2PWXA

Crystal structure of g11a mutant of sars-cov 3c-like protease
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
296
structure length
289
Chain Sequence
RKMAFPSAKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMTILGSTILEDEFTPFDVVRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Mutation of Gly-11 on the dimer interface results in the complete crystallographic dimer dissociation of severe acute respiratory syndrome coronavirus 3C-like protease: crystal structure with molecular dynamics simulations.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 75
structure length 289
sequence length 296
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2pwxA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2pwxA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2pwxA02
1C1OA 5CE1A 2TGDA 1NM6A 4X1QU 1ZLRA 2J94A 4TPYA 1Y5UT 3LJOA 2NU2E 2SGQE 3R0FA 1WUNH 2QV1A 6GCHF 3SV6A 2TGTA 3Q76A 4ZHMU 1C2DA 1IQKA 1C9TA 3BTHE 4NA8A 1YPJH 1K28D 1F5LA 4NWLA 5C1UA 3RLYH 1OPHB 1P9SA 1ELAA 1O3CA 1FPCH 2VINA 1O2TA 4Y7BA 5HM9A 3E3TA 4ABAA 2WUCA 3UREA 2FZZA 3VXEH 5FHTA 1F5RA 2FYQA 2BLOA 2FI3E 5GCHG 1VJAU 4E06H 1GBDA 4Q2KA 1AVWA 3LDXH 5EPYA 1A4WH 4IC6A 1BOQA 1O33A 1ANCA 3DD2H 1GPZA 2WPHS 2FPZA 1HAIH 2PTNA 4SGBE 5ESTE 1FZZA 1GJAB 2GGVB 4QT8C 1EASA 4YM9A 3PLKA 2WPLS 2AH4X 3PMHB 3GDVA 3MU4A 4I31A 1OWJA 1Z6EA 1MTWA 1KXEA 1YGCH 1ZMJA 3UWIA 4FUDA 1V2JT 1F0RA 1GGDC 3A8CA 3FAOA 1AIXH 3KQBA 1QL9A 1XXFA 1ZPBA 1K1NA 4LK4A 1EPTA 1UTJA 1CGIE 1PJPA 3A8AA 3Q3XA 2ZDVH 3OSYA 5EXMA 1A46H 1P2JA 3P8FA 1E0FD 2WYGA 1P3EA 4JMYA 1ZGVA 3P95A 1VITH 3BN9A 1CT2E 1GBLA 1BTUA 1LVBA 1SGRE 1N1LA 2ZPQA 3RXKA 1GBHA 1GHVH 4Q7YA 1A1RA 4YZUA 4CRFA 2BDGA 3B23B 5E0JA 5EW1H 4FVDA 1O2MA 2ZHWH 4KGAA 2ZQ2A 3OYPA 2GP9B 1CVWH 2C8WB 3F9HA 2PFEA 1FONA 3UNRA 3PMJA 1VJ9U 1Q3XA 2B7DH 3T29A 2PHBA 1ZYOA 2C4FH 1HAOH 3TNSA 1K1LA 1SGQE 2GCTB 2BDBA 1ELGA 1G3EA 1O0DH 1CBWC 3I29A 4DURA 1AMHA 5FX5A 3U9AH 2NU3E 1G2LA 3LONA 3PMAB 2CGAA 1KDQA 3MU0A 2BB4A 1HV7A 2QY0B 3BV9B 3G01A 3KQDA 2B5TB 3E0PB 3NXPA 1HAYB 1O3KA 1KXFA 1V2LT 1G36A 4RSPA 4YO9A 2FYRA 4IC5A 1F7ZA 1GJDB 1NRQH 5JBAS 1UMAH 2BD3A 4X6MA 4Y0ZE 4B2AA 2ZPSA 1RIWB 4MPVA 3RC5A 1C1VH 1LKAA 1BT7A 1P02A 1OWKA 1KTSB 2BVRH 2OUAA 4U2WA 1W13U 1AKSB 1UTKA 1EUFA 1P2OA 3KL6A 2GMTB 2GCHG 2W3KA 2JETC 3ZV8A 4A1VA 1XX9A 4YOIA 2CMYA 2A1DB 1Y5BT 1PQ8A 1ARBA 4K5ZA 1W14U 1A2CH 2WV5A 4DIHH 1NO9H 4AN7A 4WH6A 3UR6A 5LPFA 3UQOA 1CGJE 1EAWA 4GVUA 2Y82A 3TK9A 2R2WU 1QA0A 1E37B 1BJVA 1CHGA 3LGTA 3UNSA 4KELA 1D4PB 1XUGA 2ZEBA 2H5DA 4PROA 5DP8A 1C5LH 3T26A 1QRZA 4NCYA 2FTLE 2LIZA 3F68H 2XRCA 2FIRH 1GG6B 3V7TA 1O3FA 3MNBA 1P9UA 3E91A 3QO6A 1UVUH 2J2UA 1YPLH 1HFDA 2FOCA 3PO1B 3GOVB 1ACBE 3MH6A 4CRCA 3EDXB 4CREA 4GHTA 4NA9H 4ABBA 1G2MA 1DX5M 1DXPA 1WU1A 1GL0E 3MH4A 2DE8A 4RKOB 1PQ7A 2ZIQH 4AYVB 2HOBA 4GPGA 5DPAA 2O8LA 2NWNA 1YCPH 3EQ0H 1O5BB 1ZRKA 2P16A 1C1NA 1TX7A 1O3PB 1O3AA 4BXSA 1BQYA 1QJ7B 1GL1A 5JB8S 1W2KH 3BTDE 4Y71A 4AZ2B 1O3HA 2HNTF 1A0LA 1P05A 2A4RA 3V12A 3K9XB 3SI4H 4A7IB 4ZHAA 1FAXA 2OTVA 1G3BA 4YLQH 1UVOA 4H6SB 3SUDA 5EXNA 2P3TB 2P93A 4F4OC 2QIQA 1DWEH 4JYUH 1OX1A 3ZZ9A 3M7TA 4X6NA 3NKKA 1AHTH 1NFWA 5E2PA 1YPHE 4B74A 1C2FA 1SOTA 1XVOA 4BTUB 1IQJA 1GMDG 3RXUA 1VCPA 3BG8A 4DOQA 3AW1A 3OX7U 3TGKE 4O9VA 1NZQH 1DLEA 4K8YA 4MNXA 1F0SA 1BTHH 1BTXA 1ELBA 1NU9A 3KQEA 4GHQA 3SZNA 1SGIB 2BQ7B 3TH3H 2R0LA 1EB2A 1THPB 3SORA 4B2BA 3MYWA 3SHCH 3P17H 2JH5D 3EA9A 4M7GA 3A84A 4ABDA 1O37A 1K21H 2F83A 2VGCB 7LPRA 4XOJA 2BZ6H 2WYJA 2ZHDA 1ZPCA 3GY3A 4JK6A 1TRNA 2BLQA 3N7OA 1WBGB 3VFEA 3MHWU 2ZHFH 1OYQA 3M5MA 2STAE 2Y5HA 1FAKH 1QRWA 1PPBH 3P92A 1SBWA 4WWYA 1P10A 3KCGH 1RTLA 2Q6GA 3RXJA 4GLYA 1BRCE 1H1BA 4AOQA 2AGEX 5BRRE 4JZDH 3HKIB 1SLXB 3NK8A 1HJAB 4U32A 3I77A 4NZLA 3PWCA 1OP8A 3IWMA 1O2XA 3MFJA 1TB6H 3ESTA 3A7ZA 3RXRA 2P3FH 4F49A 5A09A 1XUFA 4MPWA 2Z9JA 1BTPA 1VGCB 3TJOA 4Y8XA 3A7WA 3EA8A 1LPZB 5C2ZA 4OS5A 2ZGBH 2BYAX 3W95A 1C2GA 1TAWA 2CN0H 3RXGA 3C27B 3A85A 2BDCA 2QC2A 1DSTA 1FMGA 1GJCB 1O2SA 3BG4C 1HAHH 2GVFA 4AB9A 1TALA 3IITA 4LXBH 2VJ1A 1ZSJA 2ZDAH 1TBZH 4BXWA 3FANA 3U98H 2BX3A 2G5NA 1PPZA 1EZUC 3NPSA 4SGAE 4FUCA 1O3GA 1XUIA 1MQ6A 1S5SA 1WV7H 1C5RA 1O3BA 1EZQA 1TNLA 4IN1A 1QBVH 4D7GA 2ZFSA 3GY4A 1BUIA 2QXGA 5T6DA 1N8OC 1TGBA 3SJ9A 2QF0A 2BTCE 1UK2A 1C1SA 1UTNA 1PPFE 4NFFA 5DKMA 1TRYA 3RU4D 1UVPA 5JBTA 4CR9A 1EPTB 5DP9A 4ZXXH 3ZZ6A 1UJ1A 1AKSA 1WAYB 1P12E 1QGFA 3JZ1B 4KTUA 1LKBA 1PPHE 3NCLA 2QYIA 3MU1A 1BBRH 3P8GA 1NROH 5HXFA 4Y0YE 1SLUB 5FBIA 6ESTA 3BIVH 3LGYA 4UFDH 3PTBA 1H9HE 1GBCA 1Z8GA 1A5HA 1A0HB 4D76A 1ZJKA 1DWBH 1GI6A 1TABE 2CF8H 1UCYH 1AE8H 1MTNC 5L2YH 2ZGXH 1KXAA 3MU5A 3SHAH 3V13A 1XM1A 1CA0B 4WXIA 3RU4T 1EJNA 4DT7B 3LPRA 5I46H 3A80A 1TNHA 1P2NA 2W5EA 3K65B 3T62A 1TE0A 1V2PT 1E35B 2FXRA 1SSXA 2OBOA 2FS8A 3RXFA 1TNJA 1FY1A 1CHOG 3ZZ8A 3STJA 2C8ZB 4HTCH 1E34B 3C1KA 4THNH 4YLUA 4INKA 3DA9B 3LGVA 2BD9A 1O2QA 3T5FH 5DO4H 5CMXH 1S84A 2PKSC 1GMCF 1TQ7B 3JZ2B 1ZTKA 1KXDA 3A87A 4MVNA 3M61U 3F9GA 3LKWA 2G5VA 2VIVA 1GWAA 1O2PA 1O2KA 1W0ZU 1JRSA 3SNBA 2PKAB 1AB9C 2ILNA 3L3TA 3LC3A 2ZFTA 1GBBA 1THRH 2UUYA 2BM2A 3HK3B 1P57B 1SG8B 1SB1H 4ABHA 2BZAA 2RA0A 3RC4A 1GI1A 4I32A 4DIIH 4X8SH 2PW8H 2ALPA 1AE5A 3PLPA 3SQHE 1A61H 2PUXB 1XMNB 4K3JA 3CS7A 1G37A 4X2XA 2ZP0H 3GCOA 3ZZAA 1ABIH 1P8VC 3DUXH 3VB3A 1EP6A 2ALVA 4Y10E 2VU8E 2YOLA 3URDA 2UUJB 4IN2A 2VVVA 1P0SH 1W0YH 1SGFG 4K8BA 2G00A 1HYLA 2D2DA 1C1UH 3Q3KA 1SHHB 2XC0A 2AIQA 3ZZ4A 1V2OT 3MWIU 3FP6E 5DP6A 3H7OA 2A4QA 4I33A 5FPSA 3VB4A 2ANKH 2BD2A 3A7VA 5A2MH 4X1SU 3RXCA 1NTPA 2VIOA 3ATIA 1GHYH 3KQCA 3VGCC 1VR1H 4ZKRU 4KP0A 1P2MA 1BRUP 2PUQH 1BRBE 1NN6A 5DJ7A 1C2IA 1C5QA 3U8OH 4XBBA 1DE7H 1H8DH 1K1MA 3SV9A 3PM3A 1XUHA 3SU4A 1Z1IA 3AVZA 1C2JA 1SLWB 4ABJA 5G4BA 2XXLA 1NRNH 1EQ9A 1DUEA 1C2EA 3RXVA 4X8TH 9ESTA 3SV8A 1ZOMA 3CS0A 2F9UA 3TGIE 4O3TA 2FP7B 3FFGA 3GCHC 3E90B 1O34A 1LCYA 4INHA 3MNCA 2ZQ1A 1KLJH 4Y76A 1FPHH 2EI8A 2AMDA 1GBTA 3OTJE 3ZYDA 5EOKA 1EXFA 2ZWLH 2HNTC 2SFAA 2XBYA 1BBRE 3ELAH 5FBEA 5T6GA 1T31A 2AMPA 1O35A 1TGSZ 1W11U 5JDUB 1IQHA 4YT7H 1ZHMA 3TK5A 1BHXB 1MAXA 1AFQC 3BTWE 1C5ZB 1YPKH 3HATH 1UCYE 5E0HA 1ARCA 1P2IA 4HGCA 4FUFA 1WSSH 3RM2H 2TIOA 1D3PB 1IHTH 3ZYEA 1D6WA 1DUAA 1DDJA 1JOUB 1RTKA 4MQAA 2CHAC 1OYTH 4ISIH 4OS7A 5C5NA 2OP9A 1FXYA 2JH0D 4A1TA 1RJXB 1K1PA 1C2MA 1D9IA 1H4WA 1C5OH 3SJIA 1N6YA 4TY6A 5GPIB 1HXFH 6LPRA 4HZHA 2GZ9A 4X1PU 5C67A 1NFYA 3GCTF 5C20A 1EX3A 1O2RA 1ZMNA 3RXAA 3ATLA 2A0QB 3RXBA 1P06A 3RMOH 2Q6FA 3F9FA 3P8NA 2A7CA 3ZZ7A 3ITIA 3SJKA 1WQVH 1VITF 4GUXA 1SL3A 1DSUA 2TBSA 1FLEE 1HPGA 1HB0B 1Z71A 3O8BA 1L4ZA 2STBE 2ZA5A 2SGDE 1RRKA 3P8OA 1ESTA 1INCA 1QFKH 4NIXA 3BTKE 4CRGA 4RN6A 1E36B 2D26C 1L4DA 2OXSA 3MU8A 4Q80A 3TH2H 5JYIA 3BTGE 3EA7A 3TK6A 1SQOA 1G9IE 2I6SA 4OS4A 2A31A 3AW0A 1OWDA 1QB1A 2TGAA 2BHGA 4HFPB 5FCRA 1DXWA 1QB9A 1NS3A 3RLWH 8LPRA 4DG4A 4CH8B 5FAHA 5EW2H 1EJMA 4MG3A 3PROA 5E8EH 1V6DA 2FDAA 3VPKA 1M9UA 1MZAA 2BDIA 1GVLA 1SGFA 1P11E 3H7TA 2AIPA 2FX6A 1ELEE 2QCYA 3BTTE 5EQSA 5DP3A 3D62A 2Z3EA 1NY22 2G55A 1BTZA 5DP5A 3M7QA 2BXTH 2ZCLP 3GY2A 4X2YA 3RC6A 1XUKA 5LPRA 2A5IA 3RXTA 3U8TH 2OC1A 3T28A 1LDTT 5EODA 2GX4A 3VXFH 2BY5X 3TJVA 2ANMH 2B0FA 1CBWB 2BD5A 3TJUA 1O2OA 4TY7A 4JCNA 3M5NA 2OBQA 3BIUH 4NA7A 5J4SA 1GBAA 3LOXA 4ZKOU 4U01A 1DLKB 2GCTC 4VGCC 4JZEH 4JZIA 1CU1A 3D23A 1BMMH 4TWWA 1FJSA 2CJIA 4KTCA 1JXPA 2A2XH 4X2VA 2Z3DA 3GCNA 5C1YA 4XDEA 1O2WA 3MH7A 2PKAA 1RS0A 3UPEA 1A5IA 1AFEH 1TOMH 1V2RT 5FPTA 1OWIA 1HJ8A 1DS2E 2FLRH 1E38B 3K2UA 2IN2A 4MPXA 1RGQA 2JETB 1SMFE 2ZHQH 3U1IB 2PGQB 4GSOA 1GMHG 1PYTC 3SNCA 1GHAF 3CENA 2VWNA 2SGPE 5H4IB 1QJ1B 1SQAA 2GMTC 1O5EH 4NIYA 3RMMH 2RA3A 3ATWA 5LGOA 3TLOA 2XTTB 3M3TA 3VB6A 3BTQE 4CH2B 1VZQH 4AFZA 2A32A 3PYHA 2BDHA 4OS1A 1IQLA 1OKXA 4ABFA 1DVAH 3QGNB 3SBKA 4B71A 1MKWH 2BLVA 1A7SA 1TONA 3RXPA 3UFAA 2ZGCA 5JB9S 1NRPH 2QXIA 2RDLA 1GI2A 2V3OH 4X6OA 1BB0B 1SGEE 1WOFA 3HPTB 1YM0A 4MDSA 2Z9KA 4LZ4B 2BVSH 2J4IA 2OC8A 1J8AA 1O2LA 1RXPA 2GT8A 2ZGJA 4BOHA 1TIOA 1QL7A 3SU0A 2PSXA 3SV2H 5GCHF 1MKXK 1AU8A 1J17T 3T2NA 3PO1C 1RFNA 1ZSKA 3SU5A 1IQGA 2WPMS 3EAJA 1A3BH 4AGKA 3B9FH 2SGAA 1Z8IB 3LT3A 3SU1A 2BOHB 4NSVA 3UUZA 1LVOA 2IPHA 1ANEA 3ZZ3A 3TITA 2KAIA 2QGRA 5JPMH 2OQUA 4FVBA 3GICB 1PFXC 3VB7A 3P6ZB 1YCPM 4X2WA 2HRVA 1GJ4H 1AUTC 8GCHG 2DE9A 2FESH 2F9VA 3UNQA 3RMNH 1C4Y2 2J38A 1O3EA 2ANWA 4IMZA 1MU8B 3QK1A 1Z8JB 1T8MA 5E0GA 5PTPA 3EE0B 2IOTA 3OY6U 4K1SA 2C8XB 2ZFPH 4ISLA 1UTPA 2GDDA 1C2KA 3RXLA 2HLCA 2GKVE 1HAXB 4GCHG 2H9TH 2HALA 1KLIH 1O2GH 1Y3VA 1FN6A 3DHKH 1HNEE 4NG9H 1V2VT 2ZECA 3RXHA 1ID5H 2A2QH 1TX6A 1C5PA 3F1SB 4OS6A 2OQ5A 2W7SA 1YC0A 4JYVH 2DUCA 2FI5E 1ABJH 1C5NH 3QN7A 1DITH 3PWBA 5HMAA 1UK3A 2LNCA 2W26A 1C5WB 1SGTA 4JK5A 2VWMA 3I78A 3RP2A 4R0IA 3HKJB 2FS9A 3FZDA 1AY6H 4FUEA 3RXMA 2BY7X 1BMLA 4H4FA 5GXPA 1C2LA 7GCHG 3A83A 1KYNA 4FUIA 3MTYA 1P2KA 1PPGE 2Z3CA 1AN1E 4INLA 1UTQA 1G3DA 3H5CB 3E1XB 1O3NA 2BOKA 3TGJE 1O30A 1XUJA 1AZZA 2VWLA 1P3CA 2XC5A 4Y7AA 1ZHPA 3KIDU 4CBNA 2Z6BD 3E6PH 5A0CA 3LIWA 2XC4A 1ESAA 2QXJA 2Y7XA 4E05H 1O36A 1SQTA 2W7UA 1QY6A 1A5GH 3EGKH 4ABGA 3UWJH 1T8LA 1O5AB 2GCHF 3ZZDA 2CF9H 1ELFA 4DGJA 2R0KA 3QX5H 2OCVB 1J14A 3SNAA 5C5OA 1F5KU 1C9PA 1MZDA 4IGDA 3M5OA 1Z8RA 1HJAC 3ZVDA 2Z9LA 2O9QA 2QA9E 1TPSA 5T6FA 2XCNA 5CHAC 2FOAA 2ULLA 2YNBA 2BMGB 1ETRH 1VCQA 1O5DH 3ENSB 3EYDA 3QUMP 1MCTA 2O8WA 4ISOA 4JZ1A 2RG3A 2VNTA 3A7XA 1LQEA 1NU7B 1SGNE 4JYTA 2P8OC 1VGCC 1MTVA 3BG4B 5DG6A 4UE7H 5BPEA 1AI8H 2B8OH 3MNSA 1GBKA 2GD4B 4IBLH 1O5FH 1JWTA 4WMFA 1IQNA 4ZHLU 2Y6TA 3SOSA 3BTME 3ODFA 2FMJA 1EOLA 5J4QA 4X8UH 4I7YH 4K1TA 3A8DA 2AFQB 2ZCKP 1W7XH 1WCZA 1YPHC 1AVXA 2C90B 2ZZUH 3DFLA 4I8LA 1SLVB 3A81A 5A8XA 4FUHA 1RTFB 2H2ZA 2HVXA 2GZ7A 4YESB 1C4U2 4E7RG 1KY9A 4CHAB 4DCDA 3LGIA 2PWXA 2B9LA 4ZXYH 1CT4E 1AO5A 3K6YA 1GHBG 4OGYA 4UONA 2CXVA 3KN2A 5ETXA 1NFXA 3DFJA 1TA6A 4ZROA 1SHYA 1EPTC 1QQUA 4H42U 4O97A 8ESTE 4MNWA 1W3CA 3ATKA 1PPEE 1Y3UA 1Z7KA 1MTNB 2EI6A 4FXGH 1MD7A 3V0XA 3S9CA 1QBNA 2UWPA 6GCHG 1K1IA 2TGPZ 1UVTH 2R3UA 3FZZA 2CV3A 4NZQA 2ODQA 2ZI2H 1TBRH 1FN8A 2ZU3A 3SU3A 1CA0C 1XVMA 2R3YA 6CHAB 2Q1JA 1LHDH 1GMDF 1QBOA 1YLDA 3QGJA 4Q7XA 1EAXA 5ABWA 1HCGA 1TRMA 1TNGA 2FEQH 4H6TA 1TBQH 1YF4A 3GISB 4JZFH 3RU4E 1C5YB 5T3HA 3KF2A 2BDAA 2BXUH 3A7YA 1GBEA 3E16B 1K9OE 1C5UA 2NU1E 2PR3A 1O3JA 5GJ4B 3TNTA 2AGGX 4D9QA 1NRSH 1GVKB 3U8RH 1QHRB 4B75A 1ZTLA 3ZVBA 3SV7A 2Y81A 4AFQA 1O32A 4ZKNU 3S9BA 1P09A 4A5TS 1GHZA 1Q31A 2OC0A 1HAPH 1FDPA 4X6PA 3U69H 3S0NA 1H9IE 2D1JA 1ZZZA 1DY8A 3S69A 3M37A 5EXLA 5DP4A 1OSSA 4ZH8A 2GTBA 1CSOE 2A5AA 3M3VA 4BAHB 3S7KB 2R2MB 1GI7B 2G51A 1FIZA 3GYLB 4XBDA 3SU2A 1FY3A 2BD7A 2OD3B 2J92A 4X8VH 1L0ZA 5GIBA 3RXQA 1SVPA 1EZSC 1C5XB 3UQVA 5C3NA 2QXHA 3O8RA 4BANB 1ZRBA 3MNXA 4WMDA 2F3CE 2VIDA 2XW9A 1SGCA 2LPRA 2ZTXA 1F0UA 4IW4E 1GJ7B 1LVYA 4ZAEA 1O3OA 1GCTB 1YLCA 2A4GA 1O3IA 3GDUA 1HUTH 1AZ8A 1KXCA 2SGFE 1O2JA 1UVSH 2P94A 1BIOA 2BY8X 3E0NB 1LHEH 4DJZB 5A8YA 1ELCA 3RUOA 4MNYA 2FM2A 1V2MT 3S7HB 2ODYB 4AORA 4AG1A 1ELDE 3PTNA 4J2YB 3ZV9A 2XBXA 1TYNA 2PGBB 4ISHH 1QA7A 2KAIB 2VIQA 3LH1A 2SNVA 3M7UA 1QTFA 1FI8A 1BDAA 1OWEA 1HAGE 1QIXB 4BAKB 2QN5T 1LQDB 1Q2WA 3AAUA 1AFQB 1GHXH 1DFPA 3M3SA 1H9LB 1XXDA 1LPGB 1W8BH 1UTLM 2VVCA 3SW2B 1HLTH 3GY6A 1T8OA 5EU8A 1U6QA 1KTTB 1WTHD 1ELTA 1PQAA 2W3IA 2ZPRA 3MOCA 2Z94A 4TYDA 4Y6DA 1LHFH 3LU9B 1KIGH 2CHAB 2AGIX 1ETSH 2G8TA 3WY8A 3V3MA 4D9RA 3OU0A 4Z6AH 5SGAE 2XWBI 3ZZBA 4ZMAH 2BX4A 3GY5A 3UOPA 1O3LA 2G4TA 1GI9B 1MMJN 2ZCHP 1YCPK 2ZU2A 1D6RA 2H9HA 3RXDA 1O31A 4A1XA 1GBMA 2ZKSA 3SI3H 1IAUA 1UTMA 2TRMA 1V2QT 2C3SA 3GDSA 1TMTH 3LC5A 1C5SA 1GI5A 1Y3WA 5FPYA 5HM2A 3FVFB 1CHOF 1BZXE 2PV9B 1GBIA 2VWOA 2ZF0H 3M36A 1CO7E 3FP8E 1W7GH 4MPUA 1HIAB 2THFB 2Z7FE 2O8MA 4YT6H 3SJ8A 2G4UA 1GJBB 1SR5C 1HAVB 1SFIA 1QB6A 1S85A 1W12U 1TMUH 4XE4A 1GGDB 2ZC9H 1K1JA 1XKAC 1LO6A 3A8BA 2Z9GA 4UD9H 4DW2U 1FIWA 1J9CH 2ZDMA 2EEKA 4B2CA 1TNIA 3HK6B 1TX8A 3A7TA 1TPPA 2Y5GA 1AWHB 2J95A 1GJ8B 1AQ7A 5F6MA 1GI3A 1YPGH 2AS9A 3SNEA 4XSKU 1BITA 1O2HA 3SNDA 1YP9A 4DVAU 2RCEA 1P03A 5F8XA 1THSH 1ANDA 2AMQA 4Y79A 1QJ6B 2PTCE 1GDQA 7KMEH 4K2YA 3D49H 4E7NA 2K1QA 1LPKB 1FV9A 1D3QB 1BJUA 2A45B 2H5CA 4AG2A 5F8ZA 4U30A 4FU7A 4VGCB 4ZKSU 3MO3A 2BD8A 2ZU5A 1S6HA 3RXIA 2M5TA 1B0EA 4X1NU 3VEQB 1DT2A 1S81A 3F6UH 2J9NA 1DWCH 1B7XB 1PPCE 4BAOB 5C1XA 3BEIB 3UOUA 1TWXB 1ZPZA 2QAAA 2P59A 2HPQH 1O3DA 2JH6D 1J15A 1V3XA 1RIWC 1UK4A 1V2UT 3ZVEA 2VH6A 5A8ZA 2JKHA 4UFEH 2C93B 3BEFB 1JBUH 5FCKA 1AVGH 1GI0A 1NESE 1BA8B 1GJ9B 3GY7A 3KHVA 1C4V2 2WUBA 1HJ9A 3BTFE 3ZVGA 5TJXA 1DM4B 2BDYA 2XBWA 3ATMA 3A82A 1BTWA 2FTMA 2Z9IA 1ETTH 4WJG2 3MH5A 1OXGA 3S9AA 5AFYH 3PLBA 1ELVA 2OLGA 1GBFA 2FX4A 4YOGA 2V3HH 5B6OA 4UDWH 3ZZCA 1GCDA 1EOJA 3SUEA 1OP0A 1Z1JA 1YYY1 8KME2 1FUJA 2HWLB 1WYKA 4UFGH 3URCA 1W10U 1FNIA 4MTBA 5GWZA 1LTOA 1GG6C 1P01A 2ZNKH 1O2IA 1O3MA 1L1GA 1H8IH 1G32B 1GJ5H 1MAYA 2BD4A 1RD3B 4LZ1H 2FWWA 1BBRK 1C1WH 4CRAA 2BQWB 2HPPH 1EAIA 5K0HA 4TWYA 2I6QA 3RM0H 4FUJA 5FXLA 3TIUA 2SGEE 1F0TA 1SFQB 2IJOB 1GDNA 1UCYK 1O2VA 4MLFB 3SJOA 1EZXC 1L1NA 2BY9X 1F2SE 3D65E 2BQ6B 3A86A 1P2QA 3SU6A 2VB0A 3L6PA 3Q77A 4FU8A 1F92A 5AVDA 2A5KA 2BVXH 2ZTZA 1GDUA 2XYAA 1ZGIA 5FX6A 3TJNA 1DY9A 5L6NH 1YBWA 5GDSH 1V2WT 3RXEA 2FLBH 2FOEA 2TPIZ 3DT0H 3O8CA 1TFXA 3MO9A 1TGTA 2ZHEH 3VB5A 4B73A 2AYWA 2ZGHA 3TVJB 5EGMA 1O5GH 1ZTJA 1QCPA 1BHXF 2F9OA 4WY3A 1IQFA 1EP5A 4XBCA 4I8HA 3F9EA 5DK1A 2O8TA 4KTSA 1HXEH 1O38A 4FUGA 3AASA 1MUEB 3FP7E 3ZVCA 2OINA 5K7RA 1C1PA 1O39A 4Q7ZA 2K7XA 1J16A 1UHBB 2UWOA 4NSYA 4MNVA 2XBVA 2ODPA 4AX9H 1D3TB 5HYOA 1Z6JH 4I8JA 2GDEH 1IHSH 3SGAE 4HI3A 5EG4A 1X7AC 4I8KA 5TCAA 3EBNA 2Y7ZA 5A0AE 1ZSLA 1V2KT 4WH8A 4CRBA 3P70B 2UUFB 3KNXA 1T8NA 1DICA 2ZDNA 1AUJA 1EAUA 1K1OA 3BF6H 4X0WU 1GMCG 1OWHA 5E2OA 1O2NA 3LH3A 4OS2A 1BMNH 3PMBB 2ZFQH 1MTSA 3T27A 3ZVFA 2ZDKA 2EC9H 1HIAA 3BTEE 2YNAA 1ZR0A 2Y80A 3GYMA 4WXVA 1EATA 1S82A 1YPEH 2GZ8A 4AFUA 2VGCC 1SGPE 5EPNA 1HAVA 1OOKB 2FO9A 1CA8B 2AEIH 1ESBA 1GVZA 1ORFA 1S0QA 1HDTH 1EB1H 4CBOA 1KXBA 4TPIZ 4RKJB 1AWFH 1A3EH 4K69A 4AB8A 1TNKA 1O5CB 2V6NA 2ZG0H 4UFFH 3O8DA 1N6XA 2F9PA 2VVUA 3LGUA 4D8NA 1JMOH 4BTIB 1T32A 1OP2A 1GMHF 1FY5A 3R3GB 1S83A 4NWKA 1IQMA 1FQ3A 1K22H 5A0BA 1XKBC 3M35A 1CE5A 1LHGH 2A7JA 2G52A 3QZQA 1GI8B 4ASHA 4R8TB 1S6FA 5CHAB 3SUFA 2V35A 5L2ZH 1NRRH 1SOZA 1ZJDA 2F91A 4DY7B 3BSQA 4BAMB 4FUBA 1MCVA 5DGJA 1V2ST 5EQQA 1TLDA 2UUKB 4ZUHA 3M5LA 1Y8TA 1L2EA 2P8OB 1DWDH 1C1TA 4Y8ZA 3T25A 2Q6DA 2PLXA 3OY5U 1YKTA 3BEUA 3A89A 1WTGH 1UTOA 1JRTA 2ESTE 4D7FA 1SC8U 4BAQB 4KKDA 2VIPA 2H6MA 3QTVH 4AGJA 1V2TT 2Y5FA 1T7CA 3GY8A 1SPJA 1N8OB 1C5VA 3LJJA 3MMGA 3UTUH 1VCWA 1V2NT 2WPIS 3UIRA 1TMBH 1OS8A 1EKBB 1DANH 1T4UH 5JBBS 4O3UA 1C5MD 1Y5AT 4BTTB 1QNJA 2ASUB 1C5TA 1QRXA 1NT1A 2VIWA 4YTAA 1LVMA 2P95A 1B5GH 3SO3A 1UO6A 2EA3A 2ZFRH 4CHAC 2BY6X 4B76A 2A4OA 1MKXH 1MD8A 4A6LA 4AYYB 2WPKS 2GT7A 3RXOA 8GCHF 2G81E 3SQEE 5AHGH 4Y11E 2EI7A 3PV4A 4ISNA 1B0FA 1HBTH 3KEEA 3NZIA 5EQRA 3B8JA 2BLWA 4A92A 4FU9A 2OC7A 5LH8A 3GCTG 1C1MA 3HGPA 1D3DB 5ESBA 2FOBA 2XNIA 5L30H 4Y8YA 5AF9H 1SI5H 5LPEA 1PQ5A 2ZU4A 4GCHF 1VITG 1NC6A 3AAVA 3Q00A 1BCUH 2P3UB 2WINI 2ZU1A 4LOYH 4K1EA 4CR5A 1KLTA 2HNTE 5DP7A 1DPOA 2PKSB 1KDQB 4NIWA 2UWLA 2VH0A 3MI4A 6CHAC 3TU7H 1YPMH 3SGQE 1AB9B 4ABIA 2F9NA 1C1RA 1Y3YA 4X1RU 1AD8H 2GV7A 1TQ0B 1MQ5A 2GV6A 2QF3A 1BTYA 2C8YB 4O03A 2WPJS 2AERH 2FOHA 5HGGA 1MU6B 7GCHF 1QR3E 3K6ZA 3UY9A 1AGJA 4I8GA 2ZFFH 2XCFA 1QL8A 2NU4E 4NIVA 1GJ6A 1EJAA 1NPMA 4IS5A 2ANYA 3ZVAA 2F9BH 3RDZA 2H1UA 1IQEA 9LPRA 1G30B 2D8WA 4ESTE 4GAWA 1SGDE 4NFEA 2HGTH 2J34A 1Y59T 2R9PA 1BMAA 1QURH 3QWCH 4CRDA 3TPIZ 2ZO3H 5IYTA 1IOEA 3QTOH 3RXSA 1L1JA 5JBCS 3RMLH 2FI4E 3SN8A 1QQ4A 2NU0E 1LMWB 1HAZB 3STIA 4AFSA 1KSNA 1TGCA 2H9EH 1TPOA 1HGTH 5F03A 3KGPA 3VGCB 1CT0E 3ZZ5A 1UHBA 1T4VH 4K60A 2FOFA 1FY4A 3LGWA 4BNRA 3TH4H 1BRAA 2FOGA 4NGAH 1ZHRA 3MO6A 3A88A 3NWUA 3PB1E 3QZRA 4OGXA 1CGHA 3IG6B 2FODA 3Q3YA 3QLPH 4J1YA 1DOJA 1TGNA 3CP7A 3NUMA 1GHWH 5IDKA 2A7HA 1TPAE 5AFZH 4XFQA 1LHCH 1S0RA 4Z0KA 4B1TA 3GCHB 3ODDA 4WMEA 4WF8A 1GCTC 2WV4A 2XWAA 2PSYA 1MBQA 1IQIA 1MBMA 1TA2A 4WVPE 1PYTD 1CQQA 4YOJA 1FY8E 2ZDLA 4ABEA 1O2YA 1NFUA 5F8TA 7ESTE 1ZMLA 1O2UA 1G3CA 3SUGA 3L33A 2SNWA 3SGBE 1C2HA 3UR9A 1GBJA 2FOMB 3E8LA 1MH0A 1JIRA 3HGNA 1O2ZA 4IMQA 1GHAG 1MKWK 1TOCB 1A0JA 1Y3XA 1HRTH 1K2I1 3QDZB 5TCCA 1GI4A 1C1QA 1WQSA 5I25A 1ANBA 1GHBF 2ZTYA 1SGYE 1JIMA 2V0BA 3W94A 3U1JB 1MTUA 2O8UA 1P04A 4UEHH
chains in the Genus database with same CATH superfamily
1C1OA 3N99A 5CE1A 2TGDA 1NM6A 3PRDA 4X1QU 1ZLRA 2J94A 4TPYA 1Y5UT 3LJOA 2NU2E 2SGQE 3R0FA 1WUNH 2QV1A 6GCHF 3SV6A 4P02A 2TGTA 3Q76A 4ZHMU 1C2DA 1IQKA 1C9TA 3BTHE 4NA8A 1YPJH 1K28D 1F5LA 4NWLA 5C1UA 3RLYH 3VG8A 1OPHB 1P9SA 1ELAA 1O3CA 1FPCH 2VINA 1O2TA 4Y7BA 5HM9A 1BMFD 3E3TA 4ABAA 2WUCA 5HKKD 3UREA 2FZZA 3VXEH 5FHTA 5HIZA 1F5RA 2FYQA 2BLOA 2FI3E 5GCHG 1VJAU 4E06H 1GBDA 4Q2KA 1AVWA 3LDXH 2QF4A 1A4WH 5EPYA 4IC6A 1BOQA 1O33A 1ANCA 3DD2H 1GPZA 2WPHS 2FPZA 1HAIH 2PTNA 4SGBE 5ESTE 1FZZA 1GJAB 2GGVB 4QT8C 1EASA 4YM9A 3PLKA 2WPLS 2AH4X 3PMHB 3GDVA 3MU4A 3FO8D 4I31A 3WW7A 1OWJA 1Z6EA 1MTWA 1KXEA 1YGCH 1ZMJA 3UWIA 4FUDA 1V2JT 1F0RA 1GGDC 3A8CA 3FAOA 1AIXH 3KQBA 1QL9A 1XXFA 1ZPBA 1K1NA 4LK4A 1EPTA 1UTJA 1CGIE 1PJPA 3A8AA 3Q3XA 2ZDVH 3OSYA 5EXMA 1W0KD 1A46H 1P2JA 3P8FA 1E0FD 2WYGA 1P3EA 3SZEA 4JMYA 1ZGVA 3P95A 1VITH 3BN9A 2QE7D 1CT2E 1GBLA 1BTUA 1LVBA 1SGRE 1N1LA 2ZPQA 3RXKA 1GBHA 1GHVH 4Q7YA 1A1RA 4YZUA 4CRFA 2BDGA 3B23B 5E0JA 5EW1H 4FVDA 1O2MA 2ZHWH 4KGAA 2ZQ2A 3OYPA 2GP9B 1CVWH 2C8WB 3F9HA 2PFEA 1FONA 3UNRA 3PMJA 1VJ9U 1Q3XA 2B7DH 3T29A 2PHBA 1ZYOA 2C4FH 1HAOH 3TNSA 1K1LA 1SGQE 2GCTB 1YLNA 2BDBA 1ELGA 1G3EA 1O0DH 1CBWC 3I29A 1EFRD 1AMHA 5FX5A 3U9AH 2NU3E 1G2LA 4DURA 3LONA 3PMAB 2CGAA 2RFKC 1KDQA 3MU0A 2BB4A 1HV7A 2QY0B 3BV9B 3G01A 3KQDA 2B5TB 3E0PB 3NXPA 1HAYB 1O3KA 1KXFA 1V2LT 1G36A 4RSPA 4YO9A 4XRNA 2FYRA 4IC5A 1F7ZA 2AHME 1GJDB 1NRQH 5JBAS 1UMAH 2BD3A 4X6MA 4Y0ZE 4B2AA 2ZPSA 1RIWB 4MPVA 3RC5A 1C1VH 1LKAA 1BT7A 1P02A 1OWKA 1KTSB 1E1RD 2BVRH 2OUAA 4U2WA 1W13U 1AKSB 1UTKA 1EUFA 1P2OA 3KL6A 2GMTB 2GCHG 2W3KA 2JETC 3ZV8A 4A1VA 3GS9A 1XX9A 4YOIA 2CMYA 2A1DB 1Y5BT 1PQ8A 1ARBA 4K5ZA 1W14U 1A2CH 2WV5A 4DIHH 1NO9H 4AN7A 4WH6A 3UR6A 5LPFA 3UQOA 1CGJE 1EAWA 4GVUA 3N7EA 2Y82A 3TK9A 2L74A 2R2WU 1QA0A 1E37B 4I86A 1BJVA 5FL7D 1CHGA 3LGTA 3UNSA 4KELA 1D4PB 1XUGA 2ZEBA 3ZIAD 2H5DA 4PROA 5DP8A 1C5LH 3PV2A 3T26A 3PRBA 1QRZA 4F48B 4NCYA 2FTLE 2LIZA 3F68H 2XRCA 2FIRH 1GG6B 3V7TA 2KM0A 1O3FA 3MNBA 1P9UA 3E91A 3QO6A 1UVUH 2J2UA 3F0PA 1YPLH 1HFDA 2FOCA 3PO1B 3GOVB 1ACBE 3MH6A 4CRCA 3EDXB 4CREA 4GHTA 4NA9H 4ABBA 1G2MA 1DX5M 1DXPA 1WU1A 1GL0E 3MH4A 2DE8A 4RKOB 1PQ7A 2ZIQH 4AYVB 2HOBA 4GPGA 5DPAA 2O8LA 2NWNA 1YCPH 3EQ0H 1O5BB 1ZRKA 2P16A 1C1NA 1TX7A 1O3PB 1O3AA 4BXSA 1BQYA 1QJ7B 1GL1A 5JB8S 1W2KH 3BTDE 4Y71A 4AZ2B 2JIZD 1O3HA 2HNTF 1A0LA 1P05A 2A4RA 3V12A 3K9XB 3SI4H 4A7IB 4ZHAA 1FAXA 2OTVA 1G3BA 4YLQH 1UVOA 4H6SB 3SUDA 5EXNA 2P3TB 2P93A 4F4OC 2JDID 2QIQA 1DWEH 4JYUH 1OX1A 3ZZ9A 3M7TA 4X6NA 3NKKA 1AHTH 1NFWA 5E2PA 1YPHE 4B74A 1C2FA 1SOTA 1XVOA 4BTUB 1IQJA 1GMDG 3N7DA 3RXUA 1VCPA 3BG8A 4DOQA 3AW1A 3OX7U 3TGKE 4O9VA 1NZQH 1DLEA 4K8YA 4MNXA 3DCLA 1F0SA 1BTHH 1BTXA 1ELBA 1NU9A 3KQEA 4GHQA 3SZNA 1SGIB 2BQ7B 3TH3H 2R0LA 1EB2A 1THPB 3SORA 4B2BA 3MYWA 3SHCH 3P17H 2JH5D 3EA9A 4M7GA 3A84A 4ABDA 1O37A 1K21H 2F83A 2VGCB 7LPRA 4XOJA 2BZ6H 2WYJA 2ZHDA 1ZPCA 3GY3A 4JK6A 1TRNA 2BLQA 3N7OA 1WBGB 3VFEA 3MHWU 2ZHFH 1OYQA 3M5MA 2STAE 2Y5HA 1FAKH 1QRWA 1PPBH 3P92A 1SBWA 4WWYA 1P10A 2KX4A 3KCGH 1RTLA 2Q6GA 3RXJA 4GLYA 1BRCE 1H1BA 4AOQA 2AGEX 5BRRE 4JZDH 3HKIB 1SLXB 3NK8A 5EJLA 1HJAB 4U32A 3I77A 4NZLA 3PWCA 1OP8A 3IWMA 1O2XA 3MFJA 1TB6H 3ESTA 3A7ZA 3RXRA 2P3FH 4F49A 5A09A 1XUFA 4MPWA 2Z9JA 1BTPA 1VGCB 3TJOA 4Y8XA 3A7WA 3EA8A 1LPZB 5C2ZA 4OS5A 2ZGBH 2BYAX 3W95A 1C2GA 1TAWA 2CN0H 3RXGA 3C27B 3A85A 2BDCA 2QC2A 1DSTA 1FMGA 1GJCB 1O2SA 3BG4C 1HAHH 2GVFA 4AB9A 1TALA 3IITA 4LXBH 2VJ1A 1ZSJA 2ZDAH 1TBZH 4BXWA 1SKYE 5HIYA 3FANA 3U98H 2BX3A 2G5NA 1PPZA 1EZUC 3NPSA 4SGAE 4FUCA 1O3GA 1XUIA 1MQ6A 1S5SA 1WV7H 1C5RA 1O3BA 1EZQA 1TNLA 4IN1A 1QBVH 4D7GA 2ZFSA 3GY4A 1BUIA 1H8ED 2QXGA 5T6DA 1N8OC 1TGBA 2OK5A 3SJ9A 2QF0A 2BTCE 1UK2A 1C1SA 1UTNA 1PPFE 4NFFA 5DKMA 1TRYA 3RU4D 1UVPA 5JBTA 4CR9A 1EPTB 5DP9A 4ZXXH 3ZZ6A 1UJ1A 1AKSA 1WAYB 1P12E 1QGFA 3JZ1B 4KTUA 1LKBA 1PPHE 5DN6D 3NCLA 2QYIA 5KGOA 3MU1A 1BBRH 3P8GA 1NROH 5HXFA 4Y0YE 1SLUB 5FBIA 6ESTA 3BIVH 3LGYA 4M9FA 4UFDH 3PTBA 1H9HE 1GBCA 1Z8GA 2RDEA 1A5HA 1A0HB 4D76A 1ZJKA 1DWBH 1GI6A 1TABE 2CF8H 1UCYH 1AE8H 1MTNC 5L2YH 2ZGXH 1E79D 1KXAA 3MU5A 3SHAH 3V13A 1XM1A 1CA0B 4WXIA 3RU4T 1EJNA 4DT7B 3LPRA 5I46H 3A80A 1TNHA 1P2NA 2W5EA 3K65B 3T62A 1TE0A 1V2PT 1E35B 2FXRA 1SSXA 2OBOA 2FS8A 3RXFA 1TNJA 1FY1A 1CHOG 1W0JD 3ZZ8A 3STJA 2C8ZB 4HTCH 1E34B 3C1KA 4THNH 4YLUA 4INKA 3DA9B 3LGVA 2BD9A 1O2QA 3T5FH 5DO4H 5CMXH 1S84A 2PKSC 1GMCF 1TQ7B 3JZ2B 1ZTKA 1KXDA 3A87A 4MVNA 3M61U 3F9GA 3LKWA 2G5VA 2VIVA 2V7QD 1GWAA 1O2PA 1O2KA 1W0ZU 1JRSA 4B6EA 3SNBA 2PKAB 1AB9C 2ILNA 3L3TA 3LC3A 2ZFTA 1GBBA 1NBME 1THRH 2UUYA 2BM2A 3HK3B 1P57B 2WSSD 1SQRA 1SG8B 1SB1H 4ABHA 2BZAA 2RA0A 3RC4A 1GI1A 3DSOA 4I32A 4DIIH 4X8SH 2PW8H 2ALPA 2KCPA 1AE5A 3PLPA 3SQHE 1A61H 2PUXB 1XMNB 4K3JA 3CS7A 1G37A 4X2XA 2ZP0H 3GCOA 3ZZAA 1ABIH 1P8VC 3DUXH 3VB3A 1EP6A 2ALVA 4Y10E 2VU8E 2YOLA 3FOAA 3URDA 2UUJB 4IN2A 2VVVA 1P0SH 1W0YH 1SGFG 1H8HD 1HYLA 2G00A 4K8BA 2L6OA 2D2DA 1C1UH 3Q3KA 3OEED 1SHHB 2XC0A 2AIQA 3ZZ4A 1V2OT 3MWIU 3FP6E 5DP6A 3H7OA 2A4QA 4I33A 5FPSA 3VB4A 2ANKH 2BD2A 3A7VA 5A2MH 4X1SU 3RXCA 1NTPA 2VIOA 3ATIA 1GHYH 3KQCA 3VGCC 1VR1H 4ZKRU 4KP0A 1P2MA 1BRUP 2PUQH 1BRBE 1NN6A 5DJ7A 1C2IA 1C5QA 3U8OH 4XBBA 1DE7H 1H8DH 1K1MA 3SV9A 3PM3A 1XUHA 3SU4A 1Z1IA 3AVZA 1C2JA 1SLWB 4ABJA 5G4BA 2XXLA 1NRNH 1EQ9A 1DUEA 1C2EA 3RXVA 4X8TH 9ESTA 3SV8A 1ZOMA 3CS0A 2F9UA 3TGIE 4O3TA 2FP7B 3FFGA 3GCHC 3E90B 3OAAD 1O34A 1LCYA 4INHA 3MNCA 2ZQ1A 1KLJH 4Y76A 1FPHH 2EI8A 2AMDA 1GBTA 3OTJE 3ZYDA 5EOKA 1EXFA 2ZWLH 2HNTC 2SFAA 2XBYA 1BBRE 3ELAH 5FBEA 5T6GA 1T31A 2AMPA 1O35A 1TGSZ 1W11U 5JDUB 1IQHA 4YT7H 1ZHMA 3TK5A 1BHXB 1MAXA 1AFQC 3BTWE 1C5ZB 1YPKH 3HATH 1UCYE 5E0HA 4Q63A 1ARCA 1P2IA 4HGCA 4FUFA 1WSSH 3RM2H 2TIOA 1D3PB 1IHTH 3ZYEA 1D6WA 1DUAA 3FN8A 1DDJA 1JOUB 1RTKA 4MQAA 2CHAC 1OYTH 4ISIH 4OS7A 5C5NA 2OP9A 1FXYA 2JH0D 4A1TA 1RJXB 1K1PA 1C2MA 1D9IA 3WWFA 1H4WA 3CNRA 1C5OH 3SJIA 1N6YA 4TY6A 5GPIB 1HXFH 6LPRA 4HZHA 2GZ9A 4X1PU 5C67A 1NFYA 3GCTF 5C20A 1EX3A 1O2RA 1ZMNA 3RXAA 3ATLA 2A0QB 3RXBA 1P06A 3RMOH 2Q6FA 3F9FA 3P8NA 2A7CA 3ZZ7A 3ITIA 3SJKA 1WQVH 1VITF 4GUXA 1SL3A 1DSUA 2HLDD 3UB0A 2TBSA 1FLEE 1HPGA 1HB0B 1Z71A 3O8BA 1L4ZA 2STBE 2ZA5A 2SGDE 1RRKA 4FOUC 3P8OA 1ESTA 1INCA 1QFKH 4NIXA 3BTKE 4CRGA 5C94A 4RN6A 1E36B 2D26C 1L4DA 2OXSA 3MU8A 4Q80A 3TH2H 2KCYA 5JYIA 3BTGE 3EA7A 3TK6A 1SQOA 1G9IE 2I6SA 4OS4A 2A31A 1UW7A 3AW0A 1FX0B 1OWDA 1QB1A 2TGAA 1VKYA 2BHGA 4HFPB 5FCRA 1DXWA 1QB9A 1NS3A 3RLWH 8LPRA 4DG4A 3PV5A 4CH8B 5FAHA 5EW2H 1EJMA 4MG3A 3PROA 5E8EH 1V6DA 2FDAA 3VPKA 1M9UA 1MZAA 2BDIA 2J5UA 1GVLA 1SGFA 1P11E 3H7TA 2AIPA 2FX6A 1ELEE 2QCYA 3BTTE 3OE7D 2XOKD 5EQSA 5DP3A 3D62A 2Z3EA 1NY22 2G55A 1BTZA 5DP5A 3M7QA 2BXTH 2ZCLP 3GY2A 4X2YA 3RC6A 1XUKA 5C0UA 5LPRA 2A5IA 3RXTA 3U8TH 2OC1A 3T28A 1LDTT 5EODA 2GX4A 3VXFH 2BY5X 2W6JD 3TJVA 2ANMH 2B0FA 1CBWB 2BD5A 3TJUA 1O2OA 4TY7A 4JCNA 3M5NA 2OBQA 3BIUH 4NA7A 5J4SA 3U28C 1GBAA 3LOXA 4ZKOU 4U01A 1DLKB 2GCTC 4VGCC 4JZEH 4JZIA 1CU1A 3D23A 1BMMH 4TWWA 1FJSA 4DT4A 2CJIA 4KTCA 1JXPA 2A2XH 4X2VA 2Z3DA 3GCNA 5C1YA 4XDEA 1O2WA 3MH7A 2PKAA 1RS0A 3UPEA 1A5IA 1AFEH 1TOMH 1V2RT 5FPTA 1WXRA 1OWIA 2J98B 1HJ8A 1DS2E 2FLRH 1E38B 3K2UA 2IN2A 4MPXA 1RGQA 2JETB 1SMFE 2ZHQH 3U1IB 2PGQB 4GSOA 1GMHG 4RT1A 1PYTC 3SNCA 1GHAF 3CENA 2VWNA 2SGPE 5DSFA 5H4IB 1QJ1B 1SQAA 2GMTC 1O5EH 4NIYA 3RMMH 2RA3A 3ATWA 5LGOA 3TLOA 2XTTB 3M3TA 1WDIA 3VB6A 2WHXA 3BTQE 4CH2B 1VZQH 4AFZA 2A32A 3PYHA 2BDHA 4OS1A 1IQLA 1OKXA 4ABFA 1DVAH 3QGNB 3SBKA 4B71A 3AK5A 1MKWH 2BLVA 1A7SA 1TONA 3RXPA 3UFAA 2ZGCA 5JB9S 1NRPH 2QXIA 2RDLA 1GI2A 2V3OH 2YMSC 4X6OA 1BB0B 1SGEE 1WOFA 3HPTB 1YM0A 4MDSA 2Z9KA 4LZ4B 2BVSH 2J4IA 2OC8A 1J8AA 1O2LA 1RXPA 2GT8A 2ZGJA 4BOHA 1TIOA 1QL7A 3SU0A 2PSXA 3SV2H 5GCHF 1MKXK 1AU8A 1J17T 3T2NA 2JJ2D 3PO1C 1RFNA 1ZSKA 4TT3D 3SU5A 1IQGA 2WPMS 3EAJA 1A3BH 4AGKA 3B9FH 2SGAA 1Z8IB 3LT3A 3SU1A 2BOHB 4NSVA 3UUZA 1LVOA 2IPHA 1ANEA 3ZZ3A 3TITA 2KAIA 2QGRA 5JPMH 5GNDA 5KEDA 2OQUA 4FVBA 3GICB 1PFXC 3VB7A 3P6ZB 1YCPM 4X2WA 2HRVA 1GJ4H 1AUTC 8GCHG 2DE9A 2FESH 2F9VA 3UNQA 3RMNH 1C4Y2 2J38A 1O3EA 2ANWA 4IMZA 1MU8B 3QK1A 1Z8JB 1T8MA 5E0GA 3F0OA 5PTPA 3EE0B 2IOTA 3OY6U 4K1SA 2C8XB 2F4LA 2ZFPH 4ISLA 1UTPA 2GDDA 4RI0A 1C2KA 3RXLA 2HLCA 2GKVE 1HAXB 4GCHG 2H9TH 2HALA 1KLIH 1O2GH 1Y3VA 1FN6A 3DHKH 1HNEE 4NG9H 1V2VT 2ZECA 3RXHA 1ID5H 2A2QH 1TX6A 1C5PA 3F1SB 4OS6A 4Q4LA 2OQ5A 2W7SA 1YC0A 4JYVH 2DUCA 2FI5E 1ABJH 1C5NH 3QN7A 2W6ID 1DITH 3PWBA 5HMAA 1UK3A 2LNCA 2W26A 1C5WB 1SGTA 4JK5A 2VWMA 3I78A 3RP2A 4R0IA 3HKJB 2FS9A 3FZDA 1AY6H 4FUEA 3RXMA 2BY7X 1BMLA 4H4FA 5GXPA 1C2LA 7GCHG 3A83A 1KYNA 4FUIA 3MTYA 2LELA 1P2KA 1PPGE 2Z3CA 1AN1E 4INLA 1UTQA 1G3DA 3H5CB 3E1XB 1O3NA 2BOKA 3TGJE 1O30A 1XUJA 1AZZA 2VWLA 1P3CA 2XC5A 4Y7AA 1ZHPA 4FETA 3KIDU 4CBNA 2Z6BD 3E6PH 5A0CA 3LIWA 2XC4A 1ESAA 2QXJA 2Y7XA 4E05H 1O36A 1SQTA 2W7UA 1QY6A 1A5GH 3EGKH 4ABGA 3UWJH 1T8LA 1O5AB 2GCHF 3ZZDA 2CF9H 1ELFA 4DGJA 2R0KA 3QX5H 2OCVB 1J14A 3SNAA 5C5OA 1F5KU 1C9PA 1MZDA 4IGDA 3M5OA 1Z8RA 3KQ5A 1HJAC 3ZVDA 2Z9LA 2O9QA 2QA9E 1TPSA 5T6FA 2XCNA 5CHAC 2FOAA 2ULLA 3W1EA 2YNBA 2BMGB 1ETRH 1VCQA 1O5DH 3ENSB 3EYDA 3QUMP 1MCTA 2O8WA 4ISOA 4JZ1A 2RG3A 2VNTA 3A7XA 1LQEA 1NU7B 1SGNE 4JYTA 2P8OC 1VGCC 1MTVA 3BG4B 5DG6A 2VBCA 4UE7H 5BPEA 1AI8H 2B8OH 3MNSA 1GBKA 2GD4B 4IBLH 1O5FH 1JWTA 4WMFA 1IQNA 4ZHLU 2Y6TA 3SOSA 3BTME 3ODFA 2FMJA 1EOLA 5J4QA 2F43B 4X8UH 4I7YH 2LP6A 4K1TA 3A8DA 2AFQB 2ZCKP 1W7XH 1WCZA 1YPHC 1AVXA 2C90B 2ZZUH 3DFLA 4I8LA 1SLVB 3A81A 3DSGA 5A8XA 4FUHA 1RTFB 2H2ZA 2HVXA 2GZ7A 2J98A 4YESB 1C4U2 4E7RG 1KY9A 4CHAB 4DCDA 3LGIA 2PWXA 2B9LA 4ZXYH 1CT4E 1AO5A 3K6YA 1GHBG 4OGYA 4UONA 2CXVA 3KN2A 5ETXA 1NFXA 3DFJA 1TA6A 4ZROA 1SHYA 1EPTC 1QQUA 4H42U 2KZ4A 4O97A 8ESTE 4MNWA 1W3CA 3ATKA 1PPEE 1Y3UA 1Z7KA 1MTNB 2EI6A 4FXGH 1MD7A 3V0XA 3S9CA 1QBNA 2UWPA 6GCHG 1K1IA 2TGPZ 1UVTH 2R3UA 3FZZA 2CV3A 4NZQA 2ODQA 2ZI2H 1TBRH 1FN8A 2ZU3A 3SU3A 1COWD 1CA0C 1XVMA 2R3YA 6CHAB 2Q1JA 1LHDH 1GMDF 1QBOA 1YLDA 1YY3A 3QGJA 4Q7XA 1EAXA 5ABWA 1MABB 1HCGA 1TRMA 1TNGA 2FEQH 4H6TA 1TBQH 1YF4A 3GISB 4JZFH 3RU4E 1C5YB 5T3HA 3KF2A 2BDAA 2BXUH 3A7YA 1GBEA 3E16B 1K9OE 1C5UA 2JJ1D 2NU1E 2PR3A 1O3JA 5GJ4B 3TNTA 2HVYB 2AGGX 4D9QA 1NRSH 1GVKB 3U8RH 1QHRB 4B75A 1ZTLA 3ZVBA 3SV7A 2Y81A 4AFQA 1O32A 4ZKNU 3S9BA 1P09A 5B6LA 4A5TS 1GHZA 1Q31A 2OC0A 1HAPH 1FDPA 4X6PA 3U69H 3S0NA 1H9IE 2D1JA 1ZZZA 1DY8A 3S69A 1KMHB 3M37A 5EXLA 5DP4A 1OSSA 4ZH8A 3H09A 2GTBA 1CSOE 2A5AA 3M3VA 4BAHB 3S7KB 2R2MB 1GI7B 2G51A 1FIZA 3GYLB 4XBDA 3SU2A 1FY3A 2BD7A 2OD3B 2J92A 4X8VH 1L0ZA 5GIBA 3RXQA 1SVPA 1EZSC 1C5XB 3UQVA 5C3NA 2QXHA 3O8RA 4BANB 1ZRBA 3MNXA 4WMDA 2F3CE 2VIDA 4P00A 2XW9A 1SGCA 2LPRA 2ZTXA 4HG6A 3WWBA 1F0UA 4IW4E 1GJ7B 1LVYA 4ZAEA 1O3OA 1GCTB 1YLCA 2A4GA 1O3IA 3GDUA 1HUTH 1AZ8A 1KXCA 2SGFE 1O2JA 1UVSH 1OHHD 2P94A 1BIOA 2BY8X 3E0NB 1LHEH 4DJZB 5A8YA 1ELCA 3RUOA 4MNYA 2FM2A 4OM9A 1V2MT 3S7HB 5EIYA 2ODYB 4AORA 4AG1A 5IK2D 1ELDE 3PTNA 4J2YB 3ZV9A 2XBXA 1QZ8A 1TYNA 2PGBB 1E1QD 4ISHH 1QA7A 2KAIB 2VIQA 3LH1A 2SNVA 3M7UA 1QTFA 1FI8A 1BDAA 1OWEA 1HAGE 1QIXB 4BAKB 2QN5T 1LQDB 1Q2WA 3AAUA 1AFQB 1GHXH 1DFPA 3M3SA 1H9LB 1XXDA 1LPGB 1W8BH 1UTLM 2VVCA 3SW2B 1HLTH 3GY6A 1T8OA 5EU8A 1U6QA 1KTTB 1WTHD 1ELTA 1PQAA 2W3IA 2ZPRA 3MOCA 2Z94A 4TYDA 4Y6DA 1LHFH 3LU9B 1KIGH 3KYGA 2CHAB 2AGIX 1ETSH 2G8TA 3WY8A 3V3MA 4D9RA 3OU0A 2YMSD 4Z6AH 5SGAE 2XWBI 3ZZBA 4ZMAH 2BX4A 3GY5A 3UOPA 1O3LA 2G4TA 1GI9B 1MMJN 2ZCHP 1YCPK 2V3MA 2ZU2A 1D6RA 2H9HA 3RXDA 1YWUA 1O31A 4A1XA 1GBMA 2ZKSA 3SI3H 1IAUA 2IPQX 1UTMA 2TRMA 1V2QT 2WV9A 2C3SA 3GDSA 1TMTH 3LC5A 1C5SA 1GI5A 1Y3WA 5FPYA 5HM2A 3FVFB 1CHOF 1BZXE 2KFWA 2PV9B 3MQKC 1GBIA 2VWOA 2ZF0H 3F2FA 3M36A 1CO7E 3FP8E 1W7GH 4MPUA 1HIAB 2THFB 2Z7FE 4RT0A 2O8MA 4YT6H 3SJ8A 2G4UA 1GJBB 1SR5C 1HAVB 1SFIA 1QB6A 1S85A 1W12U 1TMUH 4XE4A 1GGDB 2ZC9H 1K1JA 1XKAC 1LO6A 1S6LA 3A8BA 2Z9GA 4UD9H 4DW2U 1FIWA 1J9CH 2ZDMA 2EEKA 4B2CA 1TNIA 3HK6B 1TX8A 2M2AA 3A7TA 1TPPA 2Y5GA 1AWHB 2J95A 1GJ8B 1AQ7A 5F6MA 1GI3A 1YPGH 2AS9A 3SNEA 4XSKU 1BITA 1O2HA 3SNDA 1YP9A 5F53A 4DVAU 1K0HA 2RCEA 3OTPA 1P03A 5F8XA 1THSH 1ANDA 2AMQA 4Y79A 1QJ6B 2PTCE 1GDQA 7KMEH 4K2YA 3D49H 4E7NA 2K1QA 1LPKB 1FV9A 3F3BA 1D3QB 3OFND 3EE7A 1BJUA 2A45B 2H5CA 4AG2A 5F8ZA 4U30A 4FU7A 4VGCB 4ZKSU 3MO3A 2BD8A 2ZU5A 1S6HA 3RXIA 2M5TA 1B0EA 4X1NU 3VEQB 1DT2A 1S81A 3F6UH 2J9NA 1DWCH 1B7XB 1PPCE 4BAOB 5C1XA 3BEIB 3UOUA 1TWXB 1ZPZA 2QAAA 2P59A 2HPQH 1O3DA 2JH6D 1J15A 1V3XA 1RIWC 1UK4A 2WPDD 1V2UT 3ZVEA 2VH6A 5A8ZA 2JKHA 4UFEH 2C93B 3BEFB 1JBUH 2IJD1 5FCKA 3UAIC 1AVGH 1GI0A 1NESE 1BA8B 1GJ9B 3GY7A 3KHVA 1C4V2 5C17A 2WUBA 1HJ9A 2GJGA 3BTFE 3ZVGA 5TJXA 1DM4B 2BDYA 2XBWA 3ATMA 3A82A 1BTWA 2FTMA 2Z9IA 1ETTH 4WJG2 3MH5A 1OXGA 3S9AA 5AFYH 3PLBA 1ELVA 2OLGA 1GBFA 2FX4A 4YOGA 2V3HH 5B6OA 4UDWH 3ZZCA 1GCDA 1EOJA 3SUEA 1OP0A 1Z1JA 1YYY1 8KME2 1FUJA 2HWLB 1WYKA 4UFGH 3URCA 2YMSB 1W10U 1FNIA 4MTBA 5GWZA 1LTOA 1GG6C 1P01A 2ZNKH 1O2IA 1O3MA 1L1GA 3DSPA 1H8IH 1G32B 1GJ5H 1MAYA 2BD4A 1RD3B 4LZ1H 2FWWA 1BBRK 1C1WH 4CRAA 2BQWB 2HPPH 1EAIA 5K0HA 4TWYA 2I6QA 3RM0H 4FUJA 5FXLA 3TIUA 2SGEE 1F0TA 1SFQB 2IJOB 1GDNA 1UCYK 1O2VA 4MLFB 3SJOA 1EZXC 1L1NA 2BY9X 1F2SE 3D65E 2BQ6B 3A86A 1P2QA 3SU6A 2VB0A 3L6PA 3Q77A 4FU8A 1F92A 5AVDA 2A5KA 2BVXH 5EJ1A 4ZCNA 2ZTZA 1GDUA 2XYAA 1ZGIA 5FX6A 3TJNA 1DY9A 5L6NH 1YBWA 5GDSH 1V2WT 3RXEA 2FLBH 2FOEA 2TPIZ 3DT0H 3O8CA 1TFXA 3MO9A 1TGTA 2ZHEH 3VB5A 4B73A 2AYWA 2QF5A 2ZGHA 4F55A 3TVJB 5EGMA 1O5GH 1ZTJA 1QCPA 5EJZA 1BHXF 2F9OA 4WY3A 1IQFA 1EP5A 4XBCA 4I8HA 3F9EA 5DK1A 2O8TA 4KTSA 1HXEH 1O38A 4FUGA 3AASA 1MUEB 3FP7E 3ZVCA 2OINA 5K7RA 1C1PA 1O39A 4Q7ZA 2K7XA 1J16A 1UHBB 2UWOA 4NSYA 3FKSD 4MNVA 2XBVA 2ODPA 5C0TA 4AX9H 1D3TB 5HYOA 1Z6JH 4I8JA 2GDEH 1IHSH 3SGAE 4HI3A 5EG4A 1X7AC 4I8KA 5TCAA 3EBNA 2Y7ZA 5A0AE 1ZSLA 1V2KT 4WH8A 4CRBA 2WZQA 2UUFB 3P70B 3KNXA 1T8NA 1DICA 2ZDNA 1AUJA 1EAUA 3OEHD 5KECA 1K1OA 3BF6H 4X0WU 1GMCG 1OWHA 5E2OA 1O2NA 3LH3A 4OS2A 1BMNH 3PMBB 2KCAA 2ZFQH 1MTSA 3T27A 3ZVFA 2ZDKA 2K8IA 2EC9H 1HIAA 3BTEE 3KYFA 2YNAA 1ZR0A 2Y80A 3GYMA 4WXVA 1EATA 1S82A 1YPEH 2GZ8A 4AFUA 2VGCC 1SGPE 5EPNA 1HAVA 1OOKB 5CHBA 2FO9A 1CA8B 5T1VA 2AEIH 1ESBA 1GVZA 1ORFA 1S0QA 1HDTH 1EB1H 4CBOA 1KXBA 4TPIZ 4RKJB 1AWFH 4ACBA 1A3EH 4K69A 4AB8A 1TNKA 1O5CB 2V6NA 2ZG0H 4UFFH 3O8DA 1N6XA 2F9PA 2VVUA 3LGUA 4D8NA 1JMOH 4BTIB 1T32A 1OP2A 1GMHF 1FY5A 3R3GB 1S83A 4NWKA 1IQMA 1FQ3A 1K22H 4ACAA 5A0BA 1XKBC 3M35A 1CE5A 1LHGH 2A7JA 2G52A 3QZQA 1GI8B 4ASHA 4R8TB 1S6FA 5CHAB 3SUFA 5CDFE 2V35A 5L2ZH 1NRRH 1SOZA 1ZJDA 2F91A 4DY7B 2EQNA 3BSQA 4BAMB 4FUBA 1MCVA 5DGJA 1V2ST 2KR7A 5EQQA 1TLDA 2UUKB 4ZUHA 3M5LA 1Y8TA 1L2EA 2P8OB 1DWDH 4AC9A 1C1TA 4Y8ZA 3T25A 2Q6DA 2PLXA 3OY5U 1YKTA 3BEUA 4YXWD 3A89A 1WTGH 1UTOA 1JRTA 2ESTE 4D7FA 1SC8U 4BAQB 4KKDA 2VIPA 2H6MA 3QTVH 4AGJA 1V2TT 2Y5FA 3SYJA 1T7CA 3GY8A 1SPJA 1N8OB 1C5VA 3LJJA 3MMGA 3UTUH 1VCWA 1V2NT 2WPIS 3UIRA 1TMBH 1OS8A 1EKBB 1DANH 1T4UH 5JBBS 2K0QA 4O3UA 1C5MD 1Y5AT 4BTTB 1QNJA 2ASUB 1C5TA 4XD7D 1QRXA 1NT1A 2VIWA 4YTAA 1LVMA 2P95A 1NBMD 1B5GH 3SO3A 1UO6A 2EA3A 2ZFRH 3F2HA 4CHAC 2BY6X 4B76A 2A4OA 1MKXH 1MD8A 4A6LA 4AYYB 2WPKS 2GT7A 2KCOA 3RXOA 2PP6A 8GCHF 2G81E 3SQEE 5AHGH 4Y11E 2EI7A 3PV4A 4ISNA 1B0FA 1HBTH 3KEEA 3NZIA 5EQRA 3B8JA 2BLWA 4A92A 4FU9A 2EY4C 2OC7A 2CK3D 5LH8A 3GCTG 1C1MA 3HGPA 1D3DB 5ESBA 2FOBA 2XNIA 3F2GA 5L30H 4Y8YA 5AF9H 1SI5H 5LPEA 1PQ5A 2ZU4A 4GCHF 1VITG 1NC6A 3AAVA 3Q00A 1BCUH 2P3UB 2WINI 2ZU1A 4LOYH 4K1EA 4CR5A 1KLTA 2HNTE 5DP7A 1DPOA 2PKSB 1KDQB 4NIWA 2UWLA 2VH0A 3MI4A 6CHAC 3TU7H 1YPMH 3SGQE 1AB9B 4ABIA 2F9NA 1C1RA 1Y3YA 4X1RU 1AD8H 2GV7A 1TQ0B 1MQ5A 2GV6A 2QF3A 1BTYA 2C8YB 4O03A 2WPJS 2AERH 2FOHA 5HGGA 1MU6B 7GCHF 4TSFD 1QR3E 3K6ZA 3UY9A 1AGJA 4I8GA 2ZFFH 2XCFA 1QL8A 2NU4E 4NIVA 1GJ6A 1EJAA 1NPMA 4IS5A 2ANYA 3ZVAA 2F9BH 3RDZA 4Z1MD 2H1UA 1IQEA 9LPRA 1G30B 2D8WA 4ESTE 4GAWA 1SGDE 4NFEA 2HGTH 2J34A 1Y59T 2R9PA 1BMAA 1QURH 3QWCH 4CRDA 3TPIZ 2ZO3H 5IYTA 1IOEA 3QTOH 3RXSA 1L1JA 5JBCS 3RMLH 2FI4E 3SN8A 1QQ4A 2NU0E 4ASUD 1LMWB 1HAZB 3STIA 4AFSA 1KSNA 1TGCA 2H9EH 1TPOA 1HGTH 5F03A 3KGPA 3VGCB 1CT0E 3ZZ5A 1UHBA 1T4VH 4K60A 3NRLA 2FOFA 1FY4A 3LGWA 4BNRA 3TH4H 1BRAA 2FOGA 4NGAH 1ZHRA 3MO6A 3A88A 3NWUA 3PB1E 3QZRA 4OGXA 1CGHA 3IG6B 2FODA 3Q3YA 3QLPH 4J1YA 1DOJA 1TGNA 3CP7A 3NUMA 1GHWH 5IDKA 2A7HA 1TPAE 5AFZH 4XFQA 1LHCH 1S0RA 4Z0KA 4B1TA 3GCHB 2XNDD 2J97A 3ODDA 4WMEA 4WF8A 1GCTC 2WV4A 2XWAA 2PSYA 1MBQA 1IQIA 1MBMA 1TA2A 4WVPE 1PYTD 1CQQA 4YOJA 1FY8E 2ZDLA 4ABEA 1O2YA 1NFUA 4B6FA 5F8TA 7ESTE 1ZMLA 1O2UA 1G3CA 3SUGA 3L33A 2SNWA 3SGBE 1C2HA 3UR9A 1GBJA 2FOMB 3E8LA 1MH0A 1JIRA 3HGNA 1O2ZA 4IMQA 1GHAG 1MKWK 1TOCB 1A0JA 1Y3XA 1HRTH 1K2I1 3QDZB 5TCCA 1GI4A 1C1QA 1WQSA 5I25A 1ANBA 1GHBF 2ZTYA 1SGYE 1JIMA 2V0BA 3W94A 3U1JB 1MTUA 2O8UA 1P04A 4UEHH
chains in the Genus database with same CATH topology
1C1OA 5CE1A 2TGDA 1NM6A 4X1QU 1ZLRA 2J94A 4TPYA 1Y5UT 3LJOA 2NU2E 2SGQE 3R0FA 1WUNH 2QV1A 6GCHF 3SV6A 2TGTA 3Q76A 4ZHMU 1C2DA 1IQKA 1C9TA 3BTHE 4NA8A 1YPJH 1K28D 1F5LA 4NWLA 5C1UA 3RLYH 1OPHB 1P9SA 1ELAA 1O3CA 1FPCH 2VINA 1O2TA 4Y7BA 5HM9A 3E3TA 4ABAA 2WUCA 3UREA 2FZZA 3VXEH 5FHTA 1F5RA 2FYQA 2BLOA 2FI3E 5GCHG 1VJAU 4E06H 1GBDA 4Q2KA 1AVWA 3LDXH 5EPYA 1A4WH 4IC6A 1BOQA 1O33A 1ANCA 3DD2H 1GPZA 2WPHS 2FPZA 1HAIH 2PTNA 4SGBE 5ESTE 1FZZA 1GJAB 2GGVB 4QT8C 1EASA 4YM9A 3PLKA 2WPLS 2AH4X 3PMHB 3GDVA 3MU4A 4I31A 1OWJA 1Z6EA 1MTWA 1KXEA 1YGCH 1ZMJA 3UWIA 4FUDA 1V2JT 1F0RA 1GGDC 3A8CA 3FAOA 1AIXH 3KQBA 1QL9A 1XXFA 1ZPBA 1K1NA 4LK4A 1EPTA 1UTJA 1CGIE 1PJPA 3A8AA 3Q3XA 2ZDVH 3OSYA 5EXMA 1A46H 1P2JA 3P8FA 1E0FD 2WYGA 1P3EA 4JMYA 1ZGVA 3P95A 1VITH 3BN9A 1CT2E 1GBLA 1BTUA 1LVBA 1SGRE 1N1LA 2ZPQA 3RXKA 1GBHA 1GHVH 4Q7YA 1A1RA 4YZUA 4CRFA 2BDGA 3B23B 5E0JA 5EW1H 4FVDA 1O2MA 2ZHWH 4KGAA 2ZQ2A 3OYPA 2GP9B 1CVWH 2C8WB 3F9HA 2PFEA 1FONA 3UNRA 3PMJA 1VJ9U 1Q3XA 2B7DH 3T29A 2PHBA 1ZYOA 2C4FH 1HAOH 3TNSA 1K1LA 1SGQE 2GCTB 2BDBA 1ELGA 1G3EA 1O0DH 1CBWC 3I29A 4DURA 1AMHA 5FX5A 3U9AH 2NU3E 1G2LA 3LONA 3PMAB 2CGAA 1KDQA 3MU0A 2BB4A 1HV7A 2QY0B 3BV9B 3G01A 3KQDA 2B5TB 3E0PB 3NXPA 1HAYB 1O3KA 1KXFA 1V2LT 1G36A 4RSPA 4YO9A 2FYRA 4IC5A 1F7ZA 1GJDB 1NRQH 5JBAS 1UMAH 2BD3A 4X6MA 4Y0ZE 4B2AA 2ZPSA 1RIWB 4MPVA 3RC5A 1C1VH 1LKAA 1BT7A 1P02A 1OWKA 1KTSB 2BVRH 2OUAA 4U2WA 1W13U 1AKSB 1UTKA 1EUFA 1P2OA 3KL6A 2GMTB 2GCHG 2W3KA 2JETC 3ZV8A 4A1VA 1XX9A 4YOIA 2CMYA 2A1DB 1Y5BT 1PQ8A 1ARBA 4K5ZA 1W14U 1A2CH 2WV5A 4DIHH 1NO9H 4AN7A 4WH6A 3UR6A 5LPFA 3UQOA 1CGJE 1EAWA 4GVUA 2Y82A 3TK9A 2R2WU 1QA0A 1E37B 1BJVA 1CHGA 3LGTA 3UNSA 4KELA 1D4PB 1XUGA 2ZEBA 2H5DA 4PROA 5DP8A 1C5LH 3T26A 1QRZA 4NCYA 2FTLE 2LIZA 3F68H 2XRCA 2FIRH 1GG6B 3V7TA 1O3FA 3MNBA 1P9UA 3E91A 3QO6A 1UVUH 2J2UA 1YPLH 1HFDA 2FOCA 3PO1B 3GOVB 1ACBE 3MH6A 4CRCA 3EDXB 4CREA 4GHTA 4NA9H 4ABBA 1G2MA 1DX5M 1DXPA 1WU1A 1GL0E 3MH4A 2DE8A 4RKOB 1PQ7A 2ZIQH 4AYVB 2HOBA 4GPGA 5DPAA 2O8LA 2NWNA 1YCPH 3EQ0H 1O5BB 1ZRKA 2P16A 1C1NA 1TX7A 1O3PB 1O3AA 4BXSA 1BQYA 1QJ7B 1GL1A 5JB8S 1W2KH 3BTDE 4Y71A 4AZ2B 1O3HA 2HNTF 1A0LA 1P05A 2A4RA 3V12A 3K9XB 3SI4H 4A7IB 4ZHAA 1FAXA 2OTVA 1G3BA 4YLQH 1UVOA 4H6SB 3SUDA 5EXNA 2P3TB 2P93A 4F4OC 2QIQA 1DWEH 4JYUH 1OX1A 3ZZ9A 3M7TA 4X6NA 3NKKA 1AHTH 1NFWA 5E2PA 1YPHE 4B74A 1C2FA 1SOTA 1XVOA 4BTUB 1IQJA 1GMDG 3RXUA 1VCPA 3BG8A 4DOQA 3AW1A 3OX7U 3TGKE 4O9VA 1NZQH 1DLEA 4K8YA 4MNXA 1F0SA 1BTHH 1BTXA 1ELBA 1NU9A 3KQEA 4GHQA 3SZNA 1SGIB 2BQ7B 3TH3H 2R0LA 1EB2A 1THPB 3SORA 4B2BA 3MYWA 3SHCH 3P17H 2JH5D 3EA9A 4M7GA 3A84A 4ABDA 1O37A 1K21H 2F83A 2VGCB 7LPRA 4XOJA 2BZ6H 2WYJA 2ZHDA 1ZPCA 3GY3A 4JK6A 1TRNA 2BLQA 3N7OA 1WBGB 3VFEA 3MHWU 2ZHFH 1OYQA 3M5MA 2STAE 2Y5HA 1FAKH 1QRWA 1PPBH 3P92A 1SBWA 4WWYA 1P10A 3KCGH 1RTLA 2Q6GA 3RXJA 4GLYA 1BRCE 1H1BA 4AOQA 2AGEX 5BRRE 4JZDH 3HKIB 1SLXB 3NK8A 1HJAB 4U32A 3I77A 4NZLA 3PWCA 1OP8A 3IWMA 1O2XA 3MFJA 1TB6H 3ESTA 3A7ZA 3RXRA 2P3FH 4F49A 5A09A 1XUFA 4MPWA 2Z9JA 1BTPA 1VGCB 3TJOA 4Y8XA 3A7WA 3EA8A 1LPZB 5C2ZA 4OS5A 2ZGBH 2BYAX 3W95A 1C2GA 1TAWA 2CN0H 3RXGA 3C27B 3A85A 2BDCA 2QC2A 1DSTA 1FMGA 1GJCB 1O2SA 3BG4C 1HAHH 2GVFA 4AB9A 1TALA 3IITA 4LXBH 2VJ1A 1ZSJA 2ZDAH 1TBZH 4BXWA 3FANA 3U98H 2BX3A 2G5NA 1PPZA 1EZUC 3NPSA 4SGAE 4FUCA 1O3GA 1XUIA 1MQ6A 1S5SA 1WV7H 1C5RA 1O3BA 1EZQA 1TNLA 4IN1A 1QBVH 4D7GA 2ZFSA 3GY4A 1BUIA 2QXGA 5T6DA 1N8OC 1TGBA 3SJ9A 2QF0A 2BTCE 1UK2A 1C1SA 1UTNA 1PPFE 4NFFA 5DKMA 1TRYA 3RU4D 1UVPA 5JBTA 4CR9A 1EPTB 5DP9A 4ZXXH 3ZZ6A 1UJ1A 1AKSA 1WAYB 1P12E 1QGFA 3JZ1B 4KTUA 1LKBA 1PPHE 3NCLA 2QYIA 3MU1A 1BBRH 3P8GA 1NROH 5HXFA 4Y0YE 1SLUB 5FBIA 6ESTA 3BIVH 3LGYA 4UFDH 3PTBA 1H9HE 1GBCA 1Z8GA 1A5HA 1A0HB 4D76A 1ZJKA 1DWBH 1GI6A 1TABE 2CF8H 1UCYH 1AE8H 1MTNC 5L2YH 2ZGXH 1KXAA 3MU5A 3SHAH 3V13A 1XM1A 1CA0B 4WXIA 3RU4T 1EJNA 4DT7B 3LPRA 5I46H 3A80A 1TNHA 1P2NA 2W5EA 3K65B 3T62A 1TE0A 1V2PT 1E35B 2FXRA 1SSXA 2OBOA 2FS8A 3RXFA 1TNJA 1FY1A 1CHOG 3ZZ8A 3STJA 2C8ZB 4HTCH 1E34B 3C1KA 4THNH 4YLUA 4INKA 3DA9B 3LGVA 2BD9A 1O2QA 3T5FH 5DO4H 5CMXH 1S84A 2PKSC 1GMCF 1TQ7B 3JZ2B 1ZTKA 1KXDA 3A87A 4MVNA 3M61U 3F9GA 3LKWA 2G5VA 2VIVA 1GWAA 1O2PA 1O2KA 1W0ZU 1JRSA 3SNBA 2PKAB 1AB9C 2ILNA 3L3TA 3LC3A 2ZFTA 1GBBA 1THRH 2UUYA 2BM2A 3HK3B 1P57B 1SG8B 1SB1H 4ABHA 2BZAA 2RA0A 3RC4A 1GI1A 4I32A 4DIIH 4X8SH 2PW8H 2ALPA 1AE5A 3PLPA 3SQHE 1A61H 2PUXB 1XMNB 4K3JA 3CS7A 1G37A 4X2XA 2ZP0H 3GCOA 3ZZAA 1ABIH 1P8VC 3DUXH 3VB3A 1EP6A 2ALVA 4Y10E 2VU8E 2YOLA 3URDA 2UUJB 4IN2A 2VVVA 1P0SH 1W0YH 1SGFG 4K8BA 2G00A 1HYLA 2D2DA 1C1UH 3Q3KA 1SHHB 2XC0A 2AIQA 3ZZ4A 1V2OT 3MWIU 3FP6E 5DP6A 3H7OA 2A4QA 4I33A 5FPSA 3VB4A 2ANKH 2BD2A 3A7VA 5A2MH 4X1SU 3RXCA 1NTPA 2VIOA 3ATIA 1GHYH 3KQCA 3VGCC 1VR1H 4ZKRU 4KP0A 1P2MA 1BRUP 2PUQH 1BRBE 1NN6A 5DJ7A 1C2IA 1C5QA 3U8OH 4XBBA 1DE7H 1H8DH 1K1MA 3SV9A 3PM3A 1XUHA 3SU4A 1Z1IA 3AVZA 1C2JA 1SLWB 4ABJA 5G4BA 2XXLA 1NRNH 1EQ9A 1DUEA 1C2EA 3RXVA 4X8TH 9ESTA 3SV8A 1ZOMA 3CS0A 2F9UA 3TGIE 4O3TA 2FP7B 3FFGA 3GCHC 3E90B 1O34A 1LCYA 4INHA 3MNCA 2ZQ1A 1KLJH 4Y76A 1FPHH 2EI8A 2AMDA 1GBTA 3OTJE 3ZYDA 5EOKA 1EXFA 2ZWLH 2HNTC 2SFAA 2XBYA 1BBRE 3ELAH 5FBEA 5T6GA 1T31A 2AMPA 1O35A 1TGSZ 1W11U 5JDUB 1IQHA 4YT7H 1ZHMA 3TK5A 1BHXB 1MAXA 1AFQC 3BTWE 1C5ZB 1YPKH 3HATH 1UCYE 5E0HA 1ARCA 1P2IA 4HGCA 4FUFA 1WSSH 3RM2H 2TIOA 1D3PB 1IHTH 3ZYEA 1D6WA 1DUAA 1DDJA 1JOUB 1RTKA 4MQAA 2CHAC 1OYTH 4ISIH 4OS7A 5C5NA 2OP9A 1FXYA 2JH0D 4A1TA 1RJXB 1K1PA 1C2MA 1D9IA 1H4WA 1C5OH 3SJIA 1N6YA 4TY6A 5GPIB 1HXFH 6LPRA 4HZHA 2GZ9A 4X1PU 5C67A 1NFYA 3GCTF 5C20A 1EX3A 1O2RA 1ZMNA 3RXAA 3ATLA 2A0QB 3RXBA 1P06A 3RMOH 2Q6FA 3F9FA 3P8NA 2A7CA 3ZZ7A 3ITIA 3SJKA 1WQVH 1VITF 4GUXA 1SL3A 1DSUA 2TBSA 1FLEE 1HPGA 1HB0B 1Z71A 3O8BA 1L4ZA 2STBE 2ZA5A 2SGDE 1RRKA 3P8OA 1ESTA 1INCA 1QFKH 4NIXA 3BTKE 4CRGA 4RN6A 1E36B 2D26C 1L4DA 2OXSA 3MU8A 4Q80A 3TH2H 5JYIA 3BTGE 3EA7A 3TK6A 1SQOA 1G9IE 2I6SA 4OS4A 2A31A 3AW0A 1OWDA 1QB1A 2TGAA 2BHGA 4HFPB 5FCRA 1DXWA 1QB9A 1NS3A 3RLWH 8LPRA 4DG4A 4CH8B 5FAHA 5EW2H 1EJMA 4MG3A 3PROA 5E8EH 1V6DA 2FDAA 3VPKA 1M9UA 1MZAA 2BDIA 1GVLA 1SGFA 1P11E 3H7TA 2AIPA 2FX6A 1ELEE 2QCYA 3BTTE 5EQSA 5DP3A 3D62A 2Z3EA 1NY22 2G55A 1BTZA 5DP5A 3M7QA 2BXTH 2ZCLP 3GY2A 4X2YA 3RC6A 1XUKA 5LPRA 2A5IA 3RXTA 3U8TH 2OC1A 3T28A 1LDTT 5EODA 2GX4A 3VXFH 2BY5X 3TJVA 2ANMH 2B0FA 1CBWB 2BD5A 3TJUA 1O2OA 4TY7A 4JCNA 3M5NA 2OBQA 3BIUH 4NA7A 5J4SA 1GBAA 3LOXA 4ZKOU 4U01A 1DLKB 2GCTC 4VGCC 4JZEH 4JZIA 1CU1A 3D23A 1BMMH 4TWWA 1FJSA 2CJIA 4KTCA 1JXPA 2A2XH 4X2VA 2Z3DA 3GCNA 5C1YA 4XDEA 1O2WA 3MH7A 2PKAA 1RS0A 3UPEA 1A5IA 1AFEH 1TOMH 1V2RT 5FPTA 1OWIA 1HJ8A 1DS2E 2FLRH 1E38B 3K2UA 2IN2A 4MPXA 1RGQA 2JETB 1SMFE 2ZHQH 3U1IB 2PGQB 4GSOA 1GMHG 1PYTC 3SNCA 1GHAF 3CENA 2VWNA 2SGPE 5H4IB 1QJ1B 1SQAA 2GMTC 1O5EH 4NIYA 3RMMH 2RA3A 3ATWA 5LGOA 3TLOA 2XTTB 3M3TA 3VB6A 3BTQE 4CH2B 1VZQH 4AFZA 2A32A 3PYHA 2BDHA 4OS1A 1IQLA 1OKXA 4ABFA 1DVAH 3QGNB 3SBKA 4B71A 1MKWH 2BLVA 1A7SA 1TONA 3RXPA 3UFAA 2ZGCA 5JB9S 1NRPH 2QXIA 2RDLA 1GI2A 2V3OH 4X6OA 1BB0B 1SGEE 1WOFA 3HPTB 1YM0A 4MDSA 2Z9KA 4LZ4B 2BVSH 2J4IA 2OC8A 1J8AA 1O2LA 1RXPA 2GT8A 2ZGJA 4BOHA 1TIOA 1QL7A 3SU0A 2PSXA 3SV2H 5GCHF 1MKXK 1AU8A 1J17T 3T2NA 3PO1C 1RFNA 1ZSKA 3SU5A 1IQGA 2WPMS 3EAJA 1A3BH 4AGKA 3B9FH 2SGAA 1Z8IB 3LT3A 3SU1A 2BOHB 4NSVA 3UUZA 1LVOA 2IPHA 1ANEA 3ZZ3A 3TITA 2KAIA 2QGRA 5JPMH 2OQUA 4FVBA 3GICB 1PFXC 3VB7A 3P6ZB 1YCPM 4X2WA 2HRVA 1GJ4H 1AUTC 8GCHG 2DE9A 2FESH 2F9VA 3UNQA 3RMNH 1C4Y2 2J38A 1O3EA 2ANWA 4IMZA 1MU8B 3QK1A 1Z8JB 1T8MA 5E0GA 5PTPA 3EE0B 2IOTA 3OY6U 4K1SA 2C8XB 2ZFPH 4ISLA 1UTPA 2GDDA 1C2KA 3RXLA 2HLCA 2GKVE 1HAXB 4GCHG 2H9TH 2HALA 1KLIH 1O2GH 1Y3VA 1FN6A 3DHKH 1HNEE 4NG9H 1V2VT 2ZECA 3RXHA 1ID5H 2A2QH 1TX6A 1C5PA 3F1SB 4OS6A 2OQ5A 2W7SA 1YC0A 4JYVH 2DUCA 2FI5E 1ABJH 1C5NH 3QN7A 1DITH 3PWBA 5HMAA 1UK3A 2LNCA 2W26A 1C5WB 1SGTA 4JK5A 2VWMA 3I78A