZA 1VQCA 2ZJRA 2K28A 3NXWA 4PMWA 2Q8IB 5IGFA 1Q7YC 1TS5A 1G6PA 1ICFB 3BJUA 2JA9A 4X65L 5FJ8G 2CFMA 5D3DA 5IT9L 5HGQA 2JP1A 1ILQA 2IT1A 1TR5A 4HJ5A 2RVLA 4HJ8A 1KL9A 3BYYB 3K5MA 3CMEA 2EOTA 3VYSA
chains in the Genus database with same CATH topology
2ID0A 2RSOA 4PV1C 1ZEQX 4J8QA 4FXKC 1MSGA 4NP5A 4E6IA 1BCPD 3PUZA 4IUUA 4RKBA 1GXDC 1U4PA 4L63B 5FLXL 5I9PA 2DNCA 1I4XA 1IYVA 1TWHB 4MIUA 1PFBA 4R8NA 4RHRA 5IGEA 2F0OA 5KEEA 1XYIA 1H9SB 1NSNS 3Q0AA 3NWSA 1HXYD 1EL0A 3NK9A 3OWFA 5E3FA 3N52A 3AB9A 3CHBD 1HTPA 1H9JA 4RFBA 1WTVA 2GA4B 1YNJD 3A56A 4U68A 1JC7A 1I6VC 3FDTA 4C56C 4ILWA 4I7ZC 5KNBA 2EDGA 2B2UC 1S5CD 4CJ0B 1LT3D 1EYAA 3Q6SA 3D6CA 4CKCA 3DEPA 3VA7A 2A73B 3T56B 1B3AA 1E2WA 3A55A 1OXXK 1U4LA 1E2ZA 1PFMA 2F0MA 4OO1G 1SYCA 4RGMA 2PZTA 1GJXA 1CA6A 3SXHA 1W6KA 2M9VA 4K5VA 3MC0B 4C2MB 1BDOA 1STYA 1QWYA 1TWCB 1E0BA 3Q23A 1WTPA 3DXJC 1BQQT 1I4QA 3KK7A 3LWEA 5CV6A 1DOKA 2ZT9C 3R8BA 5CV4A 4BBRB 4HSVA 2M2LA 4A3JB 3RZOB 1NCVA 2NZ1D 3X3NA 5T1GA 2QILA 4L8JA 3VR2A 4OO1I 1WD0A 2JA6B 1Q90A 1V43A 1AN8A 1TS3A 1ET6A 3A8JE 1VMCA 1IL8A 3P20A 5FKAC 5FO9B 2PYKA 3SR1A 5FK9C 4RCNA 1BR9A 2KEEA 4C1NK 5DM63 5M5WB 2E2DC 4HSPA 4BA1I 2A5HA 2KUMA 4FVMA 2BA1A 5EGTA 5IGGA 4KD4A 2RBMA 1DM0B 4FYDA 1JWUD 2IW3A 3L9AX 3GTOB 1BUVT 4RHSA 4DF7A 2HDLA 3NBIA 1PLFA 1F9QA 1IW7C 4QMGA 3URYA 4RGNA 1FD7D 1GUGA 3S1MB 3TN2A 1MI2A 1CZGA 1EY7A 1SMYC 3H3VC 2WB1B 3OIQA 2IWHA 2OT2A 2F0DA 5HGTA 2F0JA 1W6JA 2KECA 3J7AF 1D5XC 3RLFA 1R4PB 2D2CC 2FMCA 4IUNA 1EYCA 1XWEA 2JXMB 1LTBD 1AZPA 1Q1EA 1HHVA 2RDGA 3A8KE 1B4OA 3U9SA 1MBYA 3K7AB 2K7VA 3QOLA 5LL6S 1CT1D 3SK6A 2JSOA 1LTID 4KHZA 1Y1WB 4TQUS 3LNNA 4WFN3 1ML0D 1DZ1A 3H94A 1HRJA 3E0JA 3K6OA 2KOLA 2IX3A 4G7OC 4FF4A 4QUFA 1PZID 2IX1A 3M3YB 5T1IA 1IHZA 3HS0C 3EFXD 5CV9A 3T13A 3DWPA 5C0XG 1WTRA 1I4HA 1JQYD 4XT1B 1MD2D 1Y8NB 3GD7A 3HOXB 4DA2A 2ENBA 1YNNC 4Z9CB 1KTKA 5C3XA 3QG1A 3ZYYX 3VR4A 3NUCA 1IW7D 1QNKA 1DYQA 3PUWA 2CW0C 4J1MA 5CMDA 1SMYD 1AFPA 1EZ8A 1STNA 2CQAA 1TQOA 4RKLA 4DAPA 1A2TA 2WP8J 2A68C 2WINB 5I2XA 5C0XI 1LABA 4QF4A 3MXPA 5C4ZA 1RODA 2N88A 5E4XA 3DWAA 2AUKA 1HFGA 2AQ3B 3LWUA 1WCMB 2DNEA 3BG3A 4BA2I 3T51B 3MXNA 4XQQA 3BYTB 2NVYB 1NUCA 4N9PA 1OO9B 3D4WA 2F3VA 1SYFA 5C4XB 1RJTA 1OXSC 2MHVA 4KJOA 5C3WA 1ICWA 2K5WA 1ZYRC 3DMUA 3OWEB 2R93B 1LT4D 4NKLA 4J6HA 5J22A 1J8IA 3PIO3 2A69C 2R6GA 2F0LA 4KY7A 1STBA 2AWNA 3SK8A 4BBSB 5JJZA 1Y8OB 1A2UA 2N55A 1U9RA 4IZ8A 2VB3X 1FR3A 1YNND 2F0UA 1L0YB 4UAIA 2JYOA 5DM73 3M7GA 1AZQA 1H9KA 1HCZA 4S3SA 4IFDG 2I07B 1DCZA 4ZYSA 2R3ZA 3W2DA 2CW0D 2ICIA 1XXGA 3QWNA 2A68D 2EYPA 3D3RA 2AQ1B 2C5CA 5IGBA 1M8AA 2RA4A 3OHXC 1STEA 3FPPA 2ZXPA 4ZUJA 3K5NA 1F2MA 3VA5A 3DM1A 1I50B 4ULLA 1XTCD 1R9TB 3EJIA 3TZUA 2K1BA 1BCPF 4IFDI 1AEXA 1EU3A 3FPUB 3KF8A 1Q1BA 4ZK9B 4DFAA 1CHQD 1L0XB 1RDPD 2NN6G 1QG7A 1GHKA 2O2LD 4R9WA 4F7XA 2AUJD 4ZUIA 4DK1A 3D4DA 5A35A 2J4XA 2A69D 5M9OA 1HQRD 3EA6A 5HURA 2NBFA 5IOCA 5EBCA 5K36G 3I91A 2F0WA 4C3JG 2B2UA 3DWQA 1MSHA 1CHPD 4O42A 5EQ0A 4KN7C 3MAQA 1H9MA 2PNRC 2NN6I 1SYBA 5CV5A 1F2YA 3RD4A 2K04A 2RDFA 5C5LA 4R8IA 3JAML 4KTAA 2F0FA 4M8AA 1SXTA 1KDCA 2J7ZA 1TVXA 1PTOC 3QB3A 5ISRA 1B2TA 3NPPA 3N6RA 1C4QA 1QE6A 1KNEA 3G6JB 2QF7A 3S16B 3GTJB 5C44B 3NTIA 3NQIA 2BE5C 2L5TA 4YIJA 4K2LA 2MUYA 1D1IA 3D31A 2K05A 3MFYA 5CC4A 2RKSA 1UAPA 2JEBI 4HCEA 2LFNA 2LS01 2L0CA 4C3IB 2EYLA 4XIGS 3O13A 3VR5A 2NTSA 5DAUA 2CHBD 1VDZA 3TSSA 1G91A 2WV6D 1R4QB 4ZKBB 5IODA 4U673 3HOYB 1F9RA 3NSWA 2B2WA 1EU4A 2XVSA 4BY1B 2KQ3A 4CHTB 4NDXA 4NMZA 3LX0A 5BN4A 3WDNA 3NE5B 2MP1A 3AU7A 1ZKOA 2A6EC 3C2PA 3RUZA 4F87A 1SJHD 5CYUA 2K5DA 3S1RB 2F0GA 4XYOA 3PO3B 1B50A 2CVRA 1PTOD 1A6XA 1TWAB 2NYZD 1GUWA 5E4WC 4HAEA 1B9NA 1EY4A 3S1NB 1SYEA 2AQ2B 1IYUA 3BDLA 3I3CA 2BE5D 1I4PA 1BCPB 3X3MA 4KKUA 1NAPA 5FO7B 1QCBD 5FO8B 4HN7A 1LV9A 4EQOA 1JOQA 1VCIA 2B2TC 4FXGC 2VB2X 4KY6A 4OHJA 1JWMD 2XRQD 3DUZA 1A3TA 2BOSA 2Z4HA 4L6TB 1HPCA 1LACA 1O80A 3I70A 1IKMA 2Q8TA 4OO1H 1I4GA 4M1UB 3S2DB 3NTHA 2X6GA 3DEOA 4KKTA 4FF1A 1VF5C 5KYIA 1WTQA 3IAYA 3GTMB 5EBDA 1FYCA 1RHPA 5C3EB 1UNSA 3FEWX 4XTCS 1I4RA 4K6DA 4RCOA 3S17B 1PFNA 3NTKA 4A3EB 3C46A 4ME5A 2F0TA 2HCCA 4IN3A 1Z7TA 2E2HB 1G2SA 1SEBD 4KI0A 1QNUA 2WACA 4G4KA 3OPOA 1JWSD 2QCPX 1TKWB 3C1EA 2LY7A 1BO0A 2M00A 5CBAE 1SYDA 2H1EA 4O1NA 2B2WC 1K8MA 4Y7NB 3SVMA 4MN3A 5M3FB 1ENFA 3A54A 2K5QA 1STGA 2SDFA 5JEAH 5TSSA 3DHQA 3FRPB 4H0LC 4CJ1B 4RAUC 4KHVA 1I6HB 3FVQA 2SEBD 4BS9A 2X6LA 4ZRZA 4PQXA 2EPBA 1II3A 3F2UA 1EEFD 4C3HB 1U4MA 1D5MC 4HCSA 5JVG3 1EWCA 5D65A 3PUXA 1C8CA 3HP3A 4QCLA 4DAVA 3C1FA 3NBHA 3IL8A 1JE4A 3NHHA 3E6ZX 4HEDA 4QIWB 2NB0A 1SNQA 2QKIC 1F2ZA 5EPKA 1BNZA 1S5ED 2EY6A 4JBWA 1TU2B 4RH6A 5C6AA 4FP5D 3FKIB 4A3BB 2XSCA 5I6YA 2B2VC 5AFWA 3R3OA 2XN9C 3QOJA 2F4IA 4RA8A 2ZXRA 4WRDA 4K14A 1K8OA 3OIPA 1S4ZA 4HMJA 4A3FB 1CFMA 2PCFB 4HTHA 3VYUA 1PRTF 3IFDA 2K01A 4G7HC 1SE4A 4BWGB 2HDMA 1S5FD 3S2HB 1EY9A 2JE6I 1NR2A 3D8GA 1F9PA 3CU7A 4HMIA 3A7LA 5CGKA 2EYHA 4ZLTF 4C1NI 1XX8A 4H13C 4PMBA 1PRTC 1DD2A 4A3GB 2D5DA 1U4RA 3H0GB 3L7ZC 1RTOA 5EKLA 2Y0SB 5A2QE 3S9WA 2EJGC 2QDBA 4LAAA 4XDXA 1CI3M 2JA7B 5KNCA 1JICA 5ELEA 3J80E 1EQVA 4DXGA 1TY2A 1KLGD 1GOZA 1EY8A 2YYZA 4CKBA 4P2CB 3MZ5A 4A3DB 2E76C 3I4LA 2C9OA 3HGBA 2L11A 2E74C 1G291 4F88A 2PPBC 3HZXA 3V2TA 4XYQA 2R92B 1STHA 3TDQA 3CRKC 1LTAD 3NWTA 1RCVD 4DN4M 2ICEC 1QOHA 3PMFA 5EPLA 2R7ZB 1O7ZA 2IPKD 1FNUA 2SNSA 3HRZC 5I6WA 5DNFA 3A8IE 5J39A 4K6LA 5A2QL 3GTKB 5I4DA 4FXDA 4BY7B 2NVXB 5JEAJ 2IJ0A 2DY7A 2TMPA 1DOLA 3J80L 1EYDA 5I2YA 2E75C 1G8ZD 1PZKD 2EZVA 1ENAA 2XNAC 1EY5A 3GTPB 4A93B 1JORA 4LMQD 1PRTD 2RDHA 5KIXA 3VYTA 3NP8A 4IUTA 3VYRA 1RD9D 4IFDH 2EE1A 3TZDA 5G3LF 4RGTA 4TKOB 2G9HD 1CM9A 1BOSA 3GV3A 3P75A 1ESFA 5CV8A 3K59A 4DGZA 2IX0A 4Q0FA 1SNDA 2LKVA 4AYBB 4I65A 1FNVA 1FGBD 1ZYRD 5IGDA 1F2LA 2L4NA 1T5EA 1Y1VB 4G57A 1LTGD 2FMMA 2KVMA 4QUCA 3MXGA 4ZKCB 1TWGB 2WAQB 1SBBB 2R61A 1O7LA 1PTOF 5ELFA 3IFTA 5M5XB 2NN6H 1EOTA 1LT6D 4Q5VA 3TBIB 3CKIB 5FOBB 4XQJA 4DU9A 2XWBB 2B2TA 3KLSX 1KAAA 1JB3A 2PMZB 3UI2A 1CQFA 3FMCA 1J9OA 2EYMA 5DEHA 1X3PA 3SK4A 1BF4A 4ID6A 1SNPA 3K58A 3BVZA 5K36H 1D2BA 1B53A 1FNWA 4EGVA 5KYLA 4OIJA 1SE3A 1S5DD 5LL6X 1BXTA 5JOBA 1I3QB 1JCKB 3OMGA 1ET9A 1SE2A 3QO2A 2OEOA 3ND9A 3H09A 4IUQA 4WORA 2EJMA 1SYGA 2PZUA 2D62A 5KNDA 1BBXC 1TWFB 3L3OC 4K8IA 5LHY1 2B8FA 3I73A 3TP7A 1ESRA 5C5MA 5JVH3 5M5YB 2B63B 4XXEA 3BDOA 2EY2A 5ELCA 2LMCB 4RWSC 3WOFA 3ERQA 4A3KB 2F0EA 5EJWA 3P1HA 1HA5A 1HUMA 2EY5A 2L9HA 4F8MA 2B2YC 5G3LD 1STAA 1VMPA 4DNRB 1Y8PB 4DK0A 3IKJA 3SEBA 4OGQC 2KEDA 3GTLB 2E2JB 3J7YW 2HCIA 4EQPA 2V4DA 2D9UA 5IIFA 3GV6A 5D14A 1AP0A 3BVGA 1X3QA 3U9OA 3I90A 4IURA 4WJWA 2MPMA 1TS4A 3BZDB 4H7BA 1HQMC 5EPJA 5ELBA 2OF1A 2TSSA 1HUNA 2NUCA 3K57A 4HR7B 3RZDB 2EY1A 1RF2D 1QB5D 3W3AA 5EKKA 4KY5A 2O5IC 2EYOA 4V190 4ODGA 2DY8A 3D6WA 1TY0A 4IFDJ 2L12A 1T5XD 3ND8A 1DONA 3C3LA 1KABA 3TP5A 2JEAI 1E2VA 5C4HA 3MHBA 1D5ZC 1PDQA 3HOZB 1WTXA 4KMUC 2B2VA 4KK7A 2F0SA 2DN8A 1B44D 2FJ2A 1V1OA 5E1FA 1PTOB 3M4YA 3I72A 1HFNA 3S1QB 1B1ZA 4EVOA 1VF7A 1GHJA 2EJFC 2K33A 2IL8A 4XQNA 5CV7A 5D3IB 2A6ED 4C3IG 3MFGA 3TMEA 2HUGA 1V1PA 3KLSA 3BS1A 1AW7A 1Z6HA 2VUMB 1SSOA 3MEHA 3WOEA 1LO5D 5K5PA 4FNFA 3OSOA 3QJYA 4TRDA 4V0BA 1GUTA 4FO2A 1CZWA 5BN3A 4JK1C 5C4JB 1SFOB 4B9WA 4CJ2C 1OXUA 2PO4A 3HEJA 3PUVA 3GO5A 2Q8RE 2WKDA 1WVLA 5JEAG 4B08A 1WTWA 2XIWA 1OXTA 3KBGA 1V8QA 1GUNA 3RMHA 1JR0D 4G7ZC 2KCNA 4DNTB 4FF3A 1PXUA 1TIID 2F0PA 3BDCA 3R93A 1SNCA 2JA8B 1B9MA 1O78A 4KV6A 3BVMA 3SK5A 1O7YA 4DXFA 1SJED 3EQLC 3AMUA 2RQXA 1EWHA 3HOUB 3T4AC 2FFKB 1QILA 5IGCA 3M4OB 3PIP3 4A3IB 3V05A 1SDFA 2F3WA 2SNMA 3MTSA 4MHEA 3T16A 4ABNA 1PTOH 1Q8IA 4KKSA 4ZQ3A 5KRUA 1Y69U 1G6ZA 2F03A 1S5BD 2F0VA 2B39A 1NR4A 3NQTA 1Z47A 1DOMA 1EIGA 2HQEA 2L55A 5BN5A 4IALA 4XT3B 2A6HC 1F9SA 1LTSD 2MJ8A 1A3UA 3H6MA 4NW2A 2F0IA 2XWJB 3ONAB 1ILPA 5KGUA 3HOVB 2NTTA 1EY0A 2PW7A 2VXWA 2F0QA 3K0YA 2EYJA 2FHTA 3M7NA 3I4NB 1PZJD 2L1BA 2ZXOA 5C0XH 2KA7A 3SE0A 2FINB 1H9SA 3KLRA 1EFID 2WIIB 1EY6A 2EVBA 1CTMA 4FF2A 5JAVA 1RTNA 1G2TA 1ONLA 1X32A 3GTGB 2K03A 1MGSA 3PV0A 4CGYB 2JA5B 5EKIA 3P7JA 4KJNA 1KLUD 1TS2A 4A3MB 5NUCA 3J81E 1UEAB 1LTTD 2YU9B 1SAPA 1PYWD 1D6EC 1KDAA 1UUPA 3TP8A 3MA2B 5CR3A 3GQBA 4C3HG 5F2DA 1ENCA 3HG9A 4K5XA 1TT2A 3S14B 1EIHA 5COYA 4K5WA 1LTRD 2PQEA 3HKZB 3VR3A 4UDUC 2B8GA 4C3JB 2BCOA 1IKLA 1C48A 2A6HD 3OOCA 4IUPA 1EZ6A 2I46A 4LK1C 4X3UA 3OW7A 3TP6A 2WKCA 1WD1A 2NVQB 2X69A 1F77A 1D1KA 1OXVA 2RSNA 2EYFA 2EXZA 4IUVA 2XRSD 3CQZB 1A15A 3J81L 2QEJC 2NVTB 3E5SA 4X3SA 5CBEE 1JOKA 1K83B 2KHSA 3H91A 3T53B 3SHLA 3PO2B 3VR6A 2O5JC 2B2YA 3G7LA 2BA0A 4B9XA 1HA6A 1SNOA 2F0HA 2K32A 5ELDA 2KCCA 3GP7A 2OXPA 2PZWA 2BDNA 1QJOA 2F0KA 3I4MB 1Q3LA 1LT5D 4IQZA 2VNUD 3K5OA 3A7AB 4EQNA 1LLRD 4QB4A 1EQTA 2Z4IA 4LJZC 3K5LA 2A74C 3I8ZA 5I9OA 3D4RA 1V1PB 1Q12A 1CK1A 5CORA 4TSSA 2K6AA 5M3MB 4K2KA 1GUOA 2H4OA 1WTOA 1CA5A 4X3KA 1EEID 1GUSA 4OIKA 4X3TA 1ZXTA 3JAME 1HTLD 4RGOS 1A3VA 4CKEA 4ZAIA 1PRTB 1JOOA 4GZYC 4OL7A 1PMRA 2F1MA 2J0TD 3EVQA 3MVVA 1SNMA 5JPNC 3GTQB 2G9DA 1CQVA 3CRLC 1DJRD 4DAYA 3R2TA 3MXUA 2PW5A 1BCPC 1M4VA 4H44C 3EROA 4K8JA 3Q24A 3S15B 4KN4C 5IT9E 3QIAA 5C0XJ 3OMCA 2E2IB 1KNAA 3Q22A 2Z8LA 1RKNA 3R2IA 3V96A 3MWYW 5JPMC 2F0NA 3KUPA 3M85A 2Z1CA 3J7AV 1DXMA 4PNYA 3PUYA 5J1ZA 1KDBA 4N9TA 3KBXA 2AWOA 2O4XA 1H9RA 5FLXE 3ITPA 1YNJC 2MGSA 2BDOA 2KJXA 4KD3A 2NWGA 4CBVA 3HOWB 2SOBA 4PMCA 3SDZA 2K28A 3NXWA 4PMWA 2Q8IB 5IGFA 1TS5A 5D3DA 5IT9L 2JP1A 1ILQA 2IT1A 1TR5A 2RVLA 3BYYB 3K5MA 2EOTA 3VYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BDL A;  1TQO A;  4RKL A;  4ZQ3 A;  1A2T A;  4HTH A;  4ID6 A;  3SXH A;  5IGB A;  5K5P A;  5KRU A;  1SNP A;  1EY7 A;  2OF1 A;  4K5V A;  3OSO A;  2F0V A;  4ZUJ A;  1A3V A;  3NQT A;  4TRD A;  1STY A;  1F2M A;  1EZ6 A;  2HQE A;  2NUC A;  4QF4 A;  4NP5 A;  1STG A;  3VA5 A;  3MXP A;  5C4Z A;  4YIJ A;  1JOO A;  2F0D A;  4IAL A;  1EYD A;  4K2L A;  1EY9 A;  5KYL A;  5HGT A;  3TP6 A;  4EQO A;  1JOQ A;  2F0J A;  2EY1 A;  3D8G A;  4OL7 A;  4HMJ A;  5JOB A;  3EJI A;  3DHQ A;  3EVQ A;  1A3U A;  3H6M A;  1SNM A;  3MVV A;  5CV6 A;  4E6I A;  3OMG A;  5CC4 A;  4B9W A;  2F0I A;  4HMI A;  4KHV A;  1ENA A;  5CV4 A;  2RKS A;  1AEX A;  4IUN A;  4RKB A;  4KY6 A;  5DEH A;  1EY5 A;  2OEO A;  5EKK A;  4KY5 A;  1EYC A;  4DFA A;  5KGU A;  5CGK A;  1JOR A;  2EYO A;  3HEJ A;  5I9P A;  4ODG A;  2EYH A;  4WOR A;  1SYG A;  2PW5 A;  2EYF A;  2EXZ A;  5KIX A;  2PZU A;  3NP8 A;  1A3T A;  1EY0 A;  2EYL A;  2PW7 A;  1NUC A;  1II3 A;  3ERO A;  4K8I A;  4N9P A;  3QOL A;  4MIU A;  4K8J A;  4PMB A;  2F0Q A;  3D4W A;  4R8N A;  3SK6 A;  2F3V A;  3E5S A;  1SYF A;  4F7X A;  5DAU A;  1JOK A;  5IGE A;  2EYJ A;  2KHS A;  4ZUI A;  1KAB A;  3TP5 A;  4KJO A;  3SHL A;  5C3W A;  3D4D A;  3TP7 A;  2F0O A;  3OMC A;  5C4H A;  5C5M A;  5KEE A;  3MHB A;  3C1F A;  5M9O A;  1RKN A;  5IOD A;  5EKL A;  1NSN S;  3DMU A;  3NHH A;  4NKL A;  5HUR A;  2EY2 A;  3P75 A;  2PYK A;  4J6H A;  5IOC A;  5CV8 A;  5J22 A;  3SR1 A;  2F0P A;  3BDC A;  4B9X A;  1SNC A;  2QDB A;  3S9W A;  4LAA A;  1SNO A;  3NK9 A;  3OWF A;  2F0H A;  4DGZ A;  3ERQ A;  2F0W A;  2F0S A;  2F0N A;  5E3F A;  2F0E A;  5KYI A;  2KQ3 A;  1EY6 A;  1SND A;  1SNQ A;  4KV6 A;  1F2Z A;  2LKV A;  4NDX A;  3P1H A;  2F0L A;  3SK5 A;  2OXP A;  2PZW A;  3LX0 A;  1EQV A;  4KY7 A;  4NMZ A;  4PNY A;  1STB A;  2EY6 A;  2F0K A;  5E1F A;  4I65 A;  3SK8 A;  5J1Z A;  1KDB A;  2EY5 A;  1IHZ A;  5JAV A;  4N9T A;  1EY8 A;  5IGD A;  5C6A A;  1A2U A;  4F8M A;  5EGT A;  4G57 A;  5CV9 A;  3T13 A;  5IGG A;  1STA A;  1U9R A;  4IZ8 A;  4KD4 A;  2RBM A;  3RUZ A;  2O4X A;  3MZ5 A;  4K6D A;  4EQN A;  4QB4 A;  2F0U A;  3ITP A;  1SYB A;  5CV5 A;  4EVO A;  4ME5 A;  5I6Y A;  1F2Y A;  3HZX A;  2F0T A;  3R3O A;  4KJN A;  2F0G A;  3V2T A;  2ENB A;  1STH A;  5IGC A;  2RDF A;  4KD3 A;  4EQP A;  3QOJ A;  2SOB A;  5NUC A;  4PMC A;  5C5L A;  4S3S A;  1EYA A;  5C3X A;  5I9O A;  3D6C A;  5CV7 A;  3NXW A;  4KTA A;  2WAC A;  2F0F A;  3NUC A;  5IIF A;  5IGF A;  3TME A;  4WRD A;  4K14 A;  1KDA A;  3PMF A;  4K2K A;  3TP8 A;  5CR3 A;  1KDC A;  1EY4 A;  5F2D A;  1SYE A;  2F3W A;  1ENC A;  2SNM A;  2SNS A;  3QB3 A;  1TT2 A;  4K5X A;  4DF7 A;  5I6W A;  5ISR A;  3U9O A;  4DU9 A;  2F0M A;  1TR5 A;  3C1E A;  1SYC A;  5J39 A;  1KAA A;  4K5W A;  4J1M A;  2M00 A;  2EYP A;  2PZT A;  4QMG A;  1EZ8 A;  1STN A;  2EYM A;  3SK4 A;  2PQE A;  3T16 A;  3MEH A;  1SYD A;  4H7B A; 
#chains in the Genus database with same CATH topology
 2ID0 A;  2RSO A;  1L0W A;  4PV1 C;  1ZEQ X;  1JJ2 A;  4J8Q A;  4FXK C;  4HJ9 A;  1MSG A;  1IZ6 A;  4NP5 A;  3J81 j;  1VQ7 A;  4QQB X;  1A0I A;  4E6I A;  1BCP D;  3PUZ A;  4IUU A;  4RKB A;  5M3M H;  1GXD C;  1U4P A;  4L63 B;  1EUJ A;  5FLX L;  4LNQ A;  5I9P A;  2DNC A;  1I4X A;  1IYV A;  2BH8 A;  1TWH B;  3M9B A;  4LF9 Q;  2WAQ G;  4MIU A;  1PFB A;  4JI7 Q;  4R8N A;  3LGJ A;  4RHR A;  1N9W A;  1YJ9 A;  3U4Z A;  5IGE A;  2F0O A;  5KEE A;  1XYI A;  1H9S B;  1NSN S;  1LM0 A;  3Q0A A;  3NWS A;  1HXY D;  2CQO A;  4A3C H;  1KXL A;  1EL0 A;  3UDF A;  3NK9 A;  3OWF A;  5E3F A;  3N52 A;  3GTQ H;  3AB9 A;  3CHB D;  3L2P A;  4ME3 A;  1HTP A;  1H9J A;  1HNZ Q;  4RFB A;  1WTV A;  2GA4 B;  1YNJ D;  1QUQ B;  3A56 A;  1VQD A;  4U68 A;  1RIP A;  1YJN A;  1JC7 A;  3J81 c;  1I6V C;  3S15 H;  3FDT A;  2HIV A;  4C56 C;  3J80 c;  4ILW A;  4I7Z C;  5KNB A;  2EDG A;  1PH2 A;  2B2U C;  1S5C D;  4DR6 L;  4CJ0 B;  1LT3 D;  4OWX B;  2E2I H;  4JBK A;  1EYA A;  3Q6S A;  2UUC L;  3D6C A;  4PZ8 A;  1UWV A;  4CKC A;  3DEP A;  3VA7 A;  2A73 B;  3T56 B;  1B3A A;  2Z6B A;  1E2W A;  3CPF A;  3A55 A;  4EQ5 A;  1OXX K;  1U4L A;  1E2Z A;  1PFM A;  2F0M A;  5LMN Q;  4OO1 G;  1SYC A;  4RGM A;  2PZT A;  2VQF L;  1GJX A;  3MXN B;  3K0X A;  1CA6 A;  4BXX G;  4H02 A;  3SXH A;  1W6K A;  5J3B A;  2B63 G;  2M9V A;  4K5V A;  3MC0 B;  4C2M B;  1BDO A;  1FL0 A;  1STY A;  1VQL A;  1QWY A;  4A3K G;  1TWC B;  1E0B A;  2IHE A;  3T1Y L;  2VL6 A;  4X64 L;  3Q23 A;  1WTP A;  3W5O A;  3DXJ C;  1BQQ T;  1I4Q A;  3KK7 A;  3LWE A;  4DR1 L;  5CV6 A;  4DR3 Q;  1HNX Q;  4L5T A;  1DOK A;  3HKZ E;  2ZT9 C;  3R8B A;  2IY5 B;  5CV4 A;  1VQ6 A;  1BBW A;  4BBR B;  1K8G A;  4HSV A;  2M2L A;  2CWP A;  4YHH Q;  4A3J B;  3RZO B;  1NCV A;  2NZ1 D;  1KQS A;  5IYB H;  4JI8 L;  4OX9 L;  3X3N A;  5T1G A;  4DV7 L;  2QIL A;  4L8J A;  3K8A A;  1CUK A;  3VR2 A;  4B3T Q;  2K5V A;  4OO1 I;  1WD0 A;  4GKJ Q;  1M1K C;  2JA6 B;  1Q90 A;  1V43 A;  1AN8 A;  4C3I H;  1TS3 A;  1ET6 A;  1NBW A;  1L1O A;  1YHA A;  3A8J E;  2ZTD A;  3S24 A;  1VMC A;  1XMO L;  1IL8 A;  4JW0 A;  1YHQ A;  3P20 A;  5FKA C;  5FO9 B;  1HJP A;  2PYK A;  3K80 C;  2Q2H A;  3SR1 A;  4O2D A;  5FK9 C;  2KEN A;  4RCN A;  1BR9 A;  2KEE A;  4C1N K;  1E22 A;  5DM6 3;  3H15 A;  4DV0 Q;  5M5W B;  2E2D C;  1KD1 C;  2EXD A;  4HSP A;  3W1B A;  3HOY H;  4BA1 I;  2C35 B;  2K14 A;  1SLJ A;  4BY1 H;  2N49 A;  2A5H A;  1NJI C;  2KUM A;  4FVM A;  2BA1 A;  4X65 Q;  5EGT A;  1TWH H;  5IGG A;  2ES2 A;  4KD4 A;  2RBM A;  4DV1 Q;  1EIY B;  1DM0 B;  4FYD A;  1JWU D;  2IW3 A;  1K73 C;  4L5R C;  3L9A X;  2P5Z X;  3GTO B;  3PO3 H;  1BUV T;  4RHS A;  4LF4 L;  1Q86 C;  4DF7 A;  2HDL A;  4B3M L;  3NBI A;  1PLF A;  1F9Q A;  1IW7 C;  1PVO A;  4QMG A;  3URY A;  3CW2 C;  1FD7 D;  4RGN A;  3S1N H;  2CCZ A;  1GUG A;  3L0O A;  3EIV A;  3S1M B;  1BKB A;  3TN2 A;  1MI2 A;  1CZG A;  1EY7 A;  1LUZ A;  2LSS A;  3J7A 5;  1SMY C;  3HOZ G;  4GKK L;  3H3V C;  2WB1 B;  3OIQ A;  4AH6 A;  4LF6 L;  2IWH A;  2OT2 A;  1XJV A;  2F0D A;  3KJP A;  5HGT A;  2JK8 A;  3A74 A;  2F0J A;  1W6J A;  2KEC A;  5FLM H;  3I2Z A;  1N34 L;  3J7A F;  1D5X C;  3RLF A;  1R4P B;  1VQA A;  2D2C C;  2FMC A;  4DAY B;  4IUN A;  2Q2T A;  4JI1 L;  1EYC A;  1XWE A;  5DLQ E;  2JXM B;  1LTB D;  1AZP A;  5IT9 c;  1XPR A;  1Q1E A;  3G48 A;  3FP9 A;  1HHV A;  2RDG A;  3A8K E;  1B4O A;  3U9S A;  1MBY A;  3K7A B;  2K7V A;  3QOL A;  5LL6 S;  1CT1 D;  3SK6 A;  2HIX A;  2JSO A;  1LTI D;  4KHZ A;  3T1H L;  1Y1W B;  4TQU S;  4HIK A;  3LNN A;  4WFN 3;  1ML0 D;  1DZ1 A;  5C3E G;  3H94 A;  1HRJ A;  2DJG C;  2VUM G;  3E0J A;  1IXR A;  3K6O A;  1NMF A;  2KOL A;  2IX3 A;  1ASZ A;  4KHP Q;  4DK6 C;  4DR6 Q;  4G7O C;  4FF4 A;  4LF8 L;  4QUF A;  4JPB W;  2UUC Q;  2ZTC A;  3KOJ A;  1PZI D;  1N8R C;  3OTO L;  3RZO H;  2IX1 A;  3M3Y B;  5T1I A;  1IHZ A;  3HS0 C;  3GTM H;  3EFX D;  5CV9 A;  3T13 A;  3DWP A;  5C0X G;  1WTR A;  2MFI A;  1I4H A;  2K5N A;  2JA6 H;  1JQY D;  4XT1 B;  2VQF Q;  1MD2 D;  3F1Z A;  1Y8N B;  3KLW A;  3GD7 A;  4TVA B;  3HOX B;  4DA2 A;  2CH4 A;  2ENB A;  1FJG Q;  1YNN C;  3K81 C;  4Z9C B;  1KTK A;  5C3X A;  3QG1 A;  3ZYY X;  5LMU L;  3VR4 A;  3NUC A;  2KHJ A;  1IW7 D;  3T1Y Q;  1QNK A;  4X64 Q;  1DYQ A;  1FVI A;  1M90 C;  4RG1 A;  3PUW A;  5M5W H;  4DR1 Q;  2CW0 C;  4J1M A;  5CMD A;  1XPO A;  1SMY D;  2QDL A;  1AFP A;  1EZ8 A;  1STN A;  3CCM A;  2CQA A;  4NPS A;  1TQO A;  4RKL A;  4DAP A;  1A2T A;  2WP8 J;  2A68 C;  4JI8 Q;  2WIN B;  4OX9 Q;  5I2X A;  5C0X I;  4DV7 Q;  2JA8 G;  1LAB A;  4QF4 A;  3MXP A;  5C4Z A;  1ROD A;  3CCQ A;  4JI0 Q;  1GO3 E;  2N88 A;  3HFZ B;  3M4P A;  5IYC H;  2OQ0 A;  5M3F H;  5E4X A;  3DWA A;  3FHW A;  2AUK A;  2OWO A;  2A19 A;  1HFG A;  3HOU G;  4L5Q A;  1VQG A;  2AQ3 B;  3LWU A;  1WCM B;  2DNE A;  3BG3 A;  4BA2 I;  3T51 B;  3MXN A;  2MNA A;  4XQQ A;  3G6E A;  3BYT B;  2NVY B;  1NUC A;  4N9P A;  1OO9 B;  4DV4 L;  3D4W A;  3S1M H;  4A3I G;  2F3V A;  1XTD A;  1SYF A;  5C4X B;  1RJT A;  2R7F A;  3CCJ A;  1OXS C;  2MHV A;  4KJO A;  5C3W A;  4C3H H;  1C9O A;  1ICW A;  2K5W A;  4LWC A;  1ZYR C;  4POG A;  3DMU A;  3OWE B;  2R93 B;  1JE5 A;  1LT4 D;  4NKL A;  1V1Q A;  4J6H A;  5J22 A;  1J8I A;  3FKI G;  3PIO 3;  2A69 C;  4R1J A;  2R6G A;  1SRO A;  2F0L A;  2Z6K A;  2KCM A;  1P16 A;  4KY7 A;  1STB A;  2AWN A;  3SK8 A;  4AIM A;  4P72 A;  4P74 A;  4GNX C;  3A0J A;  4BBS B;  1C7Y A;  4IPD A;  1G51 A;  1Z9F A;  4LF4 Q;  1WTH A;  5JJZ A;  1Y8O B;  1A2U A;  2N55 A;  1U9R A;  4IZ8 A;  4B3M Q;  3K7A H;  2VB3 X;  1FR3 A;  1YNN D;  1Q46 A;  2F0U A;  3KDF A;  1L0Y B;  4UAI A;  3A5Z B;  2JYO A;  5DM7 3;  3M7G A;  1AZQ A;  1H9K A;  1HCZ A;  1X65 A;  3Q8D A;  3STB C;  1YIJ A;  1VQ8 A;  4S3S A;  4IFD G;  3HOV G;  2I07 B;  1DCZ A;  4GKK Q;  4APV A;  4ZYS A;  4LF6 Q;  2R3Z A;  4JI7 L;  3W2D A;  2CW0 D;  1VQK A;  4JI6 L;  2ICI A;  1XXG A;  3QWN A;  1CSQ A;  4NXN L;  5IP9 H;  2A68 D;  2EYP A;  3D3R A;  3CAM A;  2AQ1 B;  1X54 A;  2C5C A;  4HJ7 A;  3M3Y H;  4JI1 Q;  2RF4 A;  2K52 A;  5IGB A;  1M8A A;  2RA4 A;  3OHX C;  1STE A;  5ELN A;  4JI4 Q;  3FPP A;  2ZXP A;  4ZUJ A;  3K5N A;  1F2M A;  3VA5 A;  3DM1 A;  4IJH A;  1I50 B;  4ULL A;  1GM5 A;  1XTC D;  1VS0 A;  4JI5 L;  3T1H Q;  1GD7 A;  1R9T B;  3EJI A;  3TZU A;  2K1B A;  1BCP F;  4IFD I;  1AEX A;  1EU3 A;  3FPU B;  3KF8 A;  1Q1B A;  4ZK9 B;  4DFA A;  4DAM A;  1YVC A;  3H0G G;  1CHQ D;  1L0X B;  1D8L A;  1RDP D;  2NN6 G;  1PH5 A;  1C0A A;  5GAE C;  1L1O B;  1QG7 A;  1GHK A;  4A3M G;  2O2L D;  2JA7 G;  3OTO Q;  4R9W A;  4F7X A;  2AUJ D;  2I5M X;  4ZUI A;  4DK1 A;  1EIF A;  1EWI A;  3D4D A;  4UP8 A;  5A35 A;  2HT1 A;  2J4X A;  3CCS A;  3TRZ A;  5LMN L;  2A69 D;  5M9O A;  4DV3 Q;  1HQR D;  2WFW A;  3EA6 A;  1K3R A;  5HUR A;  2NBF A;  5AJ3 L;  4IOC A;  2UU9 L;  3ER0 A;  5IOC A;  1E1T A;  4A3G H;  5EBC A;  4A3D G;  5K36 G;  3I91 A;  3HKZ G;  2F0W A;  4C3J G;  5H1S E;  2B2U A;  3DWQ A;  5LMU Q;  2R92 G;  1MSH A;  1WCM H;  1CHP D;  1PHJ A;  4O42 A;  5EQ0 A;  4KN7 C;  3TS2 A;  4MNO A;  4IPG A;  4MTN A;  3MAQ A;  1H9M A;  2PNR C;  4DR3 L;  2L15 A;  1GVP A;  3STB D;  2UXD L;  1J6Q A;  4CDE C;  2NN6 I;  1SYB A;  5CV5 A;  5C4X H;  1F2Y A;  3RD4 A;  2K04 A;  2RDF A;  4GLX A;  5C5L A;  4X6A H;  4R8I A;  3JAM L;  4KTA A;  2R93 H;  2F0F A;  4M8A A;  1SXT A;  3OYY A;  4BY7 G;  1KDC A;  2J7Z A;  1TVX A;  1PTO C;  3QB3 A;  5ISR A;  1B2T A;  3H3V H;  3NPP A;  3N6R A;  4BBS H;  1C4Q A;  3ICE A;  1CSP A;  3PO2 G;  1QE6 A;  2AMC B;  3ULJ A;  1KNE A;  4JCV E;  3G6J B;  1EYG A;  2DGY A;  2QF7 A;  3S16 B;  1NNX A;  4A93 G;  3GTJ B;  5C44 B;  3NTI A;  3PIP A;  1B8A A;  4DV4 Q;  3NQI A;  2BE5 C;  2L5T A;  4YIJ A;  4K2L A;  2MUY A;  1D1I A;  3D31 A;  1CKN A;  2K05 A;  3I4M G;  3MFY A;  3I4O A;  4JV5 Q;  5CC4 A;  4JC0 A;  4DV1 L;  2RKS A;  1UAP A;  2PQA A;  3BZC A;  2JEB I;  4A3L G;  4HCE A;  2LFN A;  2LS0 1;  2L0C A;  1XNQ L;  4C3I B;  2WB1 E;  2VW9 A;  2EYL A;  4XIG S;  3O13 A;  2KHI A;  4OEL B;  3VR5 A;  3CCR A;  3RN5 A;  5IP7 G;  3CF5 A;  2HHH L;  2NTS A;  5DAU A;  2CHB D;  1VDZ A;  4DUY L;  3TSS A;  5L37 A;  2ZJQ A;  1G91 A;  4AYB G;  2WV6 D;  3RLO A;  1R4Q B;  3WWV A;  2UXC L;  5FJ8 H;  4ZKB B;  5IOD A;  1HZ9 A;  1I50 H;  4U67 3;  1Y1V G;  2UUB L;  3HOY B;  4Y52 H;  2QA4 A;  3CP0 A;  1F9R A;  3NSW A;  2B2W A;  1R9T H;  1OTC A;  1EU4 A;  2XVS A;  4BY1 B;  2KQ3 A;  4CHT B;  4NDX A;  4NMZ A;  3LX0 A;  5IWA L;  4P73 A;  5BN4 A;  1TXY A;  2EQS A;  3WDN A;  3NE5 B;  1PH6 A;  2MP1 A;  1MJE A;  1IBK L;  1WFQ A;  4DUZ Q;  4JI6 Q;  3AU7 A;  1PV4 A;  1ZKO A;  2A6E C;  2RCF A;  3C2P A;  4QY7 A;  4JI2 L;  4PG3 A;  3RUZ A;  4F87 A;  4NXN Q;  1SJH D;  5CYU A;  2KCT A;  2K5D A;  2Q2I A;  3S1R B;  2F0G A;  4XYO A;  3PO3 B;  1VQO A;  1B50 A;  2CVR A;  2VY3 A;  4LUZ A;  1PTO D;  1A6X A;  1TWA B;  2NYZ D;  4JI3 L;  1GUW A;  5E4W C;  4HAE A;  4P71 A;  1B9N A;  1EY4 A;  3S1N B;  1SYE A;  2R7D A;  4JI5 Q;  5M5X H;  1K9M C;  1D7Q A;  2F52 A;  2AQ2 B;  1IYU A;  3BDL A;  3I3C A;  4KHP L;  2BE5 D;  1I4P A;  1KAW A;  1BCP B;  4N8X 1;  3X3M A;  4KKU A;  1NAP A;  5FO7 B;  1QCB D;  5FO8 B;  3AYH B;  4HN7 A;  1A62 A;  1LV9 A;  4NB3 A;  1HR0 L;  4EQO A;  1JOQ A;  1VCI A;  2B2T C;  3F8T A;  4LF7 L;  4FXG C;  4MTK A;  4N8F A;  2VB2 X;  4KY6 A;  5AJ3 Q;  4OHJ A;  2UU9 Q;  1I3Q H;  1JWM D;  1FJG L;  3CXC A;  2XRQ D;  3DUZ A;  2OCE A;  2PNH A;  1A3T A;  2BOS A;  2Z4H A;  2ASB A;  4L6T B;  3HOW G;  1HPC A;  1LAC A;  2RCN A;  1O80 A;  3S16 H;  3I70 A;  3GTJ H;  5C44 H;  1IKM A;  4R4O A;  1NTG A;  4MZ9 A;  2UXD Q;  2Q8T A;  4OO1 H;  1I4G A;  4M1U B;  3S2D B;  3NTH A;  2X6G A;  3DEO A;  4KKT A;  4PZ7 A;  4FF1 A;  4BXX H;  1VF5 C;  5KYI A;  1WTQ A;  3IAY A;  3AFP A;  3PIO A;  3GTM B;  5EBD A;  4GN5 A;  1FYC A;  1RHP A;  4DV6 Q;  3TS0 A;  4JI0 L;  2GN5 A;  4UPA A;  5C3E B;  1UNS A;  3ZJY C;  3FEW X;  3KDF B;  2DUD A;  4XTC S;  1I4R A;  4K6D A;  4RCO A;  3S17 B;  1PFN A;  3NTK A;  4A3E B;  2QGQ A;  3C46 A;  4DV2 L;  4ME5 A;  2F0T A;  2HCC A;  4IN3 A;  1Z7T A;  2E2H B;  3I55 A;  4O0A A;  3W1G A;  1G2S A;  1SEB D;  4KI0 A;  3CMA A;  1QNU A;  2WAC A;  2YV5 A;  4G4K A;  4POF A;  1IBM L;  3OPO A;  1JWS D;  1LYL A;  3G4S A;  2QCP X;  1TKW B;  3B6Y A;  1QZH A;  3C1E A;  4YWM A;  2LY7 A;  1BO0 A;  3RNU A;  2M00 A;  4LFA L;  2CKZ B;  5CBA E;  1SYD A;  2H1E A;  4O1N A;  2B2W C;  1K8M A;  1XNQ Q;  4Y7N B;  3SVM A;  4MN3 A;  5M3F B;  1ENF A;  3A54 A;  2K5Q A;  1STG A;  2SDF A;  3S1R H;  5JEA H;  2HHH Q;  2YTV A;  4NXM L;  1X3E A;  4DUY Q;  5TSS A;  3NEM A;  1TWA H;  3DHQ A;  3KF8 B;  3FRP B;  4H0L C;  2UXC Q;  2CWA A;  3JAM c;  4CJ1 B;  4YCV A;  4RAU C;  4KHV A;  1I6H B;  1YIT A;  3FVQ A;  4RMF A;  1VQ4 A;  2UUB Q;  2SEB D;  4BS9 A;  2N8N A;  2X6L A;  1Y14 B;  4ZRZ A;  4JBJ A;  4PQX A;  2EPB A;  1II3 A;  3F2U A;  1EEF D;  4C3H B;  1U4M A;  5GQO A;  5IWA Q;  4JYA L;  3M4Q A;  1D5M C;  4HCS A;  4OWT B;  5JVG 3;  1EWC A;  1IBK Q;  1IL2 A;  5D65 A;  3PUX A;  4GNX A;  1QZG A;  1C8C A;  3QR8 A;  4UP7 A;  3HP3 A;  4QCL A;  4JI2 Q;  4DAV A;  3C1F A;  3NBH A;  3IL8 A;  4OEM B;  4OXP A;  3KFU A;  1JE4 A;  3NHH A;  4DR7 L;  3E6Z X;  4HED A;  1UE6 A;  1AE2 A;  4QIW B;  2NB0 A;  1KHI A;  4LF5 L;  1VQH A;  4JI4 L;  1SNQ A;  2QKI C;  1F2Z A;  5EPK A;  4JI3 Q;  3HOZ H;  1BNZ A;  2EIF A;  1S5E D;  2EY6 A;  3I56 A;  4JBW A;  1TU2 B;  4RH6 A;  1BVS A;  5C6A A;  4FP5 D;  1S3O A;  4A76 A;  1E1O A;  3FKI B;  4CDF C;  1JT8 A;  4A3B B;  2XSC A;  5I6Y A;  2B2V C;  5AFW A;  3R3O A;  4BBR G;  2XN9 C;  3QOJ A;  3S1Q H;  2F4I A;  4A3J G;  4RA8 A;  3S2D H;  2ZXR A;  1NMG A;  3ULL A;  4WRD A;  5FLX c;  4K14 A;  1K8O A;  1HR0 Q;  3CD6 A;  3OIP A;  4LF7 Q;  4DV3 L;  1S4Z A;  4GN3 B;  4HMJ A;  4A3F B;  1CFM A;  4K0K Q;  2PCF B;  5C3E H;  4HTH A;  3VYU A;  1PRT F;  3CPW A;  3IFD A;  2ZJP A;  1YI2 A;  5LMN W;  3S17 H;  2K01 A;  4A3E H;  4G7H C;  1CKM A;  1SE4 A;  1CKN B;  4BWG B;  2HDM A;  1S5F D;  3S2H B;  1EY9 A;  2JE6 I;  1NR2 A;  2E2H H;  3D8G A;  4GOP C;  2VZA A;  1YNX A;  1F9P A;  1MHW C;  2PQA B;  3CU7 A;  2K50 A;  4HMI A;  3EBE A;  4ZCK A;  3A7L A;  4DKA C;  5CGK A;  2XGT A;  2EYH A;  4ZLT F;  4OWW B;  4C1N I;  1XX8 A;  4H13 C;  4A75 A;  1N32 L;  4PMB A;  2E8G A;  5IYC G;  4HIO A;  1X55 A;  1PRT C;  3RR5 A;  1PH3 A;  1DD2 A;  3PF4 A;  4JBM A;  4Y7N H;  4A3G B;  2F4V Q;  2D5D A;  1U4R A;  1N33 L;  1VQ5 A;  2YTX A;  3H0G B;  1VQB A;  1RTO A;  3L7Z C;  5EKL A;  3J81 i;  4DV2 Q;  2Y0S B;  5A2Q E;  4LUV A;  2EJG C;  3J80 i;  3S9W A;  2QDB A;  4LAA A;  4XDX A;  5JJI A;  1CI3 M;  3KYH C;  2JA7 B;  1I6H H;  5KNC A;  1JIC A;  5ELE A;  3J80 E;  1EQV A;  1JJC B;  1KRT A;  4DXG A;  1TY2 A;  2JA8 H;  1KLG D;  2WB1 G;  1GOZ A;  3KJO A;  1IBM Q;  4IPC A;  1EY8 A;  2GVA A;  2YYZ A;  3UE0 A;  1QVF A;  4CKB A;  4P2C B;  3MZ5 A;  4JV5 L;  2MO0 A;  4A3D B;  2E76 C;  3I4L A;  2C9O A;  4LFA Q;  3HGB A;  4LFC L;  2L11 A;  2E74 C;  1G29 1;  4PZ6 A;  4F88 A;  5ELO A;  3HZX A;  3V2T A;  4XYQ A;  2PPB C;  2D0P A;  2R92 B;  1STH A;  3TDQ A;  3CRK C;  1LTA D;  1QVG A;  3NWT A;  1RCV D;  4DN4 M;  2LXK A;  4GS3 A;  2ICE C;  1QOH A;  4A4I A;  1K3B C;  3PMF A;  5EPL A;  2R7Z B;  1O7Z A;  2IPK D;  1FNU A;  2SNS A;  1WYD A;  4NXM Q;  3HRZ C;  2UUA L;  5I6W A;  4YWK A;  5DNF A;  3A8I E;  3CCL A;  3E3X A;  3U4V A;  5J39 A;  4K6L A;  1Y1W G;  1LTL A;  3NEL A;  3OW2 A;  5A2Q L;  4B3S L;  1AE3 A;  3GTK B;  3FKI H;  5I4D A;  4FXD A;  4BY7 B;  2QW7 A;  5JEA J;  2IJ0 A;  2NVX B;  4A3B H;  2DY7 A;  2TMP A;  4JYA Q;  1DOL A;  3J80 L;  1EYD A;  3E0E A;  4DUZ L;  5I2Y A;  1A63 A;  2E75 C;  1G8Z D;  1PZK D;  2EZV A;  1XPU A;  1ENA A;  2XNA C;  1EY5 A;  3GTP B;  3PF5 A;  4DR7 Q;  3I4N G;  4A93 B;  1JOR A;  3MEF A;  2PI2 A;  4LMQ D;  1PRT D;  2RDH A;  4IOA A;  5KIX A;  3VYT A;  3HOX G;  4LF5 Q;  3NP8 A;  4IUT A;  3VYR A;  1WOC A;  4A3F H;  1BBU A;  5IYD H;  1RD9 D;  4IFD H;  3U50 C;  1Q81 C;  2EE1 A;  4GLV B;  3TZD A;  5G3L F;  4RGT A;  1B3Q A;  4TKO B;  1PFS A;  1UE1 A;  2G9H D;  1CM9 A;  3AFQ A;  1BOS A;  3GV3 A;  3S2H H;  2Q2U A;  3P75 A;  1ESF A;  5CV8 A;  3I7F A;  3K59 A;  1EFW A;  4DGZ A;  2QEX A;  2IX0 A;  4Q0F A;  2XTI A;  1SND A;  2JA5 G;  2LKV A;  4AYB B;  3CC2 A;  1NE3 A;  4I65 A;  3A5U A;  1EOV A;  1FNV A;  1FGB D;  1ZYR D;  5IGD A;  1F2L A;  2L4N A;  1T5E A;  1Y1V B;  4G57 A;  3D0F A;  1LTG D;  1YHB A;  2FMM A;  5HY6 A;  2KVM A;  4QUC A;  3MXG A;  1HR0 W;  4ZKC B;  1TWG B;  1K28 A;  2WAQ B;  4YY3 L;  1SBB B;  2R61 A;  1O7L A;  1PTO F;  3H0G H;  1WCM G;  5ELF A;  3IFT A;  3K7U C;  5M5X B;  1ASY A;  2NN6 H;  1EOT A;  1LT6 D;  4Q5V A;  4A3M H;  3TBI B;  4X62 L;  3CKI B;  2JA7 H;  5FOB B;  2MQH A;  4XQJ A;  1YBY A;  4DU9 A;  2XWB B;  2B2T A;  3KLS X;  1KAA A;  1JB3 A;  5IE8 A;  1NY4 A;  2PMZ B;  3UI2 A;  1CQF A;  3FMC A;  1J9O A;  2EYM A;  5DEH A;  1X3P A;  3SK4 A;  1BF4 A;  4ID6 A;  1SNP A;  3K58 A;  1HZA A;  3BVZ A;  4A3D H;  5K36 H;  1D2B A;  1B53 A;  4C3J H;  1X6O A;  1FNW A;  1N32 Q;  1PH4 A;  2R92 H;  4EGV A;  5KYL A;  4OIJ A;  4DV6 L;  1SE3 A;  1S5D D;  4BBS G;  3TEH B;  1BXT A;  5LL6 X;  5JOB A;  1I3Q B;  2PI2 E;  1JCK B;  4DR4 L;  3OMG A;  1ET9 A;  4I7A A;  1N33 Q;  1SE2 A;  3QO2 A;  2R7Z H;  2F3I A;  1PH7 A;  2OEO A;  3ND9 A;  3BZK A;  3H09 A;  4IUQ A;  4JVZ A;  4WOR A;  2EJM A;  1SYG A;  1KIX A;  1QVC A;  2NVQ H;  2PZU A;  2D62 A;  5KND A;  1BBX C;  1TWF B;  3L3O C;  4K8I A;  4GNX B;  2IHF A;  2B8F A;  5LHY 1;  3I73 A;  2D0O A;  3NBH B;  3GTK H;  4BY7 H;  1IBL L;  4LUO A;  3TP7 A;  2NVX H;  1ESR A;  5C5M A;  4QJF A;  2NVT H;  5JVH 3;  5M5Y B;  1K83 H;  2B63 B;  4XXE A;  3BDO A;  4LFC Q;  2EY2 A;  5ELC A;  4ALP A;  5IY0 A;  3PO2 H;  2LMC B;  4RWS C;  2I5L X;  3ERQ A;  3WOF A;  4A3K B;  2F0E A;  5EJW A;  3P1H A;  4YWL A;  3GTP H;  4A93 H;  1HA5 A;  1HUM A;  2EY5 A;  2L9H A;  4F8M A;  2B2Y C;  5G3L D;  2ZM6 L;  2UUA Q;  1STA A;  2Z9H A;  1VMP A;  5M3M G;  4DNR B;  3I4M H;  1Y8P B;  4DK0 A;  3IKJ A;  3SEB A;  4OGQ C;  2KED A;  3GTL B;  3PSI A;  1K0S A;  2E2J B;  3J7Y W;  4QIW E;  4DR2 L;  2E5L L;  2VQE Q;  2HCI A;  3JC6 6;  4EQP A;  4B3S Q;  4A3L H;  1A8V A;  4B3R L;  1K8A C;  2JQO A;  2MO1 A;  1V9P A;  2V4D A;  2D9U A;  5GAH C;  5IIF A;  3GV6 A;  3RN2 A;  5D14 A;  5IP7 H;  1AP0 A;  3BVG A;  1X3Q A;  3U9O A;  2ATW A;  5JJK A;  3I90 A;  4DV5 L;  1RL2 A;  4IUR A;  3NEN A;  4A3C G;  4WJW A;  2MPM A;  1TS4 A;  3BZD B;  4H7B A;  2ALY B;  1B70 B;  1HQM C;  1Y1V H;  5EPJ A;  4LW1 A;  5ELB A;  2K4K A;  2OF1 A;  2TSS A;  2GVB A;  1HUN A;  2NUC A;  3K57 A;  1TWG H;  4HR7 B;  1X3G A;  3RZD B;  1H95 A;  1WI5 A;  2EY1 A;  1RF2 D;  4R4T A;  1QB5 D;  3W3A A;  4UP9 A;  1N36 L;  2OTJ A;  5EKK A;  4KY5 A;  1XNR Q;  1SN8 A;  2O5I C;  2EYO A;  4V19 0;  3IRB A;  4ODG A;  2DY8 A;  2I5H A;  3UDX A;  3D6W A;  1TY0 A;  4IFD J;  1HZB A;  4AQY Q;  2L12 A;  1T5X D;  1K0R A;  1SR3 A;  3ND8 A;  4QL5 A;  2JN4 A;  1DON A;  3C3L A;  4X66 L;  1KAB A;  3TP5 A;  2JEA I;  1VQE A;  1GKH A;  1E2V A;  5EAY A;  5C4H A;  1MKH A;  3MHB A;  2K5H A;  3SGI A;  4HID A;  1D5Z C;  1PDQ A;  4J15 A;  3HOZ B;  1MJC A;  4K0K L;  1WTX A;  4KMU C;  2B2V A;  4KK7 A;  2F0S A;  4YY3 Q;  2DN8 A;  1B44 D;  2NZH A;  2FJ2 A;  1V1O A;  5E1F A;  1PTO B;  4DK3 C;  5C44 G;  3TRE A;  3UDI A;  4X62 Q;  1TWF H;  2LXJ A;  3M4Y A;  2H5X A;  3I72 A;  1HFN A;  2Y0S E;  3S1Q B;  1B1Z A;  4EVO A;  1PYB A;  1VF7 A;  5GAD C;  1GHJ A;  5IYB G;  2EJF C;  4JOI C;  2K33 A;  2IL8 A;  4XQN A;  5CV7 A;  4R4C A;  5M5Y H;  5D3I B;  2B63 H;  2A6E D;  3E9H A;  4C3I G;  3MFG A;  3TME A;  2HUG A;  1V1P A;  3KLS A;  3HOW H;  4A3K H;  3BS1 A;  1AW7 A;  1Z6H A;  2F4V L;  4GOP A;  2VUM B;  1X56 A;  4DR4 Q;  1T9H A;  1SSO A;  1UEB A;  3MEH A;  3WOE A;  1LO5 D;  5K5P A;  1SE8 A;  1IYJ B;  4FNF A;  3HOY G;  3OSO A;  3QJY A;  4TRD A;  2FXQ A;  4V0B A;  3GTL H;  4BY1 G;  1I94 L;  2E2J H;  1GUT A;  1JB7 A;  3EN2 A;  1I5F A;  2K75 A;  4LFB L;  4FO2 A;  1CZW A;  5BN3 A;  1IBL Q;  4JK1 C;  5C4J B;  1SFO B;  4B9W A;  4QGU A;  4CJ2 C;  1OXU A;  1HZC A;  2PO4 A;  3KF6 B;  5GRO A;  3HEJ A;  4YCU A;  3PUV A;  3GO5 A;  5GAG C;  2Q8R E;  2WKD A;  4UHV A;  1WVL A;  5JEA G;  3PO3 G;  4B08 A;  4CDC C;  1YEZ A;  3F2D A;  1MIU A;  1WTW A;  2ZTE A;  2XIW A;  4KLK A;  1OXT A;  3KBG A;  1V8Q A;  2Z0S A;  1GUN A;  2ZM6 Q;  3RMH A;  2V1C C;  1JR0 D;  4G7Z C;  4DNI A;  2KCN A;  4DNT B;  1S72 A;  3RZD H;  4FF3 A;  1PXU A;  1TII D;  2F0P A;  3BDC A;  3R93 A;  1SNC A;  4DR2 Q;  2E5L Q;  2JA8 B;  1B9M A;  3GDE A;  1O78 A;  2B29 A;  4B3R Q;  4WJ3 M;  1VQJ A;  4KV6 A;  3BVM A;  3SK5 A;  2AHO B;  1O7Y A;  4DXF A;  5FLM G;  1SJE D;  1X3F A;  1VQF A;  2A1A A;  3EQL C;  3CC4 A;  1XMQ L;  3AMU A;  2RQX A;  1EWH A;  3HOU B;  4DV5 Q;  4JG2 A;  4IPH A;  3T4A C;  1W3S A;  4DR5 L;  2FFK B;  1L2F A;  1QIL A;  5IGC A;  1U0L A;  3M4O B;  3PIP 3;  4AYB E;  4A3I B;  2RHS B;  3V05 A;  3AQQ A;  1SDF A;  2F3W A;  2SNM A;  3MTS A;  4OON A;  4MHE A;  1UE5 A;  1J5E L;  1UE7 A;  3T16 A;  4ABN A;  1N36 Q;  1PTO H;  1Q8I A;  1VQN A;  4KKS A;  2WAQ E;  4ZQ3 A;  5KRU A;  1Y69 U;  1G6Z A;  2F03 A;  1S5B D;  2B3G A;  1U5K A;  2F0V A;  4WJ4 A;  2CH4 W;  2B39 A;  1NR4 A;  3NQT A;  1Z47 A;  1DOM A;  1EIG A;  2HQE A;  2L55 A;  5BN5 A;  4IAL A;  4XT3 B;  2A6H C;  3UE1 A;  4X66 Q;  3J7Z C;  1S40 A;  4C2M H;  1F9S A;  2PMZ E;  3F2C A;  2JA6 G;  1LTS D;  2MJ8 A;  1A3U A;  3H6M A;  1TWC H;  4NW2 A;  5E7N A;  2F0I A;  3PQI A;  1B7Y B;  2XWJ B;  3ONA B;  2UXB L;  1ILP A;  3PCO B;  5KGU A;  1YJW A;  3HOV B;  4A3E G;  1HNW L;  2VUM H;  2YTY A;  4BBR H;  2NTT A;  1EY0 A;  2PW7 A;  2VXW A;  2F0Q A;  3VDY A;  3K0Y A;  4A3J H;  1HH2 P;  2EYJ A;  2FHT A;  2N3S A;  3M7N A;  3I4N B;  1PZJ D;  2L1B A;  2ZXO A;  5C0X H;  2KA7 A;  1JJG A;  3SE0 A;  1DGS A;  1SMX A;  2FIN B;  4GN4 B;  1H9S A;  3KLR A;  1EFI D;  2A8V A;  5C4J H;  1SFO H;  1VQI A;  2WII B;  3CC7 A;  1W2B A;  1EY6 A;  1O7I A;  2EVB A;  1CTM A;  1SRU A;  1L1O C;  1PYS B;  5M3F G;  2KBN A;  4L5S A;  4FF2 A;  5JAV A;  2HD3 A;  1X9N A;  1RTN A;  1G2T A;  1ONL A;  1QUQ A;  1X32 A;  3GTG B;  2K03 A;  2AKW B;  3E9I A;  1MGS A;  3PV0 A;  1FGU A;  4CGY B;  2JA5 B;  5EKI A;  3P7J A;  4KJN A;  1KLU D;  4IJL A;  2OTL A;  1TS2 A;  4A3M B;  5NUC A;  1P8L A;  5BR8 L;  3J81 E;  1UEA B;  1LTT D;  2YU9 B;  1SAP A;  1PYW D;  1I94 Q;  1D6E C;  1PH1 A;  1KDA A;  1UUP A;  3TP8 A;  3MA2 B;  5CR3 A;  3GQB A;  4C3H G;  5F2D A;  4LFB Q;  1ENC A;  3HG9 A;  4K5X A;  1TT2 A;  3GTO H;  4R4I A;  3S14 B;  1EIH A;  5COY A;  1XMO Q;  4K5W A;  1LTR D;  2PQE A;  3HKZ B;  3VR3 A;  4UDU C;  2B8G A;  4C3J B;  2BCO A;  4GLA C;  1IKL A;  1C48 A;  2A6H D;  4YCW A;  3HOU H;  3OOC A;  3UDG A;  4IUP A;  2VS1 A;  3HKS A;  2OQK A;  1EZ6 A;  2I46 A;  4LK1 C;  4X3U A;  3OW7 A;  3TP6 A;  1PH8 A;  3ERS X;  3M4O H;  2WKC A;  1VQ9 A;  1PH9 A;  4A3I H;  1WD1 A;  2NVQ B;  2X69 A;  3G71 A;  1F77 A;  3CCE A;  1D1K A;  1OXV A;  2RSN A;  4A3B G;  2VQE L;  2EYF A;  2EXZ A;  4IUV A;  2XRS D;  3CQZ B;  1A15 A;  3J81 L;  5JJL A;  2QEJ C;  4HJA A;  2NVT B;  3E5S A;  4X3S A;  5CBE E;  1JOK A;  1K83 B;  2KHS A;  1YZ6 A;  3H91 A;  3T53 B;  1XMQ Q;  5IP9 G;  1JMC A;  3SHL A;  4P75 A;  2N78 A;  3PO2 B;  3VR6 A;  2O5J C;  2B2Y A;  3G7L A;  1Y1W H;  2BA0 A;  4B9X A;  4DR5 Q;  1HA6 A;  1SNO A;  4A3F G;  2F0H A;  5IYD G;  2K32 A;  1CKO A;  4UY8 C;  3KF6 A;  5ELD A;  4LF9 L;  2KCC A;  3GP7 A;  2OXP A;  2PZW A;  2BDN A;  1QJO A;  2F0K A;  3ULP A;  3I4M B;  4DPG A;  3HOV H;  2RHQ B;  1LT5 D;  1Q3L A;  1EQQ A;  4IQZ A;  1N34 Q;  2VNU D;  3K5O A;  3F2B A;  1J5E Q;  3A7A B;  4EQN A;  1LLR D;  4QB4 A;  1E24 A;  2HQL A;  1EQT A;  1XNR L;  2Z4I A;  4HIM A;  3I4N H;  4LJZ C;  3K5L A;  1EQR A;  2A74 C;  2DJF C;  3I8Z A;  3D4R A;  1V1P B;  5I9O A;  1HNZ L;  1Q12 A;  4AQY L;  1CK1 A;  3TQY A;  5COR A;  4TSS A;  3HOX H;  3AEV A;  3BU2 A;  2K6A A;  4CDD C;  5M3M B;  4K2K A;  1GUO A;  4GOP B;  2BH2 A;  3CCV A;  2H4O A;  2NZO A;  1WTO A;  1CA5 A;  4X3K A;  1EEI D;  1GUS A;  3JAM i;  4A3G G;  2UXB Q;  4OIK A;  3U58 A;  4X3T A;  1ZXT A;  3JAM E;  1HNW Q;  2Y0S G;  4LF8 Q;  1HTL D;  3PGZ A;  4RGO S;  3GTG H;  1A3V A;  4CKE A;  4ZAI A;  2JA5 H;  1PRT B;  1JOO A;  4GZY C;  4OL7 A;  1PMR A;  2F1M A;  2J0T D;  3EVQ A;  3MVV A;  3RLN A;  1SNM A;  5JPN C;  2YU9 H;  5C4X G;  3GTQ B;  1E7Z A;  2G9D A;  1CQV A;  3CRL C;  1KC8 C;  1AH9 A;  4R4Q A;  1DJR D;  4DAY A;  3R2T A;  2G5D A;  3S14 H;  3MXU A;  2PW5 A;  2R93 G;  1BCP C;  1M4V A;  4H44 C;  3ERO A;  1VQM A;  4IO9 A;  4K8J A;  1E3P A;  3Q24 A;  1Q82 C;  3S15 B;  3DM3 A;  4KN4 C;  5IT9 E;  3QIA A;  2NVY H;  1HNX L;  2R7Z G;  5C0X J;  3OMC A;  2E2I B;  1KNA A;  3Q22 A;  1PA6 A;  3DLL A;  1Q8K A;  2Z8L A;  1RKN A;  3R2I A;  1VQP A;  3V96 A;  4YHH L;  3MWY W;  5JPM C;  2F0N A;  3KUP A;  3M85 A;  2Z1C A;  4JOI A;  5BR8 Q;  3J7A V;  1WJJ A;  1DXM A;  4B3T L;  4PNY A;  4GKJ L;  3CCU A;  3PUY A;  5J1Z A;  1KDB A;  4N9T A;  4FDB A;  3CQZ H;  2I0Q A;  3KBX A;  2AWO A;  2O4X A;  1H9R A;  1KRS A;  4EX5 A;  5FLX E;  3ITP A;  1YNJ C;  2MGS A;  2BDO A;  3H3V I;  2KJX A;  4KD3 A;  2NWG A;  4CBV A;  4DV0 L;  3HOW B;  2Z6K C;  2SOB A;  2JJQ A;  4PMC A;  3SDZ A;  1VQC A;  2ZJR A;  2K28 A;  3NXW A;  4PMW A;  2Q8I B;  5IGF A;  1Q7Y C;  1TS5 A;  1G6P A;  1ICF B;  3BJU A;  2JA9 A;  4X65 L;  5FJ8 G;  2CFM A;  5D3D A;  5IT9 L;  5HGQ A;  2JP1 A;  1ILQ A;  2IT1 A;  1TR5 A;  4HJ5 A;  2RVL A;  4HJ8 A;  1KL9 A;  3BYY B;  3K5M A;  3CME A;  2EOT A;  3VYS A; 
#chains in the Genus database with same CATH homology
 2ID0 A;  2RSO A;  4PV1 C;  1ZEQ X;  4J8Q A;  4FXK C;  1MSG A;  4NP5 A;  4E6I A;  1BCP D;  3PUZ A;  4IUU A;  4RKB A;  1GXD C;  1U4P A;  4L63 B;  5FLX L;  5I9P A;  2DNC A;  1I4X A;  1IYV A;  1TWH B;  4MIU A;  1PFB A;  4R8N A;  4RHR A;  5IGE A;  2F0O A;  5KEE A;  1XYI A;  1H9S B;  1NSN S;  3Q0A A;  3NWS A;  1HXY D;  1EL0 A;  3NK9 A;  3OWF A;  5E3F A;  3N52 A;  3AB9 A;  3CHB D;  1HTP A;  1H9J A;  4RFB A;  1WTV A;  2GA4 B;  1YNJ D;  3A56 A;  4U68 A;  1JC7 A;  1I6V C;  3FDT A;  4C56 C;  4ILW A;  4I7Z C;  5KNB A;  2EDG A;  2B2U C;  1S5C D;  4CJ0 B;  1LT3 D;  1EYA A;  3Q6S A;  3D6C A;  4CKC A;  3DEP A;  3VA7 A;  2A73 B;  3T56 B;  1B3A A;  1E2W A;  3A55 A;  1OXX K;  1U4L A;  1E2Z A;  1PFM A;  2F0M A;  4OO1 G;  1SYC A;  4RGM A;  2PZT A;  1GJX A;  1CA6 A;  3SXH A;  1W6K A;  2M9V A;  4K5V A;  3MC0 B;  4C2M B;  1BDO A;  1STY A;  1QWY A;  1TWC B;  1E0B A;  3Q23 A;  1WTP A;  3DXJ C;  1BQQ T;  1I4Q A;  3KK7 A;  3LWE A;  5CV6 A;  1DOK A;  2ZT9 C;  3R8B A;  5CV4 A;  4BBR B;  4HSV A;  2M2L A;  4A3J B;  3RZO B;  1NCV A;  2NZ1 D;  3X3N A;  5T1G A;  2QIL A;  4L8J A;  3VR2 A;  4OO1 I;  1WD0 A;  2JA6 B;  1Q90 A;  1V43 A;  1AN8 A;  1TS3 A;  1ET6 A;  3A8J E;  1VMC A;  1IL8 A;  3P20 A;  5FKA C;  5FO9 B;  2PYK A;  3SR1 A;  5FK9 C;  4RCN A;  1BR9 A;  2KEE A;  4C1N K;  5DM6 3;  5M5W B;  2E2D C;  4HSP A;  4BA1 I;  2A5H A;  2KUM A;  4FVM A;  2BA1 A;  5EGT A;  5IGG A;  4KD4 A;  2RBM A;  1DM0 B;  4FYD A;  1JWU D;  2IW3 A;  3L9A X;  3GTO B;  1BUV T;  4RHS A;  4DF7 A;  2HDL A;  3NBI A;  1PLF A;  1F9Q A;  1IW7 C;  4QMG A;  3URY A;  4RGN A;  1FD7 D;  1GUG A;  3S1M B;  3TN2 A;  1MI2 A;  1CZG A;  1EY7 A;  1SMY C;  3H3V C;  2WB1 B;  3OIQ A;  2IWH A;  2OT2 A;  2F0D A;  5HGT A;  2F0J A;  1W6J A;  2KEC A;  3J7A F;  1D5X C;  3RLF A;  1R4P B;  2D2C C;  2FMC A;  4IUN A;  1EYC A;  1XWE A;  2JXM B;  1LTB D;  1AZP A;  1Q1E A;  1HHV A;  2RDG A;  3A8K E;  1B4O A;  3U9S A;  1MBY A;  3K7A B;  2K7V A;  3QOL A;  5LL6 S;  1CT1 D;  3SK6 A;  2JSO A;  1LTI D;  4KHZ A;  1Y1W B;  4TQU S;  3LNN A;  4WFN 3;  1ML0 D;  1DZ1 A;  3H94 A;  1HRJ A;  3E0J A;  3K6O A;  2KOL A;  2IX3 A;  4G7O C;  4FF4 A;  4QUF A;  1PZI D;  2IX1 A;  3M3Y B;  5T1I A;  1IHZ A;  3HS0 C;  3EFX D;  5CV9 A;  3T13 A;  3DWP A;  5C0X G;  1WTR A;  1I4H A;  1JQY D;  4XT1 B;  1MD2 D;  1Y8N B;  3GD7 A;  3HOX B;  4DA2 A;  2ENB A;  1YNN C;  4Z9C B;  1KTK A;  5C3X A;  3QG1 A;  3ZYY X;  3VR4 A;  3NUC A;  1IW7 D;  1QNK A;  1DYQ A;  3PUW A;  2CW0 C;  4J1M A;  5CMD A;  1SMY D;  1AFP A;  1EZ8 A;  1STN A;  2CQA A;  1TQO A;  4RKL A;  4DAP A;  1A2T A;  2WP8 J;  2A68 C;  2WIN B;  5I2X A;  5C0X I;  1LAB A;  4QF4 A;  3MXP A;  5C4Z A;  1ROD A;  2N88 A;  5E4X A;  3DWA A;  2AUK A;  1HFG A;  2AQ3 B;  3LWU A;  1WCM B;  2DNE A;  3BG3 A;  4BA2 I;  3T51 B;  3MXN A;  4XQQ A;  3BYT B;  2NVY B;  1NUC A;  4N9P A;  1OO9 B;  3D4W A;  2F3V A;  1SYF A;  5C4X B;  1RJT A;  1OXS C;  2MHV A;  4KJO A;  5C3W A;  1ICW A;  2K5W A;  1ZYR C;  3DMU A;  3OWE B;  2R93 B;  1LT4 D;  4NKL A;  4J6H A;  5J22 A;  1J8I A;  3PIO 3;  2A69 C;  2R6G A;  2F0L A;  4KY7 A;  1STB A;  2AWN A;  3SK8 A;  4BBS B;  5JJZ A;  1Y8O B;  1A2U A;  2N55 A;  1U9R A;  4IZ8 A;  2VB3 X;  1FR3 A;  1YNN D;  2F0U A;  1L0Y B;  4UAI A;  2JYO A;  5DM7 3;  3M7G A;  1AZQ A;  1H9K A;  1HCZ A;  4S3S A;  4IFD G;  2I07 B;  1DCZ A;  4ZYS A;  2R3Z A;  3W2D A;  2CW0 D;  2ICI A;  1XXG A;  3QWN A;  2A68 D;  2EYP A;  3D3R A;  2AQ1 B;  2C5C A;  5IGB A;  1M8A A;  2RA4 A;  3OHX C;  1STE A;  3FPP A;  2ZXP A;  4ZUJ A;  3K5N A;  1F2M A;  3VA5 A;  3DM1 A;  1I50 B;  4ULL A;  1XTC D;  1R9T B;  3EJI A;  3TZU A;  2K1B A;  1BCP F;  4IFD I;  1AEX A;  1EU3 A;  3FPU B;  3KF8 A;  1Q1B A;  4ZK9 B;  4DFA A;  1CHQ D;  1L0X B;  1RDP D;  2NN6 G;  1QG7 A;  1GHK A;  2O2L D;  4R9W A;  4F7X A;  2AUJ D;  4ZUI A;  4DK1 A;  3D4D A;  5A35 A;  2J4X A;  2A69 D;  5M9O A;  1HQR D;  3EA6 A;  5HUR A;  2NBF A;  5IOC A;  5EBC A;  5K36 G;  3I91 A;  2F0W A;  4C3J G;  2B2U A;  3DWQ A;  1MSH A;  1CHP D;  4O42 A;  5EQ0 A;  4KN7 C;  3MAQ A;  1H9M A;  2PNR C;  2NN6 I;  1SYB A;  5CV5 A;  1F2Y A;  3RD4 A;  2K04 A;  2RDF A;  5C5L A;  4R8I A;  3JAM L;  4KTA A;  2F0F A;  4M8A A;  1SXT A;  1KDC A;  2J7Z A;  1TVX A;  1PTO C;  3QB3 A;  5ISR A;  1B2T A;  3NPP A;  3N6R A;  1C4Q A;  1QE6 A;  1KNE A;  3G6J B;  2QF7 A;  3S16 B;  3GTJ B;  5C44 B;  3NTI A;  3NQI A;  2BE5 C;  2L5T A;  4YIJ A;  4K2L A;  2MUY A;  1D1I A;  3D31 A;  2K05 A;  3MFY A;  5CC4 A;  2RKS A;  1UAP A;  2JEB I;  4HCE A;  2LFN A;  2LS0 1;  2L0C A;  4C3I B;  2EYL A;  4XIG S;  3O13 A;  3VR5 A;  2NTS A;  5DAU A;  2CHB D;  1VDZ A;  3TSS A;  1G91 A;  2WV6 D;  1R4Q B;  4ZKB B;  5IOD A;  4U67 3;  3HOY B;  1F9R A;  3NSW A;  2B2W A;  1EU4 A;  2XVS A;  4BY1 B;  2KQ3 A;  4CHT B;  4NDX A;  4NMZ A;  3LX0 A;  5BN4 A;  3WDN A;  3NE5 B;  2MP1 A;  3AU7 A;  1ZKO A;  2A6E C;  3C2P A;  3RUZ A;  4F87 A;  1SJH D;  5CYU A;  2K5D A;  3S1R B;  2F0G A;  4XYO A;  3PO3 B;  1B50 A;  2CVR A;  1PTO D;  1A6X A;  1TWA B;  2NYZ D;  1GUW A;  5E4W C;  4HAE A;  1B9N A;  1EY4 A;  3S1N B;  1SYE A;  2AQ2 B;  1IYU A;  3BDL A;  3I3C A;  2BE5 D;  1I4P A;  1BCP B;  3X3M A;  4KKU A;  1NAP A;  5FO7 B;  1QCB D;  5FO8 B;  4HN7 A;  1LV9 A;  4EQO A;  1JOQ A;  1VCI A;  2B2T C;  4FXG C;  2VB2 X;  4KY6 A;  4OHJ A;  1JWM D;  2XRQ D;  3DUZ A;  1A3T A;  2BOS A;  2Z4H A;  4L6T B;  1HPC A;  1LAC A;  1O80 A;  3I70 A;  1IKM A;  2Q8T A;  4OO1 H;  1I4G A;  4M1U B;  3S2D B;  3NTH A;  2X6G A;  3DEO A;  4KKT A;  4FF1 A;  1VF5 C;  5KYI A;  1WTQ A;  3IAY A;  3GTM B;  5EBD A;  1FYC A;  1RHP A;  5C3E B;  1UNS A;  3FEW X;  4XTC S;  1I4R A;  4K6D A;  4RCO A;  3S17 B;  1PFN A;  3NTK A;  4A3E B;  3C46 A;  4ME5 A;  2F0T A;  2HCC A;  4IN3 A;  1Z7T A;  2E2H B;  1G2S A;  1SEB D;  4KI0 A;  1QNU A;  2WAC A;  4G4K A;  3OPO A;  1JWS D;  2QCP X;  1TKW B;  3C1E A;  2LY7 A;  1BO0 A;  2M00 A;  5CBA E;  1SYD A;  2H1E A;  4O1N A;  2B2W C;  1K8M A;  4Y7N B;  3SVM A;  4MN3 A;  5M3F B;  1ENF A;  3A54 A;  2K5Q A;  1STG A;  2SDF A;  5JEA H;  5TSS A;  3DHQ A;  3FRP B;  4H0L C;  4CJ1 B;  4RAU C;  4KHV A;  1I6H B;  3FVQ A;  2SEB D;  4BS9 A;  2X6L A;  4ZRZ A;  4PQX A;  2EPB A;  1II3 A;  3F2U A;  1EEF D;  4C3H B;  1U4M A;  1D5M C;  4HCS A;  5JVG 3;  1EWC A;  5D65 A;  3PUX A;  1C8C A;  3HP3 A;  4QCL A;  4DAV A;  3C1F A;  3NBH A;  3IL8 A;  1JE4 A;  3NHH A;  3E6Z X;  4HED A;  4QIW B;  2NB0 A;  1SNQ A;  2QKI C;  1F2Z A;  5EPK A;  1BNZ A;  1S5E D;  2EY6 A;  4JBW A;  1TU2 B;  4RH6 A;  5C6A A;  4FP5 D;  3FKI B;  4A3B B;  2XSC A;  5I6Y A;  2B2V C;  5AFW A;  3R3O A;  2XN9 C;  3QOJ A;  2F4I A;  4RA8 A;  2ZXR A;  4WRD A;  4K14 A;  1K8O A;  3OIP A;  1S4Z A;  4HMJ A;  4A3F B;  1CFM A;  2PCF B;  4HTH A;  3VYU A;  1PRT F;  3IFD A;  2K01 A;  4G7H C;  1SE4 A;  4BWG B;  2HDM A;  1S5F D;  3S2H B;  1EY9 A;  2JE6 I;  1NR2 A;  3D8G A;  1F9P A;  3CU7 A;  4HMI A;  3A7L A;  5CGK A;  2EYH A;  4ZLT F;  4C1N I;  1XX8 A;  4H13 C;  4PMB A;  1PRT C;  1DD2 A;  4A3G B;  2D5D A;  1U4R A;  3H0G B;  3L7Z C;  1RTO A;  5EKL A;  2Y0S B;  5A2Q E;  3S9W A;  2EJG C;  2QDB A;  4LAA A;  4XDX A;  1CI3 M;  2JA7 B;  5KNC A;  1JIC A;  5ELE A;  3J80 E;  1EQV A;  4DXG A;  1TY2 A;  1KLG D;  1GOZ A;  1EY8 A;  2YYZ A;  4CKB A;  4P2C B;  3MZ5 A;  4A3D B;  2E76 C;  3I4L A;  2C9O A;  3HGB A;  2L11 A;  2E74 C;  1G29 1;  4F88 A;  2PPB C;  3HZX A;  3V2T A;  4XYQ A;  2R92 B;  1STH A;  3TDQ A;  3CRK C;  1LTA D;  3NWT A;  1RCV D;  4DN4 M;  2ICE C;  1QOH A;  3PMF A;  5EPL A;  2R7Z B;  1O7Z A;  2IPK D;  1FNU A;  2SNS A;  3HRZ C;  5I6W A;  5DNF A;  3A8I E;  5J39 A;  4K6L A;  5A2Q L;  3GTK B;  5I4D A;  4FXD A;  4BY7 B;  2NVX B;  5JEA J;  2IJ0 A;  2DY7 A;  2TMP A;  1DOL A;  3J80 L;  1EYD A;  5I2Y A;  2E75 C;  1G8Z D;  1PZK D;  2EZV A;  1ENA A;  2XNA C;  1EY5 A;  3GTP B;  4A93 B;  1JOR A;  4LMQ D;  1PRT D;  2RDH A;  5KIX A;  3VYT A;  3NP8 A;  4IUT A;  3VYR A;  1RD9 D;  4IFD H;  2EE1 A;  3TZD A;  5G3L F;  4RGT A;  4TKO B;  2G9H D;  1CM9 A;  1BOS A;  3GV3 A;  3P75 A;  1ESF A;  5CV8 A;  3K59 A;  4DGZ A;  2IX0 A;  4Q0F A;  1SND A;  2LKV A;  4AYB B;  4I65 A;  1FNV A;  1FGB D;  1ZYR D;  5IGD A;  1F2L A;  2L4N A;  1T5E A;  1Y1V B;  4G57 A;  1LTG D;  2FMM A;  2KVM A;  4QUC A;  3MXG A;  4ZKC B;  1TWG B;  2WAQ B;  1SBB B;  2R61 A;  1O7L A;  1PTO F;  5ELF A;  3IFT A;  5M5X B;  2NN6 H;  1EOT A;  1LT6 D;  4Q5V A;  3TBI B;  3CKI B;  5FOB B;  4XQJ A;  4DU9 A;  2XWB B;  2B2T A;  3KLS X;  1KAA A;  1JB3 A;  2PMZ B;  3UI2 A;  1CQF A;  3FMC A;  1J9O A;  2EYM A;  5DEH A;  1X3P A;  3SK4 A;  1BF4 A;  4ID6 A;  1SNP A;  3K58 A;  3BVZ A;  5K36 H;  1D2B A;  1B53 A;  1FNW A;  4EGV A;  5KYL A;  4OIJ A;  1SE3 A;  1S5D D;  5LL6 X;  1BXT A;  5JOB A;  1I3Q B;  1JCK B;  3OMG A;  1ET9 A;  1SE2 A;  3QO2 A;  2OEO A;  3ND9 A;  3H09 A;  4IUQ A;  4WOR A;  2EJM A;  1SYG A;  2PZU A;  2D62 A;  5KND A;  1BBX C;  1TWF B;  3L3O C;  4K8I A;  5LHY 1;  2B8F A;  3I73 A;  3TP7 A;  1ESR A;  5C5M A;  5JVH 3;  5M5Y B;  2B63 B;  4XXE A;  3BDO A;  2EY2 A;  5ELC A;  2LMC B;  4RWS C;  3WOF A;  3ERQ A;  4A3K B;  2F0E A;  5EJW A;  3P1H A;  1HA5 A;  1HUM A;  2EY5 A;  2L9H A;  4F8M A;  2B2Y C;  5G3L D;  1STA A;  1VMP A;  4DNR B;  1Y8P B;  4DK0 A;  3IKJ A;  3SEB A;  4OGQ C;  2KED A;  3GTL B;  2E2J B;  3J7Y W;  2HCI A;  4EQP A;  2V4D A;  2D9U A;  5IIF A;  3GV6 A;  5D14 A;  1AP0 A;  3BVG A;  1X3Q A;  3U9O A;  3I90 A;  4IUR A;  4WJW A;  2MPM A;  1TS4 A;  3BZD B;  4H7B A;  1HQM C;  5EPJ A;  5ELB A;  2OF1 A;  2TSS A;  1HUN A;  2NUC A;  3K57 A;  4HR7 B;  3RZD B;  2EY1 A;  1RF2 D;  1QB5 D;  3W3A A;  5EKK A;  4KY5 A;  2O5I C;  2EYO A;  4V19 0;  4ODG A;  2DY8 A;  3D6W A;  1TY0 A;  4IFD J;  2L12 A;  1T5X D;  3ND8 A;  1DON A;  3C3L A;  1KAB A;  3TP5 A;  2JEA I;  1E2V A;  5C4H A;  3MHB A;  1D5Z C;  1PDQ A;  3HOZ B;  1WTX A;  4KMU C;  2B2V A;  4KK7 A;  2F0S A;  2DN8 A;  1B44 D;  2FJ2 A;  1V1O A;  5E1F A;  1PTO B;  3M4Y A;  3I72 A;  1HFN A;  3S1Q B;  1B1Z A;  4EVO A;  1VF7 A;  1GHJ A;  2EJF C;  2K33 A;  2IL8 A;  4XQN A;  5CV7 A;  5D3I B;  2A6E D;  4C3I G;  3MFG A;  3TME A;  2HUG A;  1V1P A;  3KLS A;  3BS1 A;  1AW7 A;  1Z6H A;  2VUM B;  1SSO A;  3MEH A;  3WOE A;  1LO5 D;  5K5P A;  4FNF A;  3OSO A;  3QJY A;  4TRD A;  4V0B A;  1GUT A;  4FO2 A;  1CZW A;  5BN3 A;  4JK1 C;  5C4J B;  1SFO B;  4B9W A;  4CJ2 C;  1OXU A;  2PO4 A;  3HEJ A;  3PUV A;  3GO5 A;  2Q8R E;  2WKD A;  1WVL A;  5JEA G;  4B08 A;  1WTW A;  2XIW A;  1OXT A;  3KBG A;  1V8Q A;  1GUN A;  3RMH A;  1JR0 D;  4G7Z C;  2KCN A;  4DNT B;  4FF3 A;  1PXU A;  1TII D;  2F0P A;  3BDC A;  3R93 A;  1SNC A;  2JA8 B;  1B9M A;  1O78 A;  4KV6 A;  3BVM A;  3SK5 A;  1O7Y A;  4DXF A;  1SJE D;  3EQL C;  3AMU A;  2RQX A;  1EWH A;  3HOU B;  3T4A C;  2FFK B;  1QIL A;  5IGC A;  3M4O B;  3PIP 3;  4A3I B;  3V05 A;  1SDF A;  2F3W A;  2SNM A;  3MTS A;  4MHE A;  3T16 A;  4ABN A;  1PTO H;  1Q8I A;  4KKS A;  4ZQ3 A;  5KRU A;  1Y69 U;  1G6Z A;  2F03 A;  1S5B D;  2F0V A;  2B39 A;  1NR4 A;  3NQT A;  1Z47 A;  1DOM A;  1EIG A;  2HQE A;  2L55 A;  5BN5 A;  4IAL A;  4XT3 B;  2A6H C;  1F9S A;  1LTS D;  2MJ8 A;  1A3U A;  3H6M A;  4NW2 A;  2F0I A;  2XWJ B;  3ONA B;  1ILP A;  5KGU A;  3HOV B;  2NTT A;  1EY0 A;  2PW7 A;  2VXW A;  2F0Q A;  3K0Y A;  2EYJ A;  2FHT A;  3M7N A;  3I4N B;  1PZJ D;  2L1B A;  2ZXO A;  5C0X H;  2KA7 A;  3SE0 A;  2FIN B;  1H9S A;  3KLR A;  1EFI D;  2WII B;  1EY6 A;  2EVB A;  1CTM A;  4FF2 A;  5JAV A;  1RTN A;  1G2T A;  1ONL A;  1X32 A;  3GTG B;  2K03 A;  1MGS A;  3PV0 A;  4CGY B;  2JA5 B;  5EKI A;  3P7J A;  4KJN A;  1KLU D;  1TS2 A;  4A3M B;  5NUC A;  3J81 E;  1UEA B;  1LTT D;  2YU9 B;  1SAP A;  1PYW D;  1D6E C;  1KDA A;  1UUP A;  3TP8 A;  3MA2 B;  5CR3 A;  3GQB A;  4C3H G;  5F2D A;  1ENC A;  3HG9 A;  4K5X A;  1TT2 A;  3S14 B;  1EIH A;  5COY A;  4K5W A;  1LTR D;  2PQE A;  3HKZ B;  3VR3 A;  4UDU C;  2B8G A;  4C3J B;  2BCO A;  1IKL A;  1C48 A;  2A6H D;  3OOC A;  4IUP A;  1EZ6 A;  2I46 A;  4LK1 C;  4X3U A;  3OW7 A;  3TP6 A;  2WKC A;  1WD1 A;  2NVQ B;  2X69 A;  1F77 A;  1D1K A;  1OXV A;  2RSN A;  2EYF A;  2EXZ A;  4IUV A;  2XRS D;  3CQZ B;  1A15 A;  3J81 L;  2QEJ C;  2NVT B;  3E5S A;  4X3S A;  5CBE E;  1JOK A;  1K83 B;  2KHS A;  3H91 A;  3T53 B;  3SHL A;  3PO2 B;  3VR6 A;  2O5J C;  2B2Y A;  3G7L A;  2BA0 A;  4B9X A;  1HA6 A;  1SNO A;  2F0H A;  2K32 A;  5ELD A;  2KCC A;  3GP7 A;  2OXP A;  2PZW A;  2BDN A;  1QJO A;  2F0K A;  3I4M B;  1Q3L A;  1LT5 D;  4IQZ A;  2VNU D;  3K5O A;  3A7A B;  4EQN A;  1LLR D;  4QB4 A;  1EQT A;  2Z4I A;  4LJZ C;  3K5L A;  2A74 C;  3I8Z A;  5I9O A;  3D4R A;  1V1P B;  1Q12 A;  1CK1 A;  5COR A;  4TSS A;  2K6A A;  5M3M B;  4K2K A;  1GUO A;  2H4O A;  1WTO A;  1CA5 A;  4X3K A;  1EEI D;  1GUS A;  4OIK A;  4X3T A;  1ZXT A;  3JAM E;  1HTL D;  4RGO S;  1A3V A;  4CKE A;  4ZAI A;  1PRT B;  1JOO A;  4GZY C;  4OL7 A;  1PMR A;  2F1M A;  2J0T D;  3EVQ A;  3MVV A;  1SNM A;  5JPN C;  3GTQ B;  2G9D A;  1CQV A;  3CRL C;  1DJR D;  4DAY A;  3R2T A;  3MXU A;  2PW5 A;  1BCP C;  1M4V A;  4H44 C;  3ERO A;  4K8J A;  3Q24 A;  3S15 B;  4KN4 C;  5IT9 E;  3QIA A;  5C0X J;  3OMC A;  2E2I B;  1KNA A;  3Q22 A;  2Z8L A;  1RKN A;  3R2I A;  3V96 A;  3MWY W;  5JPM C;  2F0N A;  3KUP A;  3M85 A;  2Z1C A;  3J7A V;  1DXM A;  4PNY A;  3PUY A;  5J1Z A;  1KDB A;  4N9T A;  3KBX A;  2AWO A;  2O4X A;  1H9R A;  5FLX E;  3ITP A;  1YNJ C;  2MGS A;  2BDO A;  2KJX A;  4KD3 A;  2NWG A;  4CBV A;  3HOW B;  2SOB A;  4PMC A;  3SDZ A;  2K28 A;  3NXW A;  4PMW A;  2Q8I B;  5IGF A;  1TS5 A;  5D3D A;  5IT9 L;  2JP1 A;  1ILQ A;  2IT1 A;  1TR5 A;  2RVL A;  3BYY B;  3K5M A;  2EOT A;  3VYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...