2PWYA

Crystal structure of a m1a58 trna methyltransferase
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
251
structure length
251
Chain Sequence
GPLLLKDRKGRAYLVFPKEGGVFHHHKGSVPHEALLEAGPGGVVRTHLGEELSVHRPTLEEYLLHMKRSATPTYPKDASAMVTLLDLAPGMRVLEAGTGSGGLTLFLARAVGEKGLVESYEARPHHLAQAERNVRAFWQVENVRFHLGKLEEAELEEAAYDGVALDLMEPWKVLEKAALALKPDRFLVAYLPNITQVLELVRAAEAHPFRLERVLEVGWREWEVRLPVAHPRFQQVGHTAFLVALRRWKGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Thermus thermophilus tRNA m(1)A(58) Methyltransferase and Biophysical Characterization of Its Interaction with tRNA.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords tRNA (adenine-N(1)-)-methyltransferase
total genus 68
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature ec 2.1.1.220: tRNA (adenine(58)-N(1))-methyltransferase.
pdb deposition date 2007-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2pwyA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2pwyA02
1KYZA 2P7HA 3LGAA 2AVNA 1VP9A 4PCLA 2IGTA 2IIPA 2IFTA 5CCBA 2AN4A 2E5WA 3ME5A 1SQFA 1UIRA 3EGVA 3G8BA 3GDHA 4KIGA 4PWYA 4ER0A 3DOUA 2AS0A 4FP9A 4AZTA 1P39A 3PX2A 2ZIEA 2N47A 3KQVA 3ELDA 3M6XA 4Y2HA 5DTQA 3FPJA 1XCLA 3UA4A 2QE6A 1RI3A 5DSTA 3LDGA 3M6WA 3A7EA 2G72A 5K09A 2EFJA 3B3FA 3ERCA 1YZHA 2OZVA 5FWDA 3EVDA 4K6MA 1O9GA 5FTWA 4P7GA 4AZVA 2XVAA 2KW5A 3KQWA 5DWQA 4CKCA 1ORIA 3KR9A 5E1OA 3FUUA 3SMQA 5CIYA 5ICCA 3EMDA 2PV0A 3PFGA 2VP3A 3CJQA 2PLWA 3P9KA 5HFJA 5C1IA 3KQQA 3UJCA 4OBXA 5F2OA 4IV8A 5EVJA 4RTJA 1IM8A 5DX0A 2FK8A 2HWKA 3REOA 4DM3A 3T7TA 2F8LA 1EAMA 4YUYA 2FRXA 4F84A 5K0FA 2P3OA 4FT4A 1ZGJA 4HGZA 4P7KA 4QQKA 4R6XA 3C0KA 4RYLA 1XDSA 1JG1A 3QOWA 5FCDA 3TQSA 3UJDA 3TKAA 2ESRA 4RTNA 1ZKDA 4RVHA 4E30A 1D2HA 3BGVA 3B5IA 4X63A 3S68A 3GRYA 4QVGA 3GRUA 3UJ8A 4BP3A 2JG3A 2NYUA 1NW5A 5EEGA 5DPMA 1ZGAA 3JWJA 2AOXA 2O05A 1X19A 2NP6A 4WXHA 3PB3A 3TKYA 3SR4A 4BP1A 4U7PB 3EPPA 2ZZKA 3G8AA 3GO4A 4HH4A 2XYRA 3O7WA 4OQEA 4DCGA 2UYHA 2NXCA 1R8YA 3HVKA 2LD4A 4OA8A 5EMLA 2YVLA 5FWAA 5KQSA 3GRRA 4QDKA 3JWIA 1D2CA 3OCJA 5FA5A 2CMGA 3GRZA 3HA7A 2GPYA 3FYCA 4UOEA 5E9JA 1ZG3A 3JWGA 3LCCA 5LQNA 3HVIA 1G60A 2O57A 3P9IA 1X1BA 5GINE 3M33A 3FRIA 3GGDA 5GOZA 5EKXA 2PBFA 1RJFA 4P7JA 3HEMA 2Z6QA 2H00A 8MHTA 1M6EX 3K6RA 1KR5A 3EVAA 2FYTA 4FR0A 1SUIA 5DX1A 3DTNA 2FPOA 1N7IA 3CGGA 2JJQA 4C08A 3OU7A 4G56A 5BP7A 2G8NA 2ZBRA 4RSRA 3UJBA 3OPNA 3UJ9A 3AXSA 2V74B 4PONA 4JXJA 4E2WA 1RJDA 4R6WA 1O9HA 5CCXA 3R0QA 3HVJA 2C7QA 1RI4A 5FUBA 3BKXA 1XJ5A 2IH4A 3DMFA 4EK9A 4GOOD 4GOLD 2A14A 4DMGA 5K03A 1Q0TA 1D2GA 1KHHA 4P58A 2CMHA 2AZTA 4MWZA 1KXZA 3B89A 5EEHA 2Y1WA 4PNEA 4DF3A 4MQ4A 4OQDA 4EQZA 5HIKA 2B78A 5HOQA 1AV6A 1L3CA 5F2KA 3KQOA 3PTAA 5DSXA 1X1AA 5EQJB 1EJ6A 1M6YA 1XCJA 5EPEA 2FHPA 3G7UA 4BLUA 5ICEA 4PYJA 3IYLW 3KPUA 5K01A 5HZMA 3UBTA 2YXEA 1NW3A 3G2MA 3IEIA 5CVVA 4X60A 3DLIA 5FHRA 2WA2A 1FBNA 2YTZA 2FCAA 4R05A 5JUWA 3SM3A 2Z6UA 4C06A 3MCZA 3BGIA 4AZWA 3HVHA 3LPMA 3MTEA 5DM0A 2K4MA 1R6AA 2CWWA 3CBGA 2NXJA 2R3SA 5K8VA 3A4TA 2HR1A 1HMYA 2B2CA 1RJGA 2NXNA 3DXXA 2VDWA 3EEYA 3P2KA 4PIMA 4XUCA 3TMAA 4HG2A 4P7FA 5FHQA 3TPZA 5KQRA 4GC9A 3P8ZA 3SSOA 1NW6A 2P35A 4IV0A 3KQYA 4CKEA 4E2ZA 5LQKA 5JR3A 2OBFA 2AN3A 3GCZA 5CM2Z 2VDUE 3BZBA 1DL5A 4PINA 5E1DA 1TW3A 2ZBPA 4RTRA 3RIEA 3FPGA 1WXXA 1Z3CA 4OX9Y 5GIOE 3TR6A 1G8AA 1Q0SA 3FPEA 3OZTA 5T6BA 1SVUA 4B17A 1KP9A 3GIWA 3IHTA 3THSA 5LQCA 5DTMA 2ONZA 3HM2A 2C7RA 1R00A 2YQZA 2ZWAA 4YUVA 5LQAA 2CL5A 5B1SA 3EVGA 4RTQA 4KDRA 2NNWB 4CTKA 1PJZA 3KU1A 2IBSA 4FSXA 3G2PA 3FUVA 3BUSA 5E8JA 5H02A 3LL7A 4C07A 3HP7A 1VIDA 4QVKA 1F3LA 4Y30A 1SQGA 1MHTA 3T7SA 2BM9A 3FRHA 3H2BA 2Q41A 4HTFA 4GF5A 1MJFA 1JR4A 1ORHA 2EG5A 3I64A 1JTEA 2YX1A 3P2EA 4GOMD 4PGGA 3VC2A 1QZZA 3LHDA 1O54A 3KPJA 4FZVA 5DM2A 1XDZA 2ZSUA 3MQ2A 4C03A 3U81A 3VC1A 3FZGA 5EMKA 1WXWA 1JQ3A 2ZVJA 5EZQA 4YUZA 5EOVA 1JSZA 3THRA 2IDKA 3KPWA 4HC4A 2O0LA 5T64A 4A6DA 4X1OA 3P9NA 3QOXA 3G2QA 3B3JA 4L7VA 3MGGA 2OPBA 3TLJA 5K0CA 1Y8CA 5EKUA 3TM4A 3I58A 5E1BA 2ZIGA 1DUSA 3KPVA 4RTKA 1JG2A 1R18A 1BOOA 2C7OA 2BR4A 2DPMA 5CD1A 4OA5A 5E2BA 3EVEA 3AY0A 3SGLA 2YR0A 4MTLA 2BZGA 2PGXA 1JQDA 4RV9A 2BH2A 1XDUA 3ELWA 2EJTA 3F4KA 3DR5A 3GXOA 3C3PA 3MAGA 4E70A 4RTOA 2IP2A 3GNLA 3HNRA 3NTVA 3EVFA 5HIIA 2GB4A 2AOTA 5FQNA 5CUQA 2AOTB 3EGEA 1NT2A 2AVDA 2DULA 2ZFUA 5EIFA 4PYNA 2OKCA 2QRVB 3ELUA 3OFJA 1FPQA 1M0EA 5M5BA 5DLYA 1RI5A 2GS9A 2PJDA 4RVDA 5DXJA 5DM1A 4CXMA 3MHTA 4O29A 1RI2A 5DM4A 3G2OA 3E05A 3HCBA 3LDUA 4V0QA 5KS2A 4HGYA 5MHTA 3A27A 4GBED 4RWZA 4X41A 2IH5A 1FP1D 2XYQA 2QYOA 5DT2A 1EG2A 4HSGA 2ZCJA 5HEKA 2AOUB 4GEKA 1XVAA 3UJ7A 3HTXA 1G55A 1L9KA 4YV2A 3M4XA 5LR6A 1NW7A 1L3BA 3FPHA 3QV2A 3HCCA 5G02A 3LBYA 4PYLA 1UFKA 2G70A 4QQNA 3MERA 4GC5A 1KIAA 4M36A 2AN5A 2Z6AA 1NV9A 1QAMA 1XTPA 3BWMA 4POOA 4GQBA 3EVBA 3BT7A 3NVKI 3A26A 1BC5A 1BHJA 1IY9A 1QYRA 1NW8A 2WA1A 2I7CA 3HA5A 5E9QA 4KW7A 1AQJA 1AQIA 3KR0A 2PT6A 4E32A 2B25A 5T67A 4F85A 3DLCA 2I9KA 5E1MA 3ER8A 2UYCA 1EIZA 4E2XA 3DP7A 5C0OE 2PKWA 1NKVA 2JH9A 2UZ4A 4FSDA 1DCTA 3LCUA 4XUEA 5KYGA 3EEOA 2O06A 1V39A 3G5TA 2HNKA 3C6KA 3DXYA 3CCFA 3IV6A 4KVZA 5HILA 2GA9A 3V97A 2GH1A 2OXTA 4QTUB 1YFJA 4GUAA 4AZSA 5CVUA 4PYKA 2ZWVA 5EGSA 3T0IA 2PVCA 1I1NA 3G89A 3O4FA 3BWBA 3M70A 3P97A 4M7RA 3I9FA 5ICFA 3MTIA 4RTSA 4XUDA 3KQSA 3B7PA 3V8VA 2OB1A 1YB2A 1QAQA 3B3GA 3OE4A 1IXKA 2XYVA 2VS1A 3DUWA 4HTFB 4LWOA 1YZ3A 4PYIA 5FQOA 3CJTA 3CVOA 2O07A 5GM1A 2NXEA 3L8DA 1VBFA 3UFBA 3ER9A 4C4AA 3G88A 4OBWA 3BKWA 1OR8A 3LDFA 2JHCA 4KWCA 5LSAA 1FJXA 5DXAA 3SXJA 1B42A 2QY6A 3KQMA 1SKMA 1KPGA 4RX1A 5K0NA 5IH3A 3A7DA 3HCFA 2QM3A 2I6GA 5ERGB 3BWCA 2VZ9A 1G6Q1 5K0BA 2P3LA 1SUSA 4WVLA 5D1HA 1ZHFA 2UYQA 3M6UA 1P1BA 2P8JA 3R3HA 4DKJA 3LBFA 2JH8A 2B3TA 2BR3A 2HTEA 2R6ZA 3PVCA 5GWXA 4RTLA 5F2NA 3M6VA 4EMSA 2FK7A 4M38A 4ER3A 5EIWA 3UA3A 3ORHA 3MCTA 5EMJA 1JQEA 3NWBA 4MIKA 2AOVA 2PT9A 5U4XA 3UZUA 3FTFA 1EJ0A 2AOWA 5EC8A 3ANXA 3WSTA 1XXLA 4A6EA 4XCXA 3HCAA 1NE2A 3GRVA 5DX8A 1QANA 2ZZMA 3KQTA 5LQJA 5K0GA 3DMHA 3SSNA 2PWYA 3G5LA 3LSTA 2ZW9A 4V0RA 4GOND 1SG9A 1T43A 3GWZA 2ONYA 1BKYA 1U2ZA 2EX4A 5EG5A 1H1DA 5EMMA 5EZSA 4F86A 3FUTA 1TW2A 3NDJA 5E2AA 5BW5A 4QPNA 5LQRA 7MHTA 2Y1XA 3KPYA 2H11A 1P91A 3FUXA 3OZSA 4FT2A 4Z2YA 3KQPA 3EGIA 1WZNA 1JSXA 5BXYA 4PYMA 4KDCA 5K05A 1N2XA 5E8RA 1R74A 2OYRA 3SSMA 2ZBQA 4ZTBA 4BLWA 2IPXA 2PX4A 4U7TB 2YXLA 1VE3A 3DMGA 2ORED 1VP3A 5EHGA 1KPIA 1ZQ9A 1NBHA 2ZTHA 3P9CA 5CVDA 1G38A 10MHA 1YUBA 4DZRA 4MHTA 3C6MA 3UJ6A 3FPFA 5D1NA 4FS8A 2AOUA 4E2YA 5E9WA 3CC8A 3TM5A 1X1CA 4LG1A 4BY9E 5GP1A 1G8SA 4RTMA 3LKDA 4YV1A 3E23A 2NP7A 1P1CA 3BGDA 3PS9A 1KPHA 3MB5A 3Q87B 3LECA 4ER7A 1YF3A 2ZLBA 3HCEA 2H1RA 2HMYB 1YFLA 3KKZA 2ZIFA 4CKBA 3I5UA 4C04A 4BLVA 3UJAA 3OU2A 4E33A 3LCVB 3HCDA 1JTFA 4RTPA 3NW9A 5P8WA 4ER6A 4YMHA 3LX6A 5DTRA 3AWIA 4NECA 4RVGA 2PX5A 4YUXA 1EQAA 4PYQA 1JG4A 3GJYA 1WS6A 3HA3A 2WK1A 2CKDA 2PSSA 3BXOA 4FGZA 4AX8A 4CWAA 4YV0A 2HV9A 1F38A 3PT9A 2PY6A 3SX0A 2P3QA 4EVIA 3NDIA 3DULA 2YUIA 5K0JA 3R6TA 2YXDA 3JWHA 4DA4A 2OY0A 4ATNA 3I53A 2V7EA 2PXAA 4ER5A 1NBIA 3OFKA 3CJRA 4KRGA 5C9ZA 1KYWA 2IDJA 2G71A 2UYOA 1WG8A 5CVEA 5BW4A 3D2LA 3RODA 2PWPA 2PXCA 2ERCA 3FYDA 4ISCA 3NMUF 5GM2A 1X1DA 3C3YA 1QAOA 3K0BA 3NWEA 1N7JA 1RI1A 3X0DA 3P71T 2JHPA 3R24A 2IH2A 3P2IA 4C05A 4R8SA 3NVMB 2P41A 3EVZA 4EKGA 3FUWA 3CKKA 3E8SA 1JG3A 3ID6C 3BWYA 4QDJA 3FTDA 3KR2A 2GAFA 4IKPA 5FADA 3VYWA 2AR0A 1HNNA 2GLUA 1VL5A 3FTCA 2P1DA 4H0NA 4CTJA 1VPTA 3AXTA 4PIPA 3VSEA 4HRAA 4LECA 3OE5A 2IBTA 3TOSA 5DRTA 5KVAA 5HIMA 4YUWA 9MHTA 1I4WA 4DQ0A 3DH0A 3DXZA 4PYOA 2PX8A 3PX3A 1AF7A 2JHAA 3NJRA 2EJUA 3PLAE 4PGHA 5LQUA 1L3IA 5DRYA 4EKIA 4YMGA 5ICGA 1NV8A 1R8XA 1WY7A 2OO3A 4M37A 3TFWA 4IWNA 4QPPA 3OU6A 3LKZA 1PRYA 2OB2A 3T7RA 4AUKA 5HIJA 2B9EA 2BR5A 5IKMA 5K0EA 3FTEA 3RW9A 3PFHA 5K0LA 4E31A 3R9XB 4QTTB 3OZRA 2C7PA 5FULA 4R8RA 3ELYA 2ZULA 3KR1A 2ADMA 3A25A 4LWPA 3UWPA 2PXXA 5FA8A 2G1PA 2ZZNA 3GU3A 1I9GA 2BM8A 3AJDA 5GIPE 1VQ1A 3Q7EA 1L1EA 5EHIA 3E7PA 2I62A 1INLA 5CVJA 1TPYA 2QRVA 2PX2A 1FP2A 3EVCA 2XBMA 2XVMA 1VLMA 4DCMA 4PCAA 4X61A 1UWVA 2P7IA 3O31A 2VDVE 3TRKA 4KIFA 3KHKA 1RJEA 3EMBA 4RVFA 3SVZA 2P40A
chains in the Genus database with same CATH superfamily
1T2AA 3VJRA 5DNVA 2AVNA 1NUUA 3KOUA 2WWXA 2Y76A 4A36A 3A6HA 3AHEA 4AWAA 3ILHA 3ZY6A 2NTYC 2FOLA 7REQA 3JAWB 5E6RB 2N47A 4QOHA 5EJEA 4HO1X 2D3WA 1O96B 4DQLA 3BG5A 3BB4A 5I3ZA 4NYJQ 3TRDA 2V97A 2GPJA 3JXEA 3B3FA 5CNKA 4LMBA 4FYXA 1JPUA 2OQ2A 3GGJA 3SDSA 1PTJA 1AMUA 1ZHOA 4S0XA 1V1MB 1YJXA 2ZP1A 4P93A 3TZBA 4B4WA 5KVSA 4MDFA 1NF9A 1NXTA 3VPHA 1OIXA 1TC2A 2R6AA 5EYPB 4AKSA 2J0UB 4F71A 2UZAA 1YZYA 3ZNQA 1WMAA 3V8BA 5HKBA 2GEUA 4LY6A 5IBCA 5F2OA 1ZL0A 2R8OA 3LO5A 4N5IX 4JBIA 4DM3A 3NIWA 3SLRA 4YRIA 1R0SA 2PGLA 4GM0A 3SD7A 4DRXA 3NHJA 3H1GA 4HWRA 1W6UA 3AJEA 5THXA 4ZQEA 4MK4A 4YS6A 1L7EA 3KVVA 4N65A 2CXSA 2QIOA 1G8HA 2POQX 3E2PA 2WU4A 3IJ5A 4JB3A 3TE7A 4B6QA 1B6RA 2Y1LA 3WLSA 4JEIA 4LZJA 5AI5A 4REOA 4IPTA 1DDIA 3WZMA 5MN4A 3PWTA 1EXWA 5A0VA 2FX3A 3HKEA 4PPFA 2PD4A 4M83A 1XRLA 2PRZA 4EJ0A 2AOXA 3ZN2A 1QKKA 3JVUA 1ZGHA 2J07A 4KK3A 4OGKA 3WGMA 2J30A 3MJ4A 1DUVG 3LQKA 1XMVA 5CBKA 3TNYA 1A8SA 5EWLA 2NUBA 2W83A 2RDMA 4JKIA 3KAJA 1RS0A 4EKEA 1BWRA 3IB6A 1YOVB 2DHRA 3QU7A 1USVA 3KJZA 3C4VA 1EM8A 2R1VA 4MW5A 1IAVA 4TTTS 2PX0A 4DPLA 4DR6B 5AW8A 3CS3A 5HWSA 3QKSA 1T8YA 1TTHA 2FQXA 5LMNB 2IXFA 3FR8A 3ZHSA 2YFYA 3DSRA 4AKEA 2DBQA 1IPFA 4OJYA 5L3VA 1UMKA 3V7UA 3E81A 4GDMA 4P1ZA 1BW9B 3SZMA 3A6KA 2O3TA 2EDAA 2DG2A 4RZ3A 3CZAA 4UDOA 3BDVA 4AF8A 2GPAA 3G02A 2DLNA 2Y2VA 4H16A 3TNJA 4A0HA 3ZWAA 4E7PA 4X66B 1C1XB 1Z5WA 3I04A 3UB4A 2FUEA 2C97A 2ZYAA 2V5AA 1JQJC 1VDZA 3OF2A 4TQ9A 3D43A 3V4OA 1FUEA 2ILTA 1ISFA 4PSDA 5BYJA 1QV7A 5KWIA 3LXMA 1EIWA 2VF7A 5EMNA 4C7XA 3A36A 3COSA 4KG7A 5TGZA 5JV5A 1DC5A 2LV8A 4JLNA 4O3FA 3SE0A 2B2NA 2NSLA 1FYVA 3R0QA 4JB8A 1COWA 2IE8A 3GAZA 2WC1A 3GQBA 1OT5A 4MYDA 4WLOA 2IHVA 4YCJA 1P62B 4FW9A 1ZMRA 4IQFA 6ABPA 3HK2A 1KVTA 2EYQA 3P9SA 4C0LA 4W9RA 3G82C 4EKYA 2OBYA 3Q9UA 1Z17A 4EMUA 4AM8A 1IXRC 1XLTC 4ZOCA 1HBJA 1ZOOA 3KE9A 5IKXA 1CY6A 1RFLA 4IH4A 1YASA 2QA5A 4YTEA 5H4GA 2PGAA 3ND8A 1JHRA 1WDLA 2VYND 3FVTA 3W7BA 3ZLTA 3OEYA 4I50F 4QYTA 1F2UA 4LWZA 1S2DA 1W1UA 1Z2CA 4KODA 2CJFA 3KYCA 5IU6A 1TCVA 2Z6UA 1KDTA 4BKPA 1FFWA 3HVHA 4PPGA 3JVEA 3C74A 3N2KB 4LMAA 3WLHA 3CBGA 3ISVA 5JVDF 2IS1A 1LU9A 3JQFA 4MYSA 2OSBA 4CL2A 3KOOA 3HY6A 1P17A 5KQRA 1HTTA 1I7DA 1GNRA 1QYDA 1Y63A 2XI4A 2I5PO 5AESA 1GA6A 3GBSA 1CZLA 3DKIA 2DHCA 4IJ5A 1QLHA 2JAQA 2QJTA 3GA5A 5EZ6B 4C0AC 3THYA 2CJWB 3PG5A 2OCXA 1KYIA 3QY0A 4DIOA 3TG8A 1E8NA 1TQ4A 2EL7A 1GPKA 3DMDA 4D9JA 3O73A 4JLSA 2WWFA 4U6QA 2G6BA 5A9SB 1PR1A 4Q12A 4ZO7A 4PX3A 2XKJE 3PDIB 2I7XA 5CNIA 1IWBB 3C8MA 2PGOA 2Q46A 2H63A 4WUTA 3TLEA 3TVYA 4DS3A 4HB4A 3ZV3A 2R60A 1KEWA 3CR8A 4QSHA 2GF2A 4XZ3A 3TSYA 1NN0A 3CX7A 3DT6A 2PJHB 1L8LA 1WCXA 2SICE 3LL7A 3HP7A 4MI1A 4OEHA 4YEDA 2X2FA 1LDNA 1F3LA 5DBIA 4ALLA 3QXXA 5AVZA 4M1ZA 1B8PA 4UTRA 1GSIA 2B83A 4UHBA 5TNXA 5ALXA 2HA6A 4ROSA 5IK2A 1J42A 1QB8A 2ZIZA 4D41A 1CRQA 3K0SA 4B2PA 1XEFA 3Q6IA 3MJDA 2WB2A 1F8UA 2QPOA 3BFPA 4LJLA 5A71A 2FUCA 1TADA 3CNEA 2JAOA 3VC3A 4H3KB 1EINA 1F4VA 3ENNA 2VPPA 3T4PA 1RPTA 2O1SA 3R3UA 4UBNA 4X6LA 3DKKA 2H4XA 4BMXA 4TQAA 1H4QA 1RJ9A 1LJLA 4TVKA 3U1BA 2R1UA 5D6NA 1QIJA 3A2LA 4Z4EA 3O8CA 4AF6A 1W30A 1E1CB 3RIMA 4NY1A 2NT4A 2R5WA 3PEWA 1BW9A 2G1JA 1DKPA 1FRZA 2W22A 4U5QA 1NQOA 4MV8A 4E70A 1IBRA 1KE1A 2F55A 5E2IA 4A10A 2NU6A 2O3QA 4HWSA 3GLKA 2GZAA 3P5BA 2GN8A 4GPTA 3CNBA 3UY4A 4G89A 2NVBA 4C1NA 1IK4A 4HWKA 1J56A 4WDRA 4CKWB 2AXNA 2A9FA 4P53A 3OTGA 5EINA 3DHEA 3K05A 1QIKA 3IEXA 4ME6A 2DCUA 2NO5A 4CXMA 4DSOA 4G65A 2OWDA 2Q3MA 2ANCA 4E94A 3EGXA 4HGYA 3SZUA 4J16C 4S1NA 3CZCA 2BKUA 2VZLA 4ZO9A 3C5CA 2ZI7A 1F3OA 1NUAA 4ZHQF 4WADA 5FLKA 1A2QA 1JP7A 1SVWA 3DC2A 1PDOA 1K2VN 3QE0A 4US1R 1JMVA 2QQFA 1G55A 3KVNA 2TMGA 3M4XA 1VPEA 4JVMA 1L3BA 3D0QA 3SDZA 3H87A 4YCDA 2X8WA 3SS8A 2CMKA 2M32A 3PNMA 1HQYE 1SVOA 2G70A 4GRAA 3MERA 4PSCA 4LCEA 5T41A 4IG4A 1P7WA 2VNIA 1W5SA 2YH2A 3GQVA 4V3BA 2JGRA 1ULTA 1JLSA 2A9QA 3DHNA 4TMTA 2W70A 1U04A 3VXKA 1ZD2P 3OZUA 5E9QA 3VDQA 4CIYA 1AQIA 3I37X 1QFSA 3DZGA 3F0TA 4GIBA 1UZUA 2WYVA 4HJXA 3U0VA 1A8IA 4CF7A 3U7RA 2GRUA 3R0VA 1Z83A 1PR4A 3DP7A 4KGDA 4OXYA 3VGPA 3TF5A 3A4LA 5CEFA 2I34A 4BFYA 3PC3A 3JYHA 4EA6A 4ZI7A 5CR9A 1SNYA 2CCJA 3QXJA 1XDBA 5AOCA 4ZMRA 2GBCA 4HDSA 1R6DA 1KS9A 1DKUA 1E2DA 3GH1A 4B3RB 1FW6A 2BKEA 3KV1A 3QQ8A 1YCGA 3OMWA 4B7XA 1P5FA 2B61A 3UMBA 3C3EA 1SCBA 4HAZA 1Q92A 2BL4A 1ABFA 2NV6A 2C8KA 2L0XA 3BAZA 4FDAA 3UCXA 4AJ9A 2QROA 5C37A 5I9LA 2Z43A 4AJLA 2J3LA 5DDIP 2WUEA 5JWOA 3KJFA 1VBKA 2H06A 3JASA 4MV4A 1VPWA 3BMXA 1C9YA 1CG6A 3HY3A 4HLNA 1AX9A 1IXKA 2P2ZA 2VS1A 2O0KA 4IRXA 1KEEA 3HPRA 4PYIA 4YRQA 2FPSA 3DWGA 2WTMA 4CV2A 3HKEB 2ZREA 4I9GA 2RHDA 421PA 1KJ9A 2XUFA 4GX5A 4N9WA 1XYVA 2I7VA 2AUMA 2QAIA 3P19A 1CUGA 2H18A 4PFSA 2QEQA 2BD0A 4LVNA 3TIGA 1CJCA 3K6JA 3GEIA 3DAPA 4RPJA 4XQ0A 2PGJA 1GRVA 2ZJBA 1X7XB 1NLYA 4JJKA 1B8NA 1S1MA 3JZAA 3SOPA 3EDRA 3GPDG 4ZQHA 3RSGA 821PA 4CM4B 3D0RA 1WB4A 4UUAA 1WQ4A 1SCUB 3U4CA 4PGMA 3WDMA 1TJ5A 3ZOZA 5JNUA 4Y6RA 3CNNA 3GG2A 2RIPA 4UVDA 2W58A 3ONEA 2X1LA 3USCS 1NDQA 2NXWA 4RHYA 1FFCA 3JX9A 1CR4A 3M82A 5E0OA 4DLPA 4KNWA 1OFIA 1RRVA 2AOVA 3AUXA 3G2IA 5AKXA 1UKEA 2ZSFA 1KKLA 1UKBA 3S81A 2AKYA 2PKYX 1YD7A 4BLTA 4OG2A 4GFDA 3CX3A 4RSGA 2IPOA 4G1VA 4YLEA 4B2LA 5M7EA 2FPPB 3L43A 2BUCA 1U1EA 1U2QA 3NHRA 4IF4A 4RDCA 2QS9A 1VYTA 3HN6A 2OBBA 5EUQB 1ISPA 1G0OA 2XF8A 3K9QO 3CQ9A 1L5YA 3OT1B 4LSWA 4ANFA 1COWD 2L69A 5BNWA 2C9OA 1NASA 1P91A 2OV8A 3DOCA 4S1PA 1T5SA 3F4BA 3RM3A 1HE3A 2QTLA 5H59A 5A62A 1OAAA 1SXJC 1ODKA 4JLAA 4XD7A 4ZVQA 3RRJA 1NVFA 5SYAA 1M33A 5LFAA 3SSMA 3BE5A 2P5YA 3JQBA 3A6PC 2H8GA 3HKDB 4NBUA 2D54A 2F59A 4RL4A 5A3SA 1UXIA 2ZPUA 1RXSA 1MAAA 2A1IA 1J9ZA 3WIDA 4XCQA 3TOVA 2HDWA 2XHEA 4EIWA 1F17A 4LG1A 4BY9E 4Y67A 1HDIA 3B6IA 4XFKA 1X9HA 5B6PA 1HYQA 1WCYA 4ZPJA 1S01A 1CW2B 1JPNA 2JAPA 4NU5A 4AMBA 2AHRA 3BB3A 1SCQA 3BGDA 3PXAA 1ZRSA 5HUHA 3TCNA 4ON9A 4DUGA 3W0LB 4XLZA 3OQIB 1EDEA 3RC7A 3MMNA 5I3CA 3RLFA 1W4AA 5I9MA 1TLLA 1YFLA 4IH9A 1E59A 4CKBA 3CVUA 3OUUA 3HCRA 3IDFA 1RWWA 2HNBA 3JAKA 3PGLA 5JEDA 1R6VA 1SC1A 5AK0A 1J97A 1GILA 1CJVC 5BW8A 1YDWA 5EIXA 1FZQA 3AWIA 1NHGA 2QW1A 1ZNWA 4J4BA 4PYQA 1KDOA 5F76A 3SYTA 3IBFA 2WK1A 4B5KA 5TQ2B 4FMDF 3TIFA 4RANA 2PSSA 4N0MA 4NWIA 1IBLB 5T7BA 2AX3A 1JEQA 2JGFA 1S9HA 1BE0A 2B4KA 2R62A 2R8RA 5GMOA 4UATA 1SUAA 2OO7A 4TTRA 4DJFC 3WK8A 3NGXA 2BF7A 5LZ4A 2XD9A 3V9AA 4E5SA 3CPSA 1Q1QA 3CNLA 1UCFA 2ZCUA 1DNPA 2GJKA 1HDYA 1E3JA 3F3SA 3IA2A 4JFRA 4QXAA 4Q39A 2IDZA 4O4HB 4Y2QA 3IAUA 2W8BB 2ZBDA 4U6SA 3N87A 4OQ4A 4M9UA 5HCUA 4BS9A 5K6TA 2Q3DA 4JYZA 2B0CA 1BH6A 2BFBB 2O3SA 2JIOA 3AKEA 1N7JA 2AEMA 4ZVPA 4MQ5A 3ODGA 3REFA 4BQEA 3TQCA 3I05A 4FGWA 4N18A 1DRJA 3PDCA 3ZV4A 2G76A 2O7NA 2QRKA 3IOYA 1J1ZA 3QUTA 2Z04A 3SZGA 3VPSA 1JDUA 3NS7A 2JZNA 1XZLA 5CFRA 4YIHA 2XNJA 2YZ2A 3K15A 4KV7A 1W36D 2UDPA 1HNNA 2XCLA 3HSSA 5AKZA 3NYRA 5DYIA 1N2JA 2QNIA 2PRIA 3BE4A 3OLXA 1BVUA 1EWKA 4HRAA 5IC6A 1I3KA 5DRTA 4A0QA 4EW2A 1W0JD 2OXEA 5HKLA 2ACVA 2H1CA 2NSDA 3C1OA 1JFFA 1NPTO 4M3NA 5K2MA 4FGSA 1MDFA 1OWPA 3G0CA 4XOUA 5UKDA 5IJZA 2EJUA 3LW8A 1AQNA 3OQMA 2FSIA 4PGHA 3A06A 3W34A 3DYBA 4LYGA 5IC5A 3T9FA 5BY2A 1R0BA 3WMGA 2GXAA 5TMEA 1J2JA 1EUCA 3CBQA 4I50A 1GN8A 3SQWA 3PWZA 1T1JA 5BORA 4P3YA 2AA3A 1EA5A 3A6JA 3ELBA 4G5YA 2B9EA 2Q2WA 1CCWA 4D6PA 2F3RA 3HBNA 5ALUA 1D1TA 4E31A 1ZCFA 3QKUA 3R9XA 1VCMA 3D7RA 2Y92A 4WFJA 1KK2A 2JARA 5ALNA 3MLEA 2RHMA 4J07A 1FFXB 1K8ZB 3KOMA 4RDXA 1SCKA 2F8TA 4TPKA 3C6ZA 3FDFA 4ONEA 3HJRA 1VA4A 2AE2A 4X3CA 4LF5B 3U7EB 1LDYA 3IKJA 4DRZA 3FIUA 1RU3A 5IHPA 3RS3A 1OW3B 2VUHB 1EX1A 4HNRA 3FOFC 1CY4A 5ILQA 4A15A 3O8DA 1LB1B 4X7PA 4RGBA 3CZRA 2F64A 4LHXA 1G16A 4F4DA 5LVAA 4ZODA 3RHFA 1CD5A 1YRYE 1T9ZA 4PU0A 4ZT2A 3T1VA 4HGPA 4RVOA 1JHUA 3IQHX 1U4OA 3NQ41 3ZLUA 3SJBA 1N8SA 3OQ1A 4LWQA 1LLDA 5CX1B 1UJ6A 4LXIA 2NVWA 4M6WA 5BNFA 1U7OA 1EUZA 2XAAA 4EHLA 1B43A 2YXBA 3NB0A 1XRQA 3HRKA 4B45A 1SMKA 3G8BA 2HO4A 2HWXA 4W5OA 2IP1A 4AZTA 4KPEC 4LHVA 4Y2HA 3VKUA 2D2FA 4F97A 3JVVA 1HI9A 3V7YA 1RI3A 5DO9A 3M6WA 1FYEA 5ETJA 2VBGA 3FYSA 1W75A 5K09A 1L4FA 4KREA 2XZOA 1QDEA 2Z9BA 4GE3A 4D8WA 4K6MA 4N40A 3E7WA 2DJIA 4P5PA 3CRNA 5L3RA 4J7UA 2XVAA 4JI4B 3X1YA 2ZUBA 5JMOA 4NNPA 4MYHA 1T29A 3LHFA 4NPHA 3DEIA 1YMUA 3B1YA 4G3XA 1YC5A 2PA0A 4UAGA 2PPLA 2VP3A 1M76A 5KCZA 3CTPA 2ODPA 2O8EB 1Y1PA 4N7JA 3H1PA 3Q8WA 1YDMA 3HO6A 3WP1B 4J9VA 3U4GA 4F8YA 2XUKA 1YQGA 4FDVA 3T7TA 2FJPA 1EAMA 1U1CA 2GJ8A 3ESQA 3KEOA 1YZNA 3HYCA 4MUEA 1SBQA 3T3EA 3UEOA 2D5IA 1H69A 2GLXA 3QUAA 3DGFC 2JLRA 3ZJUA 3I8XA 5LL6P 2A7XA 5CLHA 4LZLA 4ZCSA 4X90A 4K6GA 5AVJA 1GDHA 3PNYA 3FDZB 2BFEB 2HMTA 2X0IA 1ZOPA 4BX8A 2RARA 5HJ7A 2ZM5A 3K8YA 4QEZA 3PGJA 4RF3A 1M0SA 1NVMB 2PQMA 3EQ8A 3G8CA 4DEYA 4IRMA 4D0NA 2QP9X 4D74A 3T1YB 1U9IA 4RKRA 5REQB 4PNHA 4DCGA 5KREA 5LOVB 2MINB 4P3OA 2SHKA 4OK6A 4WNIA 4LHWA 2D8AA 1CLEA 2B7BA 1YQTA 3GRRA 3TAHA 4ZAGA 2FW0A 5KPJA 5F73A 4LTNA 1JZSA 1LH0A 3FAZA 2R8XA 2QTTA 1G7RA 1XL0A 2JI4A 1EJBA 1G60A 1QVRA 4ITUA 4LRXA 1PN3A 4P9NA 1DC4A 1SK9A 2XQIA 4W8GA 2PBFA 1GQOA 3BREA 3H2GA 1RJFA 1CHNA 1TJNA 4AZ0A 4B40A 3VYTB 3HQ4O 4FBLA 3S2ZA 4C22A 4FR0A 3L6BA 2FYTA 4XWYA 1PK8A 3HDGA 2OHGA 3ICPA 1EGVB 3DT8A 5KINB 1XKTA 3LUJA 1PUJA 3N59A 3OU7A 2AG5A 4JR0A 2R6DA 5BP7A 3M6IA 1XO1A 5G3YA 1GGEA 3NH6A 1TCCA 2I55A 4KH0A 4S35A 3H2ZA 2OGUA 4PVDA 5HDBB 1WOMA 4FHZA 2ZI6A 4A92A 6ADHA 2IH4A 2REQA 1ACMA 4TZ6A 3C1UA 3LAWA 1K66A 3K6KA 4UM5A 1H5NA 1F9AA 1GRRA 1U4NA 2FWIA 4R40A 2ZJZA 4X1KB 5TGDA 4RGVA 4A2WA 1ADYA 2QZ9A 4WBXC 4CQJA 5KVVA 1AC5A 1O4WA 3GUVA 2W2LA 2YMLA 2GK4A 2VK8A 4PXAA 2MMGA 3N0VA 1Z6GA 4W9MC 2H0AA 1Z4IA 3H5AA 1VECA 2Y0PA 3QPAA 4QAQA 3DZKA 2H3EA 4QODA 4OJKA 2XB2A 1T1RA 3QGMA 1NU6A 2YW9A 3LBNA 2E1RA 5AK3A 1UAGA 4GI3A 3E3MA 3HBLA 1PR5A 2PDAA 4RLFA 4ZAYA 2K4MA 4YMTA 3P52A 4GI7A 3R5SA 3TSOA 5L7WA 4PIMA 3FMPB 2EF0A 1EFVB 3ZHXA 2FA9A 4GC9A 3IEPA 4DNFA 1O95A 1GFZA 2GLTA 2O2JA 4Q4JB 4UTZA 4Q03A 5GJBA 3GEEA 4UBLA 2AN3A 1V7ZA 9LDTA 3OHMA 2H9YA 2VUTA 4PG4A 1ETHA 1RM5A 5FPSA 3VR4A 1IUNA 3SCZA 3CW8X 3U16A 4DUYB 1MP0A 3STUA 1CR6A 3WKAA 1K1EA 1AM4D 3QKRB 3GIWA 3TIWA 1Z73A 3WICA 2B8TA 1NZJA 5IM5A 4LNAA 2CLOB 2H7VA 2PH1A 4BN5A 5LQAA 2J0UA 4KJXA 3AETA 3TL6A 3PPVA 1PJZA 1XTQA 2QLLA 2Y66A 3KS9A 2OGWA 2JB9A 1JLLB 4E4RA 3O94A 4GXNA 2G25A 1PNRA 4D9HA 1Y7TA 2YNMC 4ZCQA 3BHNA 4K9RA 1SUEA 2E1PA 2H4ZA 3PJRA 1JR4A 1JTEA 2Q4RA 4N4AA 4BU0A 1V8BA 5LQNA 3MMZA 3RJ9A 1PT7A 2M6LA 2QMHA 2FNAA 1FDUA 1R66A 4BZWA 1W581 5JJBA 3KYIB 4YCBA 3OCVA 4KQ2A 1SK8A 4F4CA 5A5GA 1M6WA 4QNNA 3THRA 1E2EA 3VH3A 4DBLE 1W19A 3DV0A 2HGSA 2H92A 1BHO1 5B1EA 1K3UB 5DNYB 3MPUA 3SF8A 1U0EA 3C48A 3IMGA 3HB0A 2C88A 2Q0SA 3N86A 4HBGA 4P32A 4W5WA 2P9TA 2W7TA 4JL8A 1K5GA 1W0CA 2XDWA 1TQHA 2ZIGA 3I2HA 4RL6A 4EG3A 2OE2A 1NVEA 3F71A 2XCTB 2ZYGA 5TEWA 1XZFA 4J3FA 1ZR2A 1QMPA 3KE8A 1T2FA 1S4QA 1KMCA 3LP6A 3RG2A 1CX9B 1BGXT 3ADCA 2D00A 4RGYA 4F2GA 3WLQA 4PNZA 1DIBA 4I2NA 4Y1RB 1RYDA 1CQZA 2VTKA 1VCHA 3JQAA 2YL2A 2RC6A 3ANMA 2RSLA 3FNHA 1V9LA 3WHKA 5HIIA 3HFGA 3AKZA 3IQEA 4PSAA 5FQNA 2GKSA 1FYXA 5CFQA 1S8OA 3PFIA 1UANA 2VATA 3W1EA 4JH0A 3GXBA 2W37A 1ZR4A 1L8AA 2OCBA 1WUTA 3QVMA 2FZEA 1ADBA 1HNZB 3VMFA 2Y9PB 3ZTYA 5JH7F 3ZWXA 2ZIUB 3E05A 1DAHA 2VXBA 3LDUA 1I94B 2RI0A 1VYVA 1Y37A 3QRWA 5FD8A 2ECKA 2NWQA 4U2EA 3H97A 1BFUA 3VO1A 1EG2A 3UUFA 1LDEA 1H0KA 3NLLA 1ZGZA 4H7HA 4BVEA 3WGQA 1TZMA 1M5UA 2VAPA 4FE3A 1H23A 3EZ2A 1RJWA 4IUCS 4YRSA 5A02A 4YDHB 4IQ4A 3T94A 3WG9A 3K92A 4CM3A 2P62A 1JTVA 3IQGX 4GVLA 5DBGA 4L8GA 1IN6A 3N76A 3LKVA 3DO6A 4N5NA 5DHFA 1TIPA 4DMUB 4RC9A 1QAMA 4M99A 4GQBA 2O8BA 1F2VA 4EHBA 5JTTA 4Q4JA 4DNXA 2QUHA 1WOYA 2IXBA 4V38A 4W5HA 4Z3OA 3P9XA 1U0GA 3T6KA 3DW3X 3VVCA 3DQZA 4JR2A 3NRBA 3LPDA 1M2EA 2GF9A 2PHZA 3QXGA 4NBKA 4RIGA 5G1NA 4PVCA 5T67A 4CL3A 4EPTA 4F85A 3ER8A 3G85A 1FJ2A 1QYWA 3JZIA 4UBOA 1D4ZA 5IF3A 2YWBA 1G5FA 2E4AA 4QU9A 1S2IA 1IZZA 3ASUA 4POAA 4AD8A 5IN4A 1W85B 4U7FA 3D3EA 4X92A 3OETA 4TT3D 4YMIA 5HILA 1YJQA 1JHYA 4X97A 5EJAA 6CHYA 2GH1A 2DEUA 2LGJA 1YFJA 5FWYA 3OZEA 2CJWA 2YRFA 1A9XA 2ZWVA 3G89A 1X86B 3KOZA 3LPNA 4PZLA 2DERA 3GZTB 3P97A 2C9BA 3CEPB 2ZI5A 3GRPA 2XQJA 2FPGB 1RWBA 3DGEC 3LKBA 4OFBA 3T35A 1I6WA 4FKMA 2WIDA 5BQ5A 5I5EA 3PNKA 1GG5A 4I1OA 1XTRA 1WCV1 4KO4S 1DZ3A 2VDMB 3OX4A 3Q41A 2XY4A 4CT4B 2C2MA 3ER9A 1SOUA 4ZZ0A 3W4JA 1MENA 1P9LA 3QFHA 3ESRA 3RS0A 4YRCA 3SQMA 1DBVO 2CUKA 3C41J 5J63A 4M1EA 5AHXA 3RK1A 3BBPA 3QX9A 2QY6A 1WVMA 4TMYA 4UAUA 2EZ9A 4M0FA 1RIIA 1MZVA 2HRQA 1QPBA 1VSQA 1G6Q1 2GNOA 2M2IA 1KTVA 3E5RA 4IMPA 4MZDA 5AVOA 3HNOA 5D1HA 1TVKB 3FSJX 1RTTA 2FN7A 1HMPA 2NZ2A 3K9LA 1BCRB 1I5OA 3H5LA 4Y18A 2YFHA 5IW8A 4YYEA 5EMJA 3AR8A 4TLEA 4YP7A 3CKYA 2EGUA 5K8CA 5CPBA 2FR1A 4BVGA 4CM4A 3B60A 5BPFA 3GAMA 2M1ZA 1L6RA 1Z2DA 2QTNA 2QSZA 2Z1DA 3ORQA 4LJ5A 4R2WA 2AUNA 1L4MA 3AM3A 4TTPA 4Z6KA 4OXQA 4FDUA 1QDUA 1GKLA 2VZ8A 4QPDA 2O50A 5BW5A 9LDBA 3CKLA 3SXPA 1TW2A 2WT8A 1ZRNA 3PPWA 3WMRA 3ZXYA 4EGJA 3E1SA 4ZAZA 4JBNA 5JISA 3G13A 3ZGZA 1XE3A 2CNOA 3H2YA 4NBRA 2YZNA 4X44A 1LX7A 1P0CA 1FB5A 4D9NA 2FPPA 2PZAA 1XQ1A 3TDKA 1MJNA 2CLLB 4W5QA 2EGGA 2WKQA 3GP5A 1R74A 4FX5A 4RGQA 2B21A 1KFKB 1XNGA 2EZTA 3KWJA 3RU9A 4EO7A 1N4DA 2IV7A 2NSHA 2UV8A 4AK9A 3D64A 3W1VA 1PQPA 3AESB 1Z4LA 3QU5A 5LP6A 4TZKA 1BMFD 5HZGA 1J0DA 1NOKA 1B0ZA 3KZCA 4B7CA 5GP1A 2RGDA 3NGMA 4L8WB 1CUYA 1SA0B 3AUSA 1NUTA 3RLIA 3J81k 2P8SA 3B85A 1WPGA 2PUCA 1U7PA 3O8OB 3HJUA 1KVSA 1P1CA 2QX8A 4XUGB 4WOBA 3RRBA 2FQWA 1EX9A 3PQ7A 4E3ZA 2WF6A 1EYZA 3OQIA 3WLLA 4ENTA 2I3AA 1YF3A 3M6FA 4TKVA 1WXIA 2DWOA 4CUJA 1G2IA 4KBFA 4ARZB 2EW2A 2K5UA 2HAEA 2FPIA 2P91A 2V8BA 3B9RA 1O95D 1VYUA 3EXHC 4GR4A 5D6YA 1Y34E 3JQ8A 2B82A 3NW9A 4HQKA 1TO2E 3AILA 3W06A 3FCSB 4RXTA 5JO9A 3SYKA 3T1TA 2E87A 2VJCA 3D8UA 4CLXA 4RVGA 2W2TA 4UVGA 3VSBA 4IIYA 3OFSA 3LIPA 3KB8A 3UB3A 3LU1A 2I4NA 1T3TA 2WIAA 2XUPA 1U0NA 1WP9A 2C5BA 3P4XA 3RVKA 1DX6A 2ZRQA 5B3JC 5I7FA 1F38A 5PGMA 1WCIB 3NV7A 1ZXBA 3DOOA 3EQZA 3B36A 3E7DA 4HDSB 1W76A 2QQRA 1CZNA 2X2OA 4BJ3A 4D56A 1J5EB 1N3BA 4KRGA 3MD9A 1T8SA 2DH6A 2IDJA 2WIKA 5A6SB 4MP8A 1DMRA 5FUQA 1OOEA 4LYAA 4DB2A 1Z7WA 4PTLA 3UMMA 2ERCA 3BVPA 3LUPA 3OTQA 3QLUC 4RZQA 1WXFA 3Q1KA 4KNYA 4DSNA 4HDRB 1HFWA 2BIFA 4ZDKA 2JLCA 1XTBA 4UAVA 4C0XA 4D9CA 4HFJA 2OXIA 1MPXA 1M9NA 2RB5A 2WWWA 3CISA 5ERXA 1K6EA 5FBZA 4NEHB 4UREA 2ZXUA 1OX6A 4FFNA 1PJ2A 1DEAA 2HZ7A 5JVDB 2IZZA 1PSWA 3K31A 2QUKA 5ED0A 3WL4A 3EISA 3HMQA 3UKJA 1S02A 2QX6A 4C7BA 4ZHQB 3TEFA 5F21A 4FJ0A 4FGKA 4HDNB 4MUJA 3FTCA 3KO8A 1V7PC 1DS6A 4LHSA 4MUXA 2I65A 4DJAA 4I6JA 4BPBA 1LD3A 3K9WA 4BO5A 2DETA 3FB4A 2NPOA 4E7OA 2VOEA 5TV2A 1EDOA 1HE2A 4A2CA 1RCTE 5REQA 3UN1A 3PX3A 4EHIA 2R751 3TFOA 4DV4B 4DWWA 1C2YA 4UDXX 1B74A 4IGFA 4FFWA 1WLFA 3RYCA 2A5GA 5LQUA 3HYSA 1LDBA 2LPMA 3Q8LA 4F3YA 1DRVA 2CNWA 2GGSA 1NN5A 1UBCA 4M37A 1U98A 4IWNA 2VRCD 3K30A 4FR5A 3WIOA 4JXZA 1SUDA 1R12A 3MWFA 4AUKA 2BKLA 2HHAA 3FMGA 5EXTA 1QGUB 3P7MA 4IHJA 4KU4A 3AEUA 3EAGA 1SXJD 1SBCA 4MUAA 5GY7A 2WPDA 2I9PA 1XZQA 1KYXA 3GU3A 1HE8B 5I9BA 5IKPA 3AJDA 1I2AA 4GP9A 1RTKA 2E0IA 1DC7A 4MI6A 1FP4A 3Q7EA 4QZVA 1JR6A 1FK8A 1IQPA 4WESB 4B4UA 5DV9A 3DR3A 3GNQA 2JRCA 1OXBB 3KTAA 5CVJA 3PEYA 3MMXA 3SY8A 4UPDA 1F14A 2EKLA 4OSEA 2IXTA 5AHKA 2MWMA 3RKUA 2EFDB 5AIAA 2DZDA 5DHQA 1PR2A 3QNMA 5FYQA 3RU7A 3UV3A 3RQSA 4TTJA 1KSFX 3TRKA 4ZU3A 3SVTA 3RPEA 5ALIA 3HU1A 4DQKA 3BAFA 5EUCA 1ICEA 3KZKA 1J0BA 2VH1A 4DV1B 1IOZA 4NDAA 4U39A 5EIAA 4E07A 4K0KB 5FWXA 3WWYA 2AFHB 1GKKA 3GCWA 4D80A 4RXMA 4GXRA 3PNOA 1VHWA 2UUBB 4ER0A 1KI8A 2VP2A 3ZTWA 2OK8A 3KQVA 4S0ZA 1L1FA 5ITSA 1CJBA 3MF4A 1XCLA 2AEJA 2E4XA 4JB2A 4CI0B 2QRNA 4FE7A 4YDSA 4EFKA 2G72A 5C5DA 2PGDA 3TLMA 4CKBB 1N57A 2WMDA 4G1FA 5ALQA 3TNFA 2QYSA 1N2BA 2IXGA 3H5VA 4KVAA 3WHPA 4BBJA 3N2LA 4DG9A 1QOZA 5JECA 2XXAB 4M7OA 3LF1A 3ZVNA 4HNAA 2XT9A 2XE6A 4Y1RA 2P65A 2HLPA 4PAMA 2F3QA 3LT5A 4QGFA 5IJ0B 3ONWA 4Q9KA 1ORIA 3PEVA 3H1AA 1KO4A 1WX1A 5EE9A 1HL3A 3EMDA 3OOYA 3S4YA 3ZX4A 4TS3A 3QQ7A 2PV0A 4E2FA 3UJCA 4IV5A 3M6LA 2ENWA 4RTJA 3PDIA 1F0NA 5LLDA 4G5XA 4MVJH 3DS8A 4Z9YA 4X24A 1A9SA 2JCVA 2WMNB 4I55B 4XYLA 5IG2A 4F84A 3H8SA 3I73A 4FT4A 4R6XA 3D7LA 5JXGA 5C8DA 4W7IA 3KTDA 1EAYA 3AZPA 2ZATA 5FUYA 3FWYA 4A9AA 4EFDA 2FPGA 3NUQA 4N5DA 2JFQA 4MAFA 2C8VA 4E11A 2JIRA 4DR4B 4YHBA 5IANA 3GRYA 4R69A 2I2FA 1NW5A 1PJ4A 2YS7A 3JVDA 4WNCA 3TOCA 2AZXA 1P3DA 3WTCA 1Z26A 4ZZ3A 5TX7A 1QFYA 4YJHB 3NOXA 3EXFA 4BP1A 2YZ7A 2ZB4A 4ZTUB 4I55F 2GETA 3E6AA 1QKIA 3HVKA 2LD4A 1PGOA 2UVQA 2A0UA 3DEJA 3KB6A 1DOZA 4N03A 3WYFA 2IOFK 1V1JA 4ZVLA 1UODA 3FROA 4DCCA 3GRZA 1JI0A 3GUHA 3AUAA 4RK7A 4C7OA 1VBMA 2ZSDA 1QH1B 3PHLA 1U28C 3LZ6A 5FPKA 1Q5PA 4W1QA 5TB5A 2X6QA 1J90A 5BWLA 1JXMA 2RGNC 4UE6A 1T5OA 2MR6A 3LXXA 5IF9A 5LD2B 4MQBA 1G59A 4P7JA 3HEMA 3NBQA 1QE3A 4UXHA 1B76A 4ARVA 3Q0IA 2I22A 2PSEA 3GA0A 4PE5B 2A1TS 2ZKIA 1RRCA 2P6RA 2VHXA 2OCAA 1N92A 5DYNA 3IFSA 4JLUA 5E6UA 1R5JA 4DXDA 4GMDA 1B4DA 2E5FA 1QH8B 4M7WA 3NHMA 5A03A 3OSZA 1RYEA 2RBGA 2RGEA 1QQ6A 3H1BA 4EMTA 3TRIA 2ZUEA 4MRPA 4D02A 5LJIA 4L16A 4GPEA 1RE0A 4K05A 4CR7A 5HF6A 3BKXA 3DMFA 4PYRA 1XTUA 2ZB7A 4DMGA 2RG7A 3D7MA 1ZX1A 2HRDA 2WICA 3O1LA 4UJ5A 3FKJA 3FPBA 2B1GA 4Q1FA 5FO0A 3WBFA 1UEJA 3VOSA 4PNEA 4JX8A 4EQZA 5ICMA 5LBIA 3R75A 2DUWA 2PUVA 2DQZA 4YREA 2I4MA 1RXEA 1L5WA 3DMYA 2X0KA 4G97A 4NZYA 4DRXB 1DOHA 1KJJA 2OO5C 4P5DA 4RIFA 2I6SA 3NCHA 1XCJA 3RAGA 4EHJA 3L8HA 1VE6A 4KVGA 4NS1A 3SC2A 1IEXA 3AW8A 2C7VA 3T95A 4C20A 4CR6A 5KTMA 4ENQA 5E3HA 4X60A 2GD6A 4RHTA 1EUDA 5HVNA 5JRJA 5F98A 2XCUA 2YTZA 3I2JA 4JC4A 4W99A 2EQBA 4C06A 3OD5A 3OZDA 4DDMA 3ZXSA 5KPDA 2ZJ5A 1T8TA 1TQ2A 3AV3A 3PEEA 3RF6A 1QP4A 1D4OA 4PRYA 1E77A 1GUAA 2ZWMA 4HRYA 1CQJA 1VSUA 4QJ4A 4E46A 4G5GA 4E15A 1S8FA 2R8PA 4XIGS 3T9AA 1XPUA 3QX7A 4BLOA 3ANSA 4EVSA 2HMSA 3JAWA 4WK0B 1U8AA 5E6RA 4B75A 1P4JA 2C92A 4U3JB 1BA2A 2OLEA 3V33A 2OMEA 2VNSA 2ZYUX 1LZLA 3OKPA 3FRJA 1BCRA 2R66A 3U4QB 3DLHA 1CK4A 1WXXA 4FSHA 1HC7A 4YGXB 5LM3A 2PVSA 1DPFA 2IV2X 3UBMA 4EGAA 1FJXA 4KUEA 1PI3A 3NBKA 3THSA 5JNTA 1VGVA 2HO5A 2NO4A 3GFFA 4HOYA 1QE0A 3K9FC 1ADGA 2IYEA 2PRJA 3QTBA 3N0TA 1PHRA 4FINA 4CTKA 1ZI9A 5CHYA 3BSSA 1RWNA 2HFKA 4B1FA 1OFVA 3Q12A 1HTBA 4IJWA 3CA8A 1N9GA 2RGCA 3FY4A 3TLAA 2XB6A 2EKQA 3BTOA 3DMTA 4NKRA 4Y30A 1QVAA 1PYOA 5E7MA 2XWQA 3GVCA 4LSZA 5G40A 1Q20A 5SZIA 1CYEA 2Y0EA 3O75A 3THWB 2CY0A 3AETB 4TSFD 3FDZA 1IHYA 2V58A 3KPJA 4PX2A 3EOBI 4AO7A 4UMFA 1K5DA 2PE5A 2PXHA 1UWLA 2QE7A 3LQFA 1K7EB 2IY7A 3GAAA 4D42A 1LLUA 4Q9NA 5DFAA 4ETIA 1D8TA 3KPWA 2FETA 5T64A 1E6EA 3IV9A 1K6XA 2GFIA 5BRJA 4G9EA 1FVOA 1F8YA 3D3WA 1KU0A 1R7RA 1GU1A 4IXDA 4MGEA 4AWBA 2HK6A 2PUJA 3ECSA 2ZYIA 1AY0A 5IYZF 2VPIA 3S28A 4MH0R 2C7OA 4PQGA 5HJ5A 2QLFA 3SZRA 3AY0A 1L5QA 4JQOA 4BZPA 2PGXA 3L7NA 3NOOA 2B4QA 5C52B 2QN6A 1W25A 2WWIA 1B1CA 2E4WA 2VP6A 3GNLA 3L8MA 3X1WA 4O1HA 4CLEA 2RGNA 1N25A 4M0PA 4Q1VA 5JRZA 3OTOB 1AD2A 3L0ZA 2QTCA 2ZFUA 4JX9A 2QN9A 1S3IA 1VE9A 1FLVA 4EABA 2CFRA 1DKMA 1KDRA 5GTDA 4HVTA 1BS1A 3B78A 2HMUA 4GHWA 1UOPA 1IL0A 1TZBA 3NZEA 4M0CA 4D4GA 1U2DC 3RAJA 2H65A 1XJQA 1UIMA 1NI5A 5AXDA 4F4FA 1UXJA 3KFVA 4O29A 4C3OB 1QP0A 1ZI6A 4P92A 1T2UA 5K0ZA 1KOGA 1RR6A 4G8JA 2YC4C 1JA9A 3A27A 3L8EA 1M1YE 4JT8A 4Q6BA 4RWZA 5LBTA 4B6SA 4B32A 4AS1A 5KOHA 4XIFA 3VR0A 1MC5A 1II0A 2LKDA 3DL4A 1THMA 3NWPA 4EUSA 3LBAA 3D4LA 2GTHA 2YHUA 4PLGA 4OQLA 5EWMB 1JDJA 1S9DA 4LRQA 1PD0A 3QHQA 3TXXA 4IXTA 1CQXA 2OGTA 3EXFB 5FL7D 4JAVC 4F9TA 1U3CA 3MYYA 4DDUA 3A9RA 4Z8YA 2YMMA 2FJ0A 4JLPA 5FOWA 1L7OA 3OCUA 4OLFA 3REQA 1IJFA 4E5VA 5KWVA 1GZ5A 5CGZA 1E0AA 3EVBA 4JV5B 1QSGA 3OKAA 3P4UA 2AUTA 4UQLA 3UXMA 1NNUA 2GWRA 3MMPA 2PBRA 1WULS 2JATA 4FDMA 1UKYA 3UGQA 1Z08A 2VHEA 4CF5A 1KC1A 1YZKA 4HAYA 1UBEA 2MSLA 4IUBS 4E14A 4UUOA 4TWRA 2UYCA 2C82A 4HNTA 4IMIB 2OFOA 3T5PA 4FOOA 2GZMA 1E1CA 1Z2AA 4OHKA 3JYPA 2NTEA 1SZPA 1UJ5A 1Z37A 3CCFA 4RK0A 3BMNB 2IZ6A 3LX4A 4UMVA 3F4LA 2E18A 4TLMB 3IR6A 1K98A 3IHWA 3RVSA 3V97A 3GRAA 2C2BA 1SU6A 4MLCA 2EFCB 3PUIA 2P1RA 2X4LA 1Z5GA 3BWBA 4US0R 5DYWA 1YKSA 1XU7A 2RH8A 3VJMA 2B1IA 3HLKA 3EN0A 4JWTA 1SJ9A 4WBNA 1DPGA 2A6PA 1FTGA 5DNDA 1YB2A 5AK6A 4L2IB 5AUOB 5BV7A 5FTNA 1PFKA 1WXGA 2O07A 4FGUA 3OG9A 5K8JB 2BFMA 4KQWA 2WVAA 1D0IA 1JLRA 1I4OA 2HCBA 1EXVA 4DM4A 1T15A 4G5RA 5IBRA 1XLTA 2H2GA 2BY4A 2GEKA 1O5IA 1U1GA 2P2NA 2XNHA 3OTWA 3PQ8A 3Q7PA 4OUDB 1NMXA 3WAKA 2AYXA 3SXJA 2ATVA 5ALVA 4JLDA 3J80A 1EFCA 2Q3EA 2VJBA 2WSBA 1CDDA 4X7RA 1Q0UA 4E6EA 3AVYA 2Q0QA 2QM3A 3K5HA 4MV9A 2G8LA 4DDKA 1Y3HA 3PDHA 2X5KO 3D7SA 4QPZA 3I6BA 3J7TA 4F7DA 5FXMA 2QLTA 3D2AA 2YJ6A 1WWKA 3PGA1 3MUOA 2YHBA 1C7IA 2B3TA 1DEKA 4WERA 3UTDA 1KGDA 2O0HA 3DPSA 2BTOA 4UCXA 5TE9A 5H68A 1QIHA 4D8XA 4OHCA 3BFKA 2PH5A 2Q7OE 1NYRA 2OG2A 2J5BA 2PN1A 2QVCA 3ASZA 3GRVA 4KFRA 4OK3A 1LRLA 3U0BA 2WD7B 4V03A 1YDFA 4CMEC 5K3OA 3AU9A 3QYAA 4H7PA 2W6ID 2HIMA 8GPBA 4JT4A 3V6LA 4AW9A 2V9PA 1UAAA 1NF2A 4W1SA 3LM8A 5DP1A 4LNHA 3NBYC 4EYGA 1E2NA 2UUPA 3IV7A 4UASA 4CLOA 3FCAA 4GMXA 3V1NA 2VCEA 1IMJA 3AR7A 3ESYA 3PICA 2VJOA 2ISSD 2NU8B 5K4GA 4BAZA 2HA0A 4B8WA 2JIPA 3L8YA 3ZDYB 2PZJA 3COPA 4IIFA 3IDAA 5JS6A 4KYVA 1KZ7B 1NFQA 2O2EA 3QYJA 1XN4A 2XDAA 4KDIA 4GR9A 5K6RA 2AOUA 3TR0A 3GP3A 3KB2A 1HPLA 5CAEA 2A92A 3UK2A 3FLMA 1CEXA 3B8EA 1I6KA 3EC2A 3WGKA 2VEOA 2OVBA 3BCSA 4YV1A 1P4HA 1HGXA 2AMJA 4YT5A 3THWA 1N6RA 1I9CA 2D4AA 3RTGA 2UVPA 2GK3A 1WVGA 4CFZA 1AS2A 3I6QA 2H17A 3E9YA 1GGHA 2G36A 2QD5A 2H1RA 3I9V6 1WU8A 4FILA 3S27A 1Y3FE 2GFQA 5IKOA 1R6UA 2D3TA 1RQXA 2WU3A 2QGFA 3TEMA 2CVFA 3LCVB 3HCDA 1IXSB 1DXQA 2RCNA 3JR3A 1OX4B 4S12A 5AVSA 4KIJA 3D4OA 3WRYC 3LX6A 3QE2A 5JH7A 2HW8A 3MCVA 3QFRA 2P1ZA 3IOMA 3RWMB 1NNLA 2JAXA 3ADKA 2WE8A 3WLOA 3LUHA 4PFQA 3RKSA 4TXHA 3T3DA 3P9RA 4L15A 3PLRA 2DQKA 2JFBA 1KY4A 3Q1LA 4BECA 1OPXA 3HRHA 1XU4A 2YUIA 3IIMA 4C6SA 3JWHA 3LVQE 2V3WA 2JFUA 1JIXA 4J6EA 1VE7A 5D51S 1H4VB 5EHQA 1F5SA 2ARKA 2FLKA 3E9CA 3FI0A 3KLNA 4KI7A 5KTTA 1ZOSA 3JSXA 4J0EA 3IKTA 5CM8B 2QRUA 2FH5B 4EW6A 2Q6OA 1GDDA 4MW1A 5CA0B 2ZYDA 4HDOB 5C46F 1Z5ZA 1HM5A 1VG1A 4ALNA 3C3YA 3HI6A 4G25A 4QM6A 2QJWA 1RRKA 4PC2A 4XSGA 3NIDB 3SBDA 4Y9SA 2ZJAA 3X1JA 2V7GA 5CCDA 2GPNA 1SQ6A 3ZVMA 5HE9A 1Q0ZA 3TVDA 1DB3A 3FUWA 3KWMA 4RPCA 4EARA 2VLBA 1D9ZA 2JGMA 2BGLA 1VM6A 3TL3A 3W7VA 2FWNA 2VPTA 2EJVA 1K06A 1H3FA 3QVWA 3MTJA 4HDNA 1F8XA 2XRMA 4XE5A 5DOVA 1NQ5A 1HV8A 1VL5A 4JUIA 1UH5A 4UU7A 1HSZA 1QGAA 2VN8A 4GBJA 2EEZA 3IRVA 2V7XA 4XB1A 1RSZA 3OE5A 5ALKA 3F67A 1ZY2A 3MJCA 1GXSB 2LDBA 2QT0A 2WT9A 4G09A 4ZAVA 2OXRA 4YJ2B 2R9VA 3DH0A 3DXZA 1KS2A 4UULA 2XOKD 3RARA 4IQ8A 1SWVA 1TKCA 2CF5A 1VJTA 3BGSA 2IYLD 4N8EA 3JRNA 3NTQA 4A16A 4DUPA 4ZI7B 4RMHA 1T5LA 5CG1A 4TSRA 1IWPB 5JYCA 1F8FA 5K20A 2H7CA 2GCEA 3LS2A 2P30A 4IIUA 2AXQA 2DFNA 1GZ3A 5AW4A 4OOFA 1XVVA 2Y2UA 3ZDZB 3COJA 1TDJA 3LKZA 2WHPB 1I6MA 1Q1GA 1TYEB 4GKAA 4EA7A 1TM2A 3LOQA 3H4IA 2BSAA 5A6SA 3RYCB 3VNVA 3TSAA 2XUHA 2R7AA 4IDDA 4EZIA 4GR5A 3OIFA 2XXJA 2J1LA 2FW1A 1XP5A 2QR5A 3LLMA 4FMCF 3TE6A 2P67A 4U8GA 5FA8A 3DLBA 5A06A 1KZ6A 1YQEA 1XRRA 2BM8A 2H4JA 3ADPA 4UEWA 2ADOA 2VRBA 5AJWA 2FOIA 2PZGA 3L41A 5COQA 1QIMA 1G4UR 3JQ9A 1W52X 3OECA 1JPJA 1ZPDA 3OD1A 3SKXA 1UDWA 2NZUG 2GVNA 1WV1A 4LMRA 1QTNA 3ZE1B 3FMIA 1YE5A 2G4CA 3MBKA 2P7IA 3Q2IA 4HEHA 5JXJA 4GZMA 2VDVE 1H1LA 3PJGA 5H4HA 1K4MA 1R4AA 1HYHA 4IIGA 3O26A 1EI9A 1JJBA 1H9BA 3KHKA 3TQOA 1IU9A 1UBSB 3EHEA 3Q5DA 2P40A 2O5EA 1PP4A 4IS2A 4N1AA 3G7NA 1ECFA 3GCGA 4IDQA 4O2AB 4RH1A 3RIYA 5J2UF 3G2NA 4F5WA 2VPQA 3OICA 2PH3A 4O4JB 3PC8A 3LQRA 13PKA 2JCBA 3VO2A 3J7AC 3M7IA 1R5NA 2Q1AX 3R3VA 5DSTA 3LDGA 1RWOA 4KWEA 5KVQA 2CE2X 2YIDA 1PV1A 4NULA 1PV2A 5KNBD 1HF3A 4MRMA 3VI3B 2IHZA 2ANBA 5FTWA 2CHEA 2GK7A 2HIGA 2GVDC 3IB3A 1TJ4A 1GZDA 1QIDA 3P45A 1STOA 1L5KA 3WJAA 1MAVA 1XCPA 2WKRA 3IT0A 4II3A 4PC7A 2O5VA 2DGDA 4ACAA 1PBNA 5AO9A 9GPBA 4GPZA 1T2EA 2NADA 4GM4A 2J5RA 3ND9A 3CJQA 1Q95A 1KO5A 4O59O 1QCSA 3BM5A 4LRYA 3QWFA 4KQKA 3OZFA 2HWKA 4I9FA 4E5NA 1HXHA 4RHXA 4AZ3B 5DM70 3QI2A 1HFJA 4RK5A 4NCIA 4DARA 2QM0A 1TQDA 3GJTA 2LTAA 4P7KA 2GJSA 3KHSA 2NG1A 3TKAA 5C1BA 3G6KA 2DFPA 1J7KA 1XAJA 2C4HA 2XUIA 1Q44A 3L05A 4KYUA 2C7PA 4Q47A 5K3BA 2HSZA 3A1FA 2AWOA 3VOAA 1ECLA 1U81A 4JQCA 1OD6A 2YV1A 5IZCC 4OGGA 1XHEA 5CYPA 4BBZA 2ZSJA 3EZ9A 3DE0X 3I9NA 1TYAE 1C3EA 4C2AA 4JCOA 5HJEA 1T8UA 4IHQA 4ND6A 3PB3A 1I36A 3ZWKA 4XPIA 1PUXA 3UPUA 2GEJA 2ZZKA 4XKJA 5BMVB 3OZ7A 1YS9A 2BEUB 1R8YA 3CVJA 2GZSA 2WD9A 6Q21A 2A30A 3LRXA 2QU8A 4IM7A 4MB6A 4BQFA 4ZYZA 5I6DA 3GDWA 4DW8A 1N0IA 2Z3VA 2Q27A 1N4AA 1ZC3A 3A9SA 3CPJB 5B55A 1LKZA 2BHNA 2AC7A 3EA4A 3OZIA 4G8BA 4GKBA 1CUDA 2LWIA 2O1EA 1EP9A 3F7TA 3PC4A 3P9IA 3AYXB 4WI1A 1X1BA 1XD2B 1Z6TA 1MDBA 3G1WA 1RLJA 2YCBA 3ETHA 3EA5A 4C6TB 3F97A 1WBBA 1DFGA 4LF4B 3I1JA 4I4IA 3UHOA 2G6TA 4D3SA 2CFIA 4HNGA 4J1TA 1V9CA 3CURA 4ZVKA 1Y6FA 3ZCRA 3QEBZ 2ERXA 4YQZA 5AKYA 1AQUA 5FL7A 5D85A 3CRZA 1JA0A 2O1XA 2P90A 2QMQA 1THTA 3BRCA 5J2TA 1YR9A 2XYHA 3DE5X 2V7TA 1FS6A 1EE2A 1EFLA 2QL6A 3PE4A 4PLWA 2JCSA 3OPNA 3QQPA 4HADA 3MT7A 4RSRA 3IOEA 5DK4A 3UJBA 3ZJ5A 4OF4A 2RH9B 3OTHA 2C7QA 4JU9A 1GITA 2AB0A 3NUZA 3B2EA 4FNAA 2PMCA 2X7HA 3SFTA 2N3ZA 3UMJA 4CIAA 4NZOA 5EKSA 4BOYA 2GTIA 1C7EA 3RC3A 4O1MA 5B3AA 3ZD9A 2EP5A 3BEDA 2R1ZA 1YHNA 3E9RA 2H1LA 3NX4A 2C4NA 1ZH4A 2FHPA 1NDHA 3GZNA 4ZFNA 2ASVA 4KWIA 1GZUA 5FWXB 3T1OA 1MT3A 1ZD9A 2VRNA 2JZOA 2OM6A 2HDNB 1L1QA 1SD2A 1SZDA 3AOGA 1H0RA 4Y2UA 1TI7A 2OGZA 1OBFO 2VPZA 5F7OA 1RYYA 1UFRA 1VI5A 1NKTA 2OV6A 3P2KA 2Z8YM 3ZNPA 3RVNA 3TMAA 1BFDA 5BOSB 3C3JA 1RAGA 1TZJA 2JI9A 3JZDA 2QTWB 4L72A 2BEUA 5TS2A 1RQNA 4X0EA 4DHWA 3E53A 4MVJI 1Z2OX 4LE0A 5IUNC 1FE8A 3QLEA 5DN6A 3RBAA 3LUCA 4UCFA 1B0AA 2C2OA 2I0FA 4DAOA 2Q1DX 2IC5A 3F78A 3IP5A 2RHBA 4WCVA 1M2OB 2W6IA 2Z5GA 3C3MA 1UXGA 3OO0A 2FRDA 1JKXA 2A4MA 4ZK6A 1KEKA 3K4PA 3HYTA 4FMPA 4P86A 1D6SA 3H18A 1S7CA 2BMDA 5IM4F 1ISSA 1T3GA 1FY2A 1PEYA 1FDTA 5B6IA 1CYDA 3TPCA 3W2HA 4AVYA 4U02A 3I9V1 1P80A 3BL5A 4PHFA 5ALEA 3FYUA 3STHA 5LP6F 4RE6A 3UMVA 4RTNA 4MWOA 1E7QA 4KO8A 1W8IA 2QT1A 1TIKA 3A1SA 4FI3F 1BVYF 2QTBA 3DMRA 3OCZA 3CR3C 4ZDWA 4A27A 3RBXA 3H8JA 1N75A 4FZVA 4WY2A 5FOQA 3VPGA 3HZOA 4HDCA 1YL5A 3TZLA 4E5UA 5KQGA 5ADUS 2WZQA 2H4HA 2ZVJA 3I30X 5AMXA 4ED9A 1O6BA 2CL7X 2XOXA 4A6DA 4NE7A 4AWXA 5FUWA 1AHIA 1VL2A 1PGQA 1Y8CA 2QG9A 1WV0A 2GQ0A 4X8LA 4AJNA 1IHXA 4YJ3B 5SZJA 4RTKA 3NASA 3OQJA 1R18A 2QBYA 5KQPA 5KTOA 2CL0X 5TJ9A 1RXUA 1R64A 1Z35A 2QORA 3EVEA 4MRSA 3CFYA 5I9NA 3EWNA 5IP5A 4YXFA 4CCSA 5EIOA 3HFSA 1XDUA 3MFQA 5K5EA 2OZEA 3L5OA 2BGWA 4YRAA 5DF1A 3IQFA 2H85A 3NTVA 3NU1A 1B73A 1KI1A 3PE6A 4BVAA 1USUA 2FLVA 4WZAA 1G6KA 5JSZA 5SY6A 3K2IA 3O92A 4PG6A 5CUQA 1P45A 2AVDA 4L74A 5EQFA 1SGWA 2CBGA 3DV9A 3NTXA 5T5QA 1R16A 2XIJA 3ZW8A 1AO0A 2DQYA 1T34A 4ZIRB 1Z4NA 4DLTA 3WXMA 3T7DA 2PJDA 1O03A 4V2UA 5DSZA 1AUVA 5DKFA 3S2UA 1SN7A 3LRPA 1QZ3A 3ZIAD 1BQ3A 2HHJA 3FYHA 3HCBA 4RUKA 2ST1A 3VFDA 4DNQA 1V7CA 3OOJA 4AYXA 3KUKA 4YVFA 5BR8B 4PXYA 2O5CA 3IH5A 2ZIVB 1Q7RA 5F78A 4R71A 3DVLA 3USZA 3T9BA 4HSGA 2ZCJA 1Y1SA 3OWHA 1G41A 1M34A 3CSSA 4KFSA 4MS4A 4QXMA 5AJZA 1PSDA 1ND6A 1YUNA 5THQA 1L9KA 1RZ3A 2I2WA 5E7JA 2LW7A 2HYDA 2R96A 3DOJA 4L8VA 5G4KA 5AFSA 4TV9A 1GAWA 2BGMA 1UFKA 1QH9A 2DBZA 3LBYA 3QLUA 1JXAA 1I4LD 1W44A 2YIJA 3ZS8A 2Z6AA 2FFAA 1PJCA 1BMTA 4LHYA 2EWVA 3VH1A 4DHEA 3NVKI 1K86A 1SC6A 3KHUA 5JQWA 5A4KA 1IY9A 1GXSA 5HQ3A 1NY6A 3OVMA 3JSAA 1R10A 2YS6A 4JMLA 1LTHR 2WJAA 1GIAA 4EHFA 3U48A 3QEMA 4QQFA 1OGYA 2G7MC 2PSHA 1OKKD 1LTQA 3WRWA 4DC0A 3SSAA 1JJFA 3GHYA 2PUDA 1LI5A 2MM0A 2VSOA 2BHSA 3FBGA 1KO8A 1EIZA 2AF4C 5LA6F 4AO6A 4E5KA 5C0OE 1Y5NA 2UUOA 1A9PA 4KFUA 1CUCA 1FPMA 4B4VA 1A4UA 2XB8A 1ULUA 2NU8A 1EFVA 2JDID 2WG0A 1USWA 3HJNA 2ZYWX 3QUBA 5JZOA 4LC9A 1PWZA 3AUKA 3EWSA 3U7JA 2GA9A 1JMKC 4GPBA 1T0IA 3LLCA 4GUAA 2XMRA 3E9MA 2KSQA 4HX2A 1HFEL 4PYKA 3RVLA 1PEKE 3FGZA 3SS7X 3RYIB 1XJWA 1FMJA 2NT3A 1CUBA 1XCMA 3I9FA 3M70A 3FYUB 2O7RA 2H5JA 4OO3A 4QYWA 2ZUSA 2CXPA 3AVWA 1AXRA 3NONA 4ZXFA 2KI5A 2UYGA 4YO7A 5JZBA 1WW2A 4U7DA 4DNOA 2ZQYA 1EK2A 2ZR8A 3DBVO 3UFBA 4I3GA 3IVAA 1O97C 1SPBS 1PT9A 4CCWA 3DFKA 4X3OA 4BGEA 1Z47A 1BYUA 3HZZA 3L07A 2ETVA 2PS1A 1VFNA 1XTJA 5CX1A 2PMWB 4N8DA 3S1AB 4AO8A 1A8PA 4TYNA 3A7DA 3F6PA 1SOVA 1YJBA 3G9XA 4HLUC 1SXJB 1E5VA 3HYRA 4KMSA 2V1XA 3M3PA 4TKZA 4G4GA 4KO2S 1N8TA 4BE9A 4NZMA 5FF9A 5KTRA 4AMZA 2L82A 5LZ2A 5DZSA 3SEFA 1P33A 3M6VA 3PVZA 4RK1A 2A5YB 5LBUA 4D9MA 1TVMA 4XLTA 5U4XA 1DBRA 1AKYA 1E3TA 2P4UA 1WHTB 3ZGXA 1UBOS 1I51A 1XU9A 1GUBA 2JBHA 3LY5A 3LY7A 4PLYA 2BZ1A 1TMOA 4TT8A 4X54A 2ZG6A 2QZZA 5C32A 5LQJA 2PWYA 5IASA 5A5EA 5J47A 1KE2A 2QVBA 1C0PA 4D4KA 1T43A 3GWZA 4JQYA 4N3GA 2OAEA 2X8AA 1VZ2A 4AY6A 2DUNA 1P5JA 1PW7A 1RZUA 4B0PA 1QHXA 2XMPA 1EUCB 1NVVR 2ACWA 4HWOA 4K6OA 4WNAB 3T7KA 1E2LA 3FTNA 1K63A 1CSEE 2FFHA 5CCEA 4YJGB 3JARA 5H81A 5HK9A 3EDMA 1DELA 2J41A 3JARB 3KJHA 2CT8A 1N2XA 5T8KA 4ZT6A 1ESNA 2OYRA 4ZCIA 4NBLA 1FTNA 2WPDD 3BF7A 5J5CA 3UT5B 2A5JA 3H6GA 5IRCD 1Z29A 4CQMA 2GM9A 1WL8A 2H1SA 4FD3A 4FHFA 2J48A 5JFOA 3TTUA 2Q4OA 1J6UA 1GTZA 3PHBE 3UJ6A 3VR4D 4ZVTA 1RPAA 2RK3A 5E9WA 2F4VB 3NDPA 4C3ZA 1DBWA 4MVJE 4ZAFA 5LDGA 4DC1A 3GCXA 2CHGA 5ALDA 3TN7A 2I3GA 1H66A 1WZEA 1GTMA 1JQBA 4LPSA 2FDCA 2NP7A 2QY9A 4MI9A 4WGFA 2HF8A 2DSTA 4DBLC 2GHRA 4NZNA 2GOYA 2ACKA 2R6JA 5L3QA 4OXRA 4AJ1A 4W4TA 3NALA 3Q40A 4CU2A 1V0JA 1W48A 2C42A 3ES9A 3CLRC 4ZCTA 1T91A 3MINA 5FLXA 4TMZA 2KLBA 1IEVA 1ECCA 2ZBUA 2WJPA 4H6WA 4YGYA 2QVGA 5DLQC 4LY9A 3ZD8A 4E12A 5GONB 4LIPD 5DGTA 2VLIA 3FB1A 3OFND 5DI3B 2F6RA 5KNDH 3NVAA 3I9KA 1NLUA 2VF4X 1H42A 1C8KA 1FQJA 1H65A 2WYIA 1I7NA 1OMOA 3GJYA 5FPTA 4L0DA 4D9EA 4BLPA 3ZWOA 1MOSA 3PC2A 3PIDA 1E9EA 2AG0A 1C1DA 1Z4PX 1U28A 3IUQA 3N58A 5HRCA 2JL1A 2G07A 3K1TA 4I5FA 1H2FA 1YS7A 2R6R1 3ICVA 2COEA 2DECA 4YAWA 2XT0A 1K7SN 4GBMA 4TVBA 2FUG1 1N2GA 4DBVO 1G63A 2XCIA 3SBOA 3WL6A 4FCTA 3X1XA 1QDLB 5CK5A 2C3MA 5AR1A 5H5JA 4ISCA 3FH0A 3WGYA 5KU7A 1DO2A 4WLNA 5GM2A 4AP5A 4Z4HA 1TAUA 3KQLA 4PC6A 1R6BX 4LXTA 3AF4A 3RADC 2Z4SA 3MELA 4YJGA 2C4UA 3K8QA 1DWPA 4LXUA 2BAGA 4TUYA 3FWKA 5B1HA 4PXSA 3A2KA 3LWBA 5A4FS 3D5TA 4JP1A 5LLSA 1NRWA 1ZC1A 1M2HA 1BD3A 3MD0A 2XSZA 4TVSA 4CEHB 4IKPA 3OJ0A 4IOLA 5JWHA 4I1UA 1FNSA 3VYWA 3M8KA 3CNOA 3OSUA 4FUQA 3T7IA 4MRNA 1FUYB 2BFDA 2FSUA 4LOHA 2BFCB 1YS1X 3DLPX 4HYTA 1O08A 1AGRA 3MGAA 2WILA 4A2PA 2I2CA 4OQYA 1ECPA 1J25A 3TW8A 3ZNOA 3OQPA 3VTKA 1I24A 1CHDA 3H4MA 3B6EA 2FZWA 4PYOA 2UUCB 1CP2A 4MIEA 3AP2A 3IAFA 1PVVA 1KP3A 3THXB 4M0KA 4KNVA 2C4VA 2HWWA 4J1SA 1IVNA 4WSOA 1ZJJA 1L7MA 4ZOLB 1MH9A 2FPUA 3LVFO 3SPXA 5C5EA 2OO3A 1N9ZA 5IKEA 1ZUWA 1OFGA 1T25A 3OU6A 2VTBA 4JLOA 2XYPA 4I4TA 1TZ2A 1H2WA 2BEWB 2H54A 4M2LA 4FFMA 4QTZA 4V39A 3TTYA 1WW8A 1U0RA 2XCQA 3OCXA 2BGUA 3KT6A 2UZ1B 4KFCA 2W5UA 4AZ0B 3UMSA 2DPXA 5GV8A 1Y42X 2AI1A 2MT9A 3GROA 3WLMA 3T15A 2CJXA 2VQDA 4D8UA 4MO9A 4TMWA 2CYBA 3PDWA 5TQ0A 1TEHA 4M1YA 4XGIA 3HLTA 2OTCA 3FD8A 5AW6A 2QSUA 5DYTA 3AINA 1EFRA 2QRPA 2ADFA 3CRMA 1TA0A 1JH8A 3DO5A 3F9IA 4KMRA 4L78A 3VUFA 4BJ1A 1QU2A 5K6AA 3GUZA 3EGWA 1RYMA 2X9VA 2ZYVX 4B84A 1M67A 2L2QA 3ZU5A 1DTEA 5C2JB 5FNVA 4Y7CA 2V7QD 1T0UA 3LWNA 4B74A 3D3NA 3R9IA 4R0MA 3OIDA 4ZN6A 5B58C 1UPUA 2PVPA 1AZTA 3ZJTA 2BSXA 4F6RB 3Q7QA 3R6DA 5FUVA 3TQTA 2PJZA 3ME5A 3WO1A 3TLGA 1CDZA 3OF5A 3IEMA 2WU0A 1EGHA 4CLHA 1GPAA 1YTLA 2AS0A 4LUCA 2DQ4A 3K2BA 3TNDA 2FP4A 1ONPA 3R76A 5FAKA 3FNBA 3FPJA 3UA4A 5DP2A 1HR0B 1BXGB 3WHLA 2X42A 5TC4A 4RKFA 4C4SA 1A2OA 3DDWA 4YMVA 1XVLA 4TMFA 1A5AB 2CNBA 4YMLA 3M2TA 2XWPA 3W9SA 2GYVA 5AKEA 3ZQUA 5B12A 4AZVA 1QX4A 2ZITA 4XR4A 5ELMA 1SVIA 4OBEA 3UANA 2PUFA 1ABEA 1V41E 3JALB 4U0JA 3R7WB 5DNCA 3RTAA 3Q6NA 5ICCA 3ZU6A 2NZ8A 4V0SA 3FSGA 2IYPA 1G66A 5HFJA 4MOWA 5JD6A 5F3DA 4XIYA 3A05A 2XQFA 4LW8A 3WK6A 4JC8A 1NVXQ 3L0SA 4ZAWA 3L7KA 4I8DA 4NFLA 3CUUA 4XEUA 4COOA 5LYJF 2QD3A 5E95A 3CWCA 1EDZA 1H1LB 3ZCTA 1U7DA 3Q98A 3QOWA 4FBGA 3VKWA 1K5PA 5L7YA 1Q0HA 5DW3A 2XUZA 1WSWA 4MLPA 5BN1A 4KE7A 1D2HA 3BGVA 4M8IA 2RHOA 4P80A 1DAFA 4X63A 2C1XA 1IPHA 1G5RA 4KPFC 4HZUB 3BCHA 4RA9A 4WZAE 2PAAA 4HGQA 3TUIC 2VYFA 4Z0HO 5H7XA 2GPWA 2EFEB 4OQFA 3EW7A 3V48A 4BNDB 4EP1A 4EZBA 5BVHA 2XMCA 1YJAA 5C8YF 2I6FA 2X76A 4KQXA 3QVGB 2C99A 1B93A 1ORDA 3ZY2A 3PUHA 1E4EB 3SE7A 3ZVRA 1G8KA 4J8PA 1NXWA 2A1UA 4FN4A 1BH2A 3ACCA 4LGMA 4TS9A 3FFWA 1YS2X 1ZG3A 1NR7A 4E5MA 4E88A 3HVIA 2I8LA 3NEAA 4Y7DA 2XF2A 3I9OA 2C9YA 2FAXA 2A2ZA 4G84A 1K92A 1MAHA 4OMFG 5GOZA 3LTEA 1XFAA 3OIVA 1MRSA 5K3FA 4F46A 4MCJA 1U3FA 3QPUA 2IIQA 4ZYYA 4TN1A 1RP7A 2BHRA 2FPOA 4KR7A 2K2QB 3I2YX 2XTNA 3TTSA 1SVSA 4QSMA 4F1WA 1ZGBA 4C08A 2YWJA 3PF8A 4LDQA 5LD2C 2ZPTX 5I8ZA 3SEQA 2D5AA 3FPTA 1OLUA 1ESDA 1SCAA 4HDAA 1OJ7A 4PONA 1GG9A 1QRDA 2HWUA 4LFAB 1U8TA 1AKNA 5A3JA 1E7YA 2ODEA 2A84A 2ZS8A 1E1MA 1TYCA 3NM4A 1SULA 3INGA 3MWDB 4HAWA 4IWYA 3P27A 4IY1A 4KQ6A 4CNQA 2I76A 1BS2A 3PQDA 4F6RA 1AV6A 1L3CA 5KYYA 5BQFA 1U3DA 3ZWCA 2CNDA 1A96A 1GT91 5HG0A 1TF5A 4XA8A 3VZCA 4P84A 3GVHA 4BMZA 1RW4A 3UTCA 3WGVA 5EPPA 3UHAA 1DFHA 2FB9A 2QXYA 4K8RB 4ZARA 3VPBA 1V11B 4HRVA 4O2BB 5JS2A 3U4IA 1HETA 3KPUA 2GZ2A 4JVSB 2ZUUA 4H2DA 3QPDA 1NW3A 4M53A 3GGPA 3PIIA 4PX9A 4UFNA 5F35A 1CQPA 3UUGA 1IZ8A 4HKTA 1BXRA 4IJVA 4HVLA 4G0NA 2KE5A 2EL9A 5AM2A 3X2EA 2XR1A 1GZSA 2R86A 4TLDA 3KSBC 3KDSE 2GR9A 5K8VA 3BB1A 3V1KA 4JI2B 2NXNA 1KDVA 3H0EA 3OE7A 3SX4A 3DVQX 1YIAA 4HG2A 1XG5A 4G63A 4MQEB