2PWYA

Crystal structure of a m1a58 trna methyltransferase
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
251
structure length
251
Chain Sequence
GPLLLKDRKGRAYLVFPKEGGVFHHHKGSVPHEALLEAGPGGVVRTHLGEELSVHRPTLEEYLLHMKRSATPTYPKDASAMVTLLDLAPGMRVLEAGTGSGGLTLFLARAVGEKGLVESYEARPHHLAQAERNVRAFWQVENVRFHLGKLEEAELEEAAYDGVALDLMEPWKVLEKAALALKPDRFLVAYLPNITQVLELVRAAEAHPFRLERVLEVGWREWEVRLPVAHPRFQQVGHTAFLVALRRWKGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (adenine-N(1)-)-methyltransferase
publication title Crystal Structure of Thermus thermophilus tRNA m(1)A(58) Methyltransferase and Biophysical Characterization of Its Interaction with tRNA.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 68
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature ec 2.1.1.220: tRNA (adenine(58)-N(1))-methyltransferase.
pdb deposition date 2007-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2pwyA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2pwyA02
3PLAE 1D2CA 4X63A 1RI4A 3V8VA 3M6UA 1YFLA 2P41A 1R00A 1U2ZA 2OZVA 2AOTB 2V74B 3AJDA 3ELYA 2CMGA 3HA7A 3HNRA 3R6TA 4KDRA 5E8RA 3DULA 5FHRA 3GNLA 5EOVA 1RI5A 3OE5A 2YUIA 4GUAA 4KWCA 5EMMA 3T0IA 4KIGA 4CKCA 5K0JA 2YXEA 4IWNA 3FZGA 3EEOA 3BT7A 2PXCA 3DOUA 3UJCA 4O29A 1R18A 1T43A 4X61A 4EQZA 3M33A 3FYDA 3LBYA 2ZLBA 3OCJA 4PCLA 3MHTA 4OBXA 1L9KA 4F86A 3RW9A 5DPMA 1XCLA 3FPJA 3BXOA 3KR0A 4P58A 4LG1A 1RJEA 4IV8A 5CD1A 3LDUA 4DCMA 3NVMB 3TQSA 1ZHFA 4E2YA 3K6RA 5ICGA 5CVUA 5LR6A 3UA4A 3KR9A 1KHHA 5B1SA 2Z6QA 4BLUA 3KQPA 4XUCA 3SX0A 2XVAA 3LSTA 1AV6A 1NV8A 3BKWA 4GEKA 3LCVB 2PX8A 3R3HA 5DTQA 3T7RA 4GOND 4RTPA 5IKMA 2UYOA 3MAGA 4DCGA 4ER3A 1NKVA 2Y1XA 3FPGA 2HR1A 1YF3A 2Z6UA 2PLWA 3LDGA 3P9IA 3R0QA 4GC9A 3FTCA 1JG1A 4RX1A 2ZULA 1MHTA 2O0LA 2AN5A 2H11A 3WSTA 2I6GA 1NW6A 5FCDA 1RI2A 5EMJA 1G38A 2PKWA 2GPYA 1VIDA 4HTFA 3RIEA 2IH5A 1KIAA 1EJ0A 4BP1A 3OZSA 4FP9A 2PY6A 1EQAA 1ZG3A 4A6EA 1G60A 3SSMA 3TRKA 4HTFB 4F84A 2GH1A 3E7PA 2P40A 4YUWA 5EG5A 4Y2HA 1SVUA 5JUWA 3G8AA 4P7KA 5LQNA 2GLUA 3P8ZA 2EG5A 4DMGA 1RJGA 1VBFA 1N2XA 1Q0SA 4R6WA 5FWDA 1KYZA 3DTNA 2XYVA 2E5WA 3MB5A 1R8YA 3ELDA 4CXMA 3I53A 3QOWA 5EC8A 5DXAA 3TR6A 4FGZA 2EJUA 3M4XA 5GIPE 2C7OA 4AUKA 2VDVE 4FSXA 3EVDA 3HCFA 5EEHA 3SGLA 1NW8A 3KQQA 4PYMA 2IDJA 4V0QA 3T7TA 3KQWA 4A6DA 4PGGA 3SSOA 3QOXA 4EKGA 2I9KA 1L3BA 3A25A 3KPUA 2JHPA 5LQJA 2PT9A 1BC5A 3P9CA 5DRYA 4ER5A 1JTEA 3EVCA 2OY0A 3JWGA 4DQ0A 3KPVA 1AQJA 4P7GA 3PS9A 4ER7A 5LQAA 5MHTA 2AOXA 3MQ2A 4QVGA 4LWOA 5K0NA 2I7CA 5HILA 5HZMA 2FRXA 2QM3A 2QY6A 2OKCA 2PXXA 5GINE 3P2EA 3HTXA 2ZIEA 4RVHA 4RYLA 5BXYA 1P1CA 3E05A 3FUWA 3I9FA 3NWEA 3MCZA 4E33A 1DUSA 3UJ7A 4BLWA 5HIKA 2OXTA 5KYGA 2DPMA 2UYCA 2YTZA 4YUXA 2Y1WA 3C6KA 4PCAA 4BLVA 5K09A 4AZWA 3UA3A 4GOMD 4PYLA 2PSSA 3C3YA 3C6MA 3QV2A 5K0LA 5KQSA 5DM4A 5E1BA 5K8VA 2G8NA 5FQOA 3DH0A 5E1DA 1EAMA 5FUBA 4PONA 3GRZA 2R6ZA 5CVVA 1N7JA 5EZQA 4YV1A 1F3LA 1KYWA 4M7RA 3Q7EA 4MQ4A 4DKJA 3B3JA 1ZGJA 4HH4A 1L3CA 2PGXA 4E32A 1M0EA 3NTVA 1O9HA 1P1BA 1X1DA 2ZWAA 3UJ6A 2CKDA 4LWPA 3SVZA 5ERGB 3M70A 3PB3A 5CUQA 5EMKA 3DXZA 5DSXA 3KHKA 3EVBA 4PYOA 5T6BA 3OU6A 4H0NA 2VDUE 4P7JA 3P2IA 3DMFA 3DP7A 2AOTA 2N47A 2QRVA 5HIIA 3H2BA 3TM4A 3U81A 9MHTA 2P7IA 1P39A 2B3TA 2EJTA 4GF5A 2XYQA 4PYJA 4QDJA 4R8RA 5EEGA 2FCAA 3G2MA 5K0CA 2QRVB 1YZHA 1B42A 1Q0TA 3IYLW 3O31A 2OB1A 5E1MA 4YV0A 2NP7A 2C7RA 3X0DA 4YUYA 4RSRA 2GAFA 5E9WA 1ZKDA 1EIZA 1WXWA 4IV0A 5C1IA 3HVJA 1TW2A 4ISCA 2JH8A 3HM2A 4MTLA 5DX0A 3FUVA 5E9JA 3VSEA 4C03A 4RTLA 5CCXA 3AXSA 1I4WA 3PFGA 4YUZA 3FUXA 8MHTA 4G56A 2Z6AA 3NDJA 2FK7A 3I64A 4C04A 2G72A 4QDKA 1KR5A 2NXNA 2ZIFA 3ANXA 3BWCA 5FQNA 3B5IA 3RODA 3TPZA 4C4AA 3UJAA 5E2BA 3EVFA 3P9NA 4R6XA 4C05A 3P2KA 1JG4A 1QAQA 2GA9A 3KQVA 3E8SA 1Z3CA 4PYIA 4M36A 1D2GA 3CJQA 5HOQA 5E9QA 2YXDA 4PIMA 3EPPA 3KPWA 1I9GA 3EVGA 3G2QA 4EVIA 4OBWA 4FT4A 3PVCA 4E2XA 4X41A 1ZQ9A 5ICFA 3UJ9A 3EVAA 1RI1A 2HV9A 5E2AA 2R3SA 1Y8CA 4CKEA 4PNEA 2ZZNA 4AZVA 3KQMA 3FTDA 4M37A 3AXTA 3P97A 1NW7A 3PT9A 5CIYA 3GRRA 1JQEA 2FHPA 3DMGA 5K03A 3VC2A 5DRTA 1RI3A 2AR0A 2ZVJA 5C9ZA 3TKAA 2IGTA 4PYKA 5CVEA 4AX8A 4Z2YA 3LBFA 3TLJA 1TPYA 1G6Q1 2O07A 3EVEA 1YUBA 5GIOE 3KPJA 1O9GA 1XDUA 2IFTA 3HA3A 2VS1A 2ZW9A 1MJFA 5CCBA 2H1RA 3ERCA 3HP7A 3OPNA 2FYTA 2HTEA 2ORED 2OB2A 2XYRA 3OFKA 4OX9Y 1SKMA 1P91A 1NT2A 2O06A 5FADA 2PT6A 4AZSA 2EX4A 4FS8A 10MHA 3CBGA 1NV9A 3DLCA 2G70A 3DXYA 3OFJA 3G8BA 5EIWA 3LX6A 2VDWA 2DULA 5ICCA 2HMYB 3V97A 3OZTA 1H1DA 4OA8A 3IEIA 3GGDA 5FA5A 1UFKA 3ELUA 2XVMA 2NXCA 3NDIA 4FSDA 5LQUA 1OR8A 1EJ6A 1L1EA 3G88A 3TMAA 3G7UA 5DTRA 3IHTA 5DX8A 1INLA 4EK9A 4OQDA 2OBFA 2YX1A 3SSNA 5U4XA 5GM1A 1KPHA 3SM3A 3FRIA 2YXLA 5EHGA 4ER0A 5D1HA 4ATNA 2AN4A 1X1CA 2WK1A 3P71T 5FHQA 2IDKA 4HG2A 5F2NA 3LL7A 5DTMA 3E23A 3MERA 4FZVA 2BM8A 2JG3A 2PXAA 3GCZA 4PINA 4F85A 3THSA 1VLMA 3GRYA 5F2KA 3TKYA 5P8WA 5E1OA 4RWZA 5GP1A 4YV2A 1FP1D 1R6AA 2BR3A 4RV9A 3CC8A 1VQ1A 4R05A 2GB4A 3NW9A 4LECA 3PX2A 4EKIA 1WG8A 3KU1A 2O57A 4XUEA 4ZTBA 3FUTA 5EQJB 1O54A 3NWBA 4M38A 3GJYA 2P3QA 3NMUF 3TM5A 3KQYA 5DX1A 5F2OA 1YZ3A 3LKZA 1AQIA 4KVZA 3THRA 2ERCA 2NXEA 3UJDA 1JQ3A 3MGGA 3EMDA 4RTNA 3EGVA 3CKKA 1SQFA 1R74A 1DCTA 1D2HA 3TOSA 3LECA 4RTRA 1FJXA 2PX2A 4QTTB 3FRHA 1M6YA 2LD4A 5LQRA 2OO3A 4E70A 3O7WA 2A14A 3PTAA 1SQGA 1XJ5A 1PJZA 4CWAA 1JR4A 2ZBRA 3MTEA 5DM1A 2C7QA 3FTEA 1AF7A 3A27A 3G5LA 3DMHA 4U7PB 4X60A 3F4KA 4JXJA 5EPEA 5HEKA 4E31A 1XDSA 2P3OA 3ER8A 2V7EA 5GWXA 4DA4A 4HRAA 2IBTA 1XXLA 3BWMA 1VP3A 4QQNA 2JJQA 4U7TB 1UIRA 3BGDA 3SMQA 4HGZA 5DT2A 1QYRA 5KS2A 3HA5A 3UWPA 1WY7A 2YR0A 5EGSA 3DXXA 2AS0A 5HIJA 3KR2A 4L7VA 1TW3A 2HWKA 3HVIA 5EZSA 3HCBA 2WA1A 3C0KA 4GQBA 2PV0A 1IY9A 5DM2A 3BWYA 4E30A 2I62A 5DXJA 3HVKA 1QAOA 1V39A 3S68A 1VL5A 2PWYA 3B3GA 3G5TA 3PX3A 5JR3A 4KIFA 1XCJA 5GOZA 5K0GA 1VPTA 2PJDA 3Q87B 4PGHA 5HFJA 4BP3A 2GS9A 1SG9A 2K4MA 5GM2A 5KQRA 2ONYA 1RJFA 3MTIA 3BUSA 3MCTA 4KDCA 4QPPA 4UOEA 1ORIA 1JTFA 4QPNA 2ZZMA 2B9EA 2P7HA 5DM0A 4QVKA 4XUDA 3KQTA 3BKXA 4XCXA 5IH3A 1KP9A 2EFJA 1JQDA 1M6EX 1X19A 3GRVA 3UFBA 4POOA 5K0BA 1HNNA 2UZ4A 4HGYA 4C06A 3LKDA 4V0RA 1I1NA 3HVHA 2ESRA 3LCCA 3KKZA 3KPYA 5DLYA 3ID6C 5FA8A 4E2WA 4OQEA 2Q41A 1X1BA 3BGIA 4PIPA 3JWIA 4MIKA 1BKYA 2KW5A 2JHCA 3BZBA 4GC5A 3BWBA 5G02A 1VP9A 1YFJA 3L8DA 3I5UA 3REOA 1XDZA 2G1PA 2NXJA 1NBIA 3DLIA 4PYNA 3CCFA 5FWAA 5T67A 1NE2A 2BM9A 2IH4A 2FK8A 3P9KA 3M6VA 5CVDA 3G2PA 2CMHA 2UYHA 4DF3A 5EMLA 2PVCA 5K0EA 4GBED 3A4TA 3KQSA 1ZGAA 3EMBA 3OZRA 4K6MA 2IH2A 2BR5A 2VP3A 3JWHA 5K01A 2BR4A 2ADMA 3FYCA 1G8SA 1FP2A 2IP2A 4FR0A 5DSTA 3EGEA 3HEMA 5T64A 3TFWA 3EEYA 4WVLA 4CTJA 4MWZA 2ZBPA 2NYUA 5EIFA 1FPQA 4WXHA 1HMYA 1YB2A 3IV6A 1XTPA 1KXZA 1X1AA 5FTWA 1BHJA 5CM2Z 3KQOA 1XVAA 3SXJA 1SUSA 3GO4A 5ICEA 3FPFA 3R9XB 2B2CA 2HNKA 2B25A 4RVGA 4CTKA 3GIWA 1FBNA 4RTMA 2YVLA 4RVFA 4QQKA 2B78A 1JG3A 4DZRA 1JSXA 3C3PA 3CVOA 5LQCA 3BGVA 4FT2A 2NP6A 2PBFA 3CJRA 2YQZA 3M6WA 5EKXA 2ZSUA 3SR4A 1RJDA 1WZNA 2CWWA 2PWPA 1F38A 4NECA 4X1OA 2BZGA 4R8SA 5EVJA 3OU7A 5HIMA 3LHDA 3B3FA 3D2LA 1G55A 1R8XA 1QANA 4YMGA 5H02A 2ZFUA 2ZZKA 2BH2A 3LDFA 3OU2A 2C7PA 2AOVA 4MHTA 1QZZA 2ZBQA 5M5BA 3ELWA 2AOUA 3PFHA 4KW7A 3VYWA 1NBHA 5LSAA 3A7EA 4BY9E 1VE3A 2FPOA 3HCEA 2ZCJA 2ZWVA 2P8JA 2PX5A 1BOOA 4OA5A 2P35A 1UWVA 2AVNA 2AOUB 3GRUA 3HCCA 5DWQA 1JSZA 1JG2A 3G2OA 3ORHA 3I58A 4C08A 3GDHA 2IIPA 2VZ9A 2ZIGA 3ER9A 3EVZA 5BW4A 4YMHA 4ER6A 2OYRA 5BW5A 2IPXA 4RTKA 3LPMA 2JH9A 3AY0A 3GWZA 1G8AA 5K05A 1ORHA 3FTFA 1EG2A 1N7IA 1NW5A 3FPEA 3ME5A 3DR5A 3UBTA 1QAMA 3JWJA 3HCAA 3KR1A 4GOLD 3OE4A 3UJ8A 4IKPA 5K0FA 3LCUA 3VC1A 2QE6A 3A26A 3K0BA 3EGIA 1NW3A 5E8JA 2WA2A 1SUIA 1KPIA 4GOOD 4PYQA 4QTUB 2AVDA 2XBMA 5LQKA 1IM8A 4B17A 7MHTA 2ZTHA 3LGAA 2AZTA 2P3LA 1IXKA 3CJTA 3UZUA 2IBSA 4YUVA 1L3IA 4HC4A 4HSGA 3R24A 4DM3A 5KVAA 3FPHA 2G71A 2PX4A 3HCDA 2UYQA 4PWYA 3NVKI 4C07A 4E2ZA 1PRYA 3M6XA 5CVJA 2JHAA 3B7PA 3B89A 3CGGA 4RVDA 4Y30A 5EHIA 3GU3A 1WS6A 2P1DA 3GXOA 4AZTA 4CKBA 2ONZA 2OPBA 3O4FA 5C0OE 4RTSA 2CL5A 3UJBA 2QYOA 5EKUA 2NNWB 3NJRA 2H00A 4RTQA 4RTOA 4EMSA 3A7DA 3G89A 4P7FA 2O05A 5FULA 1KPGA 5BP7A 3DUWA 2AN3A 5D1NA 2AOWA 4RTJA 2F8LA 3FUUA 3AWIA 4KRGA 3T7SA 1DL5A 1WXXA
chains in the Genus database with same CATH superfamily
1RBZA 2TECE 2VH2A 2XUPA 3OM8A 1E59A 4JUIA 4JI5B 3D5TA 4EKDA 4G89A 3C70A 1CULC 3HGTA 2C5LA 1X7DA 2YHIA 4L0MA 1YRBA 2V74B 3C3BA 2CMGA 1IDN1 5LMNB 3G9QA 1YU9A 3GNLA 4CM3A 2QVBA 2YUIA 5TEVA 3BDIA 1BQEA 1YB7A 4INAA 2WFMA 2VP9A 4O59O 4CLOA 4O4JF 5I4CA 4JOBA 4WEQA 3L79A 3MTGA 1WR8A 3IERA 4ZARA 3C14C 3ZHYA 4PCLA 2B82A 2WWIA 1YXMA 4DUGD 3RNOA 3QELB 3W5UA 1W88A 1YJQA 3VBCA 4FFSA 5ADVA 1JS1X 1EPUA 1BW9A 1HR0B 1IOVA 2P5UA 3JQ7A 2XZOA 2XZLA 4LF4B 5CB0A 2QQSA 1CJSA 4G97A 5TT0A 5K2MA 5LKRA 3V1LA 3E1KA 2XCRB 2JC3A 4H1TA 3SIWA 3B60A 1CZNA 4M0CA 4D9EA 3NGXA 1LBTA 2V0NA 2QG6A 1U0RA 2XVAA 4L57A 4NU6A 2QMYA 4XUCA 2OQVA 3UQYS 4BC1A 3C43A 2BMDA 4QBGB 5B7GA 2I1VB 5H3CA 1WXHA 1DC4A 3HL0A 3H8WA 4Q1BA 2OCAA 3PWTA 2QZZA 2BN4A 5FWXA 1X7GA 1Q0RA 3N2KB 2H2IA 3ZCSA 1MTOA 2MWMA 2H1LA 3VKFA 5DYNA 1Q1AA 2WJGA 5REQB 2G83A 3DJFA 4M9QA 4TPKA 4BJHB 2VPXA 3WO0A 2C99A 4TV8A 4ZU6X 3A0UA 5HIAA 1RRFA 4BNGA 2HDOA 1OVGA 4EGFA 2QTGA 1GGFA 4NV3A 1B7GO 4WN9B 3WYBA 3ZDXB 4Z3OA 1PZGA 4XFKA 3UW3A 2BE7A 1CIJA 2Y6VA 3EH2A 3K1YA 4P54A 4BRUA 4RM2A 4J6EA 1HX7A 3BFPA 2IH5A 3KE9A 5EQDA 1PG2A 3HRHA 1E2JA 4AJPA 2V7BA 2XZDA 3PXUA 4A6EA 3CVYA 3W77A 5BV8A 3GZNA 3KZVA 1MJ5A 1CYDA 5LIPA 3NLLA 3TR5A 1HT1E 2CL0X 2IX9A 2RHJA 3FYUB 3V46A 2BOVA 2PSFA 1G2IA 2ZJ1A 3T34A 3KO8A 4G25A 4QUDA 3TLBA 5JBNA 1E92A 2NU7B 5FLKA 1MIHA 1TADA 1QMPA 5GV7A 1I51A 1SCJA 5A3VA 1JFTA 4RH3A 3SHQA 4J9VA 4RKEA 2WD8A 2QTLA 3RBVA 2VCHA 4FYMA 2ZCUA 4HQOA 1NWHA 3U7QA 3TVYA 2BTQA 1VCNA 1X7WB 1WE2A 2D00A 2LXNA 4LXUA 4REOA 1XQXA 5K4AA 3I42A 2H2HA 3AKYA 4PGGA 1WMDA 3QXSA 4JHLA 4GYYA 4JYPA 4CLRB 2YRWA 5LLDA 1N32B 5LMUB 4RDXA 3NHPA 2YOFA 4E12A 4DQ0A 1KDYA 3V1UA 4BFYA 1SZPA 4GP9A 3UKJA 3U44A 2D2FA 3L6EA 1CUHA 2O1EA 5JASA 1H85A 1Z2OX 4NP6A 3IMEA 1DIGA 3F90A 2IL1A 4LRQA 4AULA 4B3FX 4RYLA 1QG2A 4LX0A 5K6AC 3VGPA 1F2TB 4OJYA 2AKAB 4G8CA 5KC8A 4F5EA 4EEKA 4R2WA 5CFRA 4B46A 2X9NA 3H75A 3BJZA 2I5PO 5ALGA 3UJHA 3UMBA 4YUXA 4PCAA 2YDYA 1U8FO 3IIJA 3LQQA 1LJLA 2CDRA 4LVUA 3RPEA 5LB4A 2W2LD 4X44A 4PN3A 4JGBA 1NM5A 4JJ4A 1OOEA 4CUKA 5HFNA 4LYJA 3FPAA 1MMFB 1SVOA 1YS7A 2IQ5A 1NIJA 1P44A 3GRZA 3N53A 1G21A 3ZE0B 1WL8A 1UOQA 1E3IA 1L1RA 1E5XA 5JWRA 3FA2A 5IK2A 4BDTA 1O9HA 1H8HD 1DO8A 1WTAA 2LRHA 3UJ6A 2C3UA 5KTMA 4JI8B 1HDGO 2MYPA 3PB3A 5SZKB 2GD6A 2QUHA 1VJ5A 2A2ZA 2XD4A 3P96A 5FP0A 4D7AA 5GONA 1C1XB 1ZGCA 3C6QA 3RROA 1ZOPA 7MDHA 3VR5D 2IE0A 3E9YA 3VVMA 2VCEA 3N6XA 3L1VA 2DFPA 2P2NA 4GO1A 1TYEB 3IE2A 1EZZA 4KQFA 2BKLA 3L7JA 4LHVA 2Z1MA 5EEGA 3U3MA 5JRDS 1E4EA 2X7JA 3THXB 4G0MA 4OJNA 2O0MA 2ANCA 1ULAA 2R8BA 3CXUA 3E9QA 3S2ZA 2HAEA 3DYIA 4YAKA 4G4GA 3IGFA 4HDOB 4NH0A 5CNMA 4CKYA 4ZK6A 1NLFA 3FUVA 1DJOA 4PU0A 1YVUA 4XSGA 3NC0C 4KE8A 1FVHA 3KB2A 4V38A 1SOUA 2DUWA 3UUEA 2W70A 1GDTA 5DE3A 5KDLA 1T8WA 1YR1A 2R2AA 3DVAB 4HNQA 2BM0A 2H06A 1JAHA 2QU7A 1YR6A 1NMZA 3H8VA 5DM60 1MCZA 2FEAA 3D4NA 3QLVA 4PEVA 1UWLA 2BUCA 5LQSA 1BROA 1FK8A 2YS6A 4CF7A 4OHKA 1UODA 2F43A 4KGVA 4KDIA 1KO7A 3X1WA 3KEGA 2Z5FA 3PGKA 1CZ5A 1BMQA 3PNKA 3LW7A 4UBJA 1CUEA 2W6JD 4F91B 4ARBA 3D6VA 4EVIA 4K2HA 3GBSA 4G5OA 3DS8A 2XT9A 3BGOS 3JVUA 3K30A 2PUTA 4O1IA 1P60A 3WKAA 3LY8A 4E14A 3L49A 1ZK1A 1NAHA 1YDEA 3GL9A 1QJ4A 4TMWA 4NFLA 2V8OA 5SYMA 1XDWA 1L7RA 3MBKA 5EESA 2R8EA 4M7PA 1FYEA 1RI3A 1YS9A 3K1TA 1ODIA 3IX7A 3MWLA 4G5SA 3H5AA 2QYTA 2WD7B 5CA1F 2ZRBA 4E07A 3EZ2A 1W2WB 3BQMB 4OFXA 3QLTA 4BEWA 3QKSB 1ZIXA 4E51A 5GZ1A 2CV0A 2CN1A 3E4DA 4BVFA 2B1QA 1R66A 3HA3A 3DFIA 4ALJA 2FG7C 4YMVA 2VS1A 9ABPA 3COSA 2OHIA 2DFVA 1N3LA 3RUAA 1U8ZA 3KYIB 3BXFA 1YI8A 5I8ZA 4H7DA 1SVMA 2IZ1A 3GGOA 4MWCA 2RH9B 3OKPA 1COZA 4B2PA 1RAIA 3RC8A 1HSOA 4QXQA 2EJWA 2JJ2A 3O1JC 4NY1A 1GTMA 1H1DA 2BFAA 3NEAA 3IDFA 3NI2A 3WGYA 3HR4A 1UMCB 2VJNA 1QIIA 3RWBA 1WA5A 3DEIA 3O95A 4B3MB 1RRKA 3KB8A 2P65A 2WJVA 3HR8A 2A5DA 1U0SY 4MJ7A 5D6NA 2J59A 4YRGA 1INLA 1P4AA 4NFHA 4N03A 3SSNA 5BN4B 5K8CA 4TN1A 5KKCA 3BULA 1E5QA 3OCVA 3P4YA 5TNXA 1TZMA 5AHKA 3WYEA 4DHEA 1HOTA 1T24A 2GYVA 3I2JA 1RKBA 1XCMA 2J5KA 3TLEA 2FEMA 3G1TA 3STHA 1MOPA 2CZCA 2EKLA 1F1JA 2LE0A 3CLSC 4LDQA 4M9SA 3RWMB 1P1IA 2I4OA 3CX8A 3ZC3A 4XIIA 2AT1A 1U28C 3HN6A 1CEYA 2PUWA 5GAJA 4M9RA 4GMKA 2FFBA 4GH5A 1YQQA 1W6RA 1NE7A 3ZDZB 3NW9A 2P6NA 2JLVA 2B8TA 2PUHA 4F46A 1D7OA 1N2CA 3GA0A 2F9LA 3Q9UA 2RI0A 3B2QA 4OXYA 2C57A 4IJQA 1IWBB 1K7XB 4HN9A 1CF2O 4CMAA 4YRNA 4MUXA 1VOTA 3IBGA 3AIMA 3LKZA 3FAKA 3WGOA 1RYMA 3QFTA 1YAHA 2EIXA 4LDPA 5HX7A 3AZPA 1VCOA 4B80A 3I72A 3GMTA 4OYLA 2G36A 4E3ZA 5DM70 1OXSC 3E81A 4C4XA 3IB6A 4YDHB 5JWHA 1AHNA 1KJ8A 4FE7A 2X8AA 2O2DA 3H17A 1X87A 3RABA 3CO0S 4CF3A 4JZYA 3UWMA 2HN9A 1E1QA 3AL2A 3I9LA 3IEMA 3NO4A 5B3LA 5HRAA 4BNHA 2WOOA 4EHNA 1VECA 2C0QA 3A27A 4RV4A 3L7CA 3WHKA 1TJPB 3V48A 2IS4A 1DAOA 2CHGA 3WNDA 2NUAA 3I9JA 3IAFA 2HIGA 3QP9A 4KAJA 2DJ5A 4TKMA 3Q72A 4AROA 5EKTA 4FFOA 1J5XA 1GGMA 1P81A 1XD2A 2FPKA 4FJ0A 1MJNA 2HWKA 1ONOA 3QEMB 3C1TA 3BCSA 1BU8A 3L5KA 3MWGA 5E7IA 3TVDA 2GLTA 2FEKA 1OE0A 2GEJA 2YYYA 3Q7SA 1IWPB 4WKBA 3ROKA 4G3XA 3ZY6A 4MV4A 2X0NA 2FLVA 2XA1A 3C8UA 4X93A 4UBIA 3AMVA 1SIUA 2X6TA 3ISVA 1EGMB 4A0RA 4Q00A 3FN4A 3PU6A 4ESHA 1SRRA 4YXWD 6CHYA 3LCMA 1PU2A 4QYIA 3F96A 2P7HA 4DB2A 3OEED 1HUQA 3P2OA 2CK3D 5C51B 2HADA 1SBIA 1RXSA 3Q7RA 4GZMA 4G26A 1S2OA 4HLNA 4ZOBA 3Q6NA 1KP9A 5F4ZA 2IKQA 2SHKA 3NCTA 2A86A 4KQMA 2E4YA 3ZBUA 2OPHA 5K6RA 1O96B 3IL2A 2QRZA 1AKMA 5BR4A 4OQFA 4KLNA 3DO5A 1F0PA 2Q1CX 5L3SA 2D3TA 1JZTA 4WK4B 3MFYA 2XNJA 5IBQA 1K0FA 4DV7B 1I3OA 1FUIA 1U0HC 3JWIA 3FCEA 4B4DA 2FSSA 4CUJA 5A7FA 1R7RA 4UE3S 1G8HA 2QZJA 4EA6A 1F2UB 3KSUA 3MTDA 1TYCA 1J5PA 2PV7A 1W4RA 3JAWA 4OCZA 2A5LA 2DHDA 4RD1A 4CN9A 4Z7JA 5B6IA 3BTVA 4WUVA 3WK7A 2XDYA 1Q92A 3BXEA 1I13A 1KEZA 5LQNA 4C87A 1NQOA 1WIWA 1GTVA 5FB3A 2AG1A 2GBGA 2JAQA 4BY9E 5ARDA 1DKPA 1BTOA 2J30A 3E1GA 4KNWA 2DJIA 3N74A 5EZYA 3TXYA 4GPZA 4Q3OA 3VYUB 3L7DA 3ZKAA 5B1EA 4BNFA 1MFZA 2Q5IA 2G77B 2Y05A 2TMKA 3H1TA 4MOWA 4L5IA 3F3MA 5EIFA 1L4EA 2UZ1A 4GWGA 4Z6KA 1K7YA 1UFOA 2B5VA 1OXXK 2VUTA 4INPA 5H0IA 1PWXA 2CLCX 1XVAA 4HAWA 2D62A 3JY6A 3PGMA 4JP5A 4L4XA 3KFVA 1WULS 1K75A 3CM0A 3OOJA 5E3HA 4K46A 2YBEA 1NU8A 4LOIA 2YVLA 3X43A 2OGSA 4Q1CA 1R0ZA 3WR5A 4XOIA 4NYIR 5DT9A 4C22A 1TCBA 4GNKA 3D8SA 1DTEA 1MTZA 2V5AA 3UHAA 3CJRA 1A2QA 5BN3B 1OFGA 4UREA 4EAQA 2O8BB 1YBHA 5HKKA 1XTSA 1G5IA 2XMCA 1NXQA 4H7EA 3PENA 1PS0A 5EP2A 1T9HA 2IYPA 2JGFA 5BR7A 4L4SA 4N1AA 3RJ9A 2YFQA 3E7DA 2KHZA 4UTPA 3D7NA 2OGTA 4IEFB 4ZQHA 2LVBA 2WNHA 3E3AA 4QHSA 3L2OB 2XMDA 3PFHA 1L6RA 1Y6RA 2OVBA 3JQAA 5DJ5A 5ALOA 4CU2A 5K7SA 1WOYA 1G9XA 4R31A 1FYWA 5JMPA 4CKZA 3L1HA 1GV1A 3SZRA 3ZW9A 4N6GA 1UWVA 4QPJC 4DEYA 5B5SA 3U6BA 2G5PA 4ZVSA 3UV6A 2O2HA 4ZO6A 3GDHA 5BUZA 1LPMA 3AEUA 3ZHUA 2I71A 5H83A 2NZWA 4PS0A 4F9TA 1YO6A 1QHNA 1VJDA 3NOOA 1P5FA 3EXHA 3OE7D 2CFTA 3SX2A 3DONA 4G0NA 3VXKA 2DYKA 5DI9A 1TKRA 1IQRA 3L4BC 3F0TA 1TF2A 1AE1A 4I4TF 2IOYA 1L5NA 3U3RA 1FQOA 4B71A 2ZI5A 1FS5A 2A0WA 1UP7A 3R5TA 3LFUA 4JYMA 3EGIA 1OT5A 1VL1A 2CVHA 4ZVOA 1E6UA 4M1WA 3HYCA 3KZXA 4B17A 2G5GX 5ALWA 4Q9JA 5JVDF 1U1FA 1J25A 3X1MA 5ALDA 2PRJA 3COVA 4DUZB 1KA9H 2V96A 3L6OO 3RS5A 3PUJA 3NJ4A 4WBSA 1GFZA 2ZWMA 4CW7A 4GMGA 3WK5A 3ZHQA 2OAP1 1RHKA 3P4XA 4QUJA 3W79A 3BSFA 1OKKD 1R5JA 5IDXA 4HUQB 4XKJA 4BO5A 4NCBA 3L1IA 1V95A 4ACAA 2ZSKA 3F3KA 1JFFB 4E22A 3HR7A 5AKLA 4Q9NA 3ZDYB 4Z2AA 3EXIA 5JY1A 3IFSA 4XZ3A 3RIYA 1XDBA 3W5SA 2I67A 7REQB 1VJCA 3BE5A 5BWOA 2QYOA 3WYCA 3KKOA 1Q6ZA 3P9QA 3BZUA 5A62A 2Q62A 2M98A 1QRRA 4GS5A 3EBPA 1Y3IA 5FNZA 2NPFA 3FB1A 4OBBA 4JJ7A 4XH9B 3FROA 1XLTC 1MT0A 4GYKA 4P82A 4ZJYA 3AWIA 4A1OA 2V7VA 3K4HA 2BFWA 4KRGA 5AKYA 2VJCA 4M1MA 1I80A 4I19A 2QGFA 4JQSA 4U3JB 3VPBA 621PA 1JQAA 3M6UA 2NO4A 4B83A 2NO0A 5ITZB 1XMJA 1IQ0A 4OHRA 2ZRAA 4ENQA 2PUBA 3O4JA 5DK6A 4FGWA 1JXAA 2YHSA 1RR6A 4ZEMA 4WKCA 2R0QC 5EMMA 3SBDA 5IUKC 3TR0A 4DBLC 2R8ZA 2G6TA 3O03A 3I92A 4EJSB 2E9SA 4R4JA 1BS9A 3D5QA 1C8KA 2E87A 1T8TA 4KBYA 5JI2E 2Q1SA 4DILA 3JYOA 3KV1A 3TIGA 3W5BA 4RLQA 3VHLB 4QWWA 1XP8A 2VPIA 4LA4A 3L4EA 4BQRA 1VPVA 5CBPB 1Z13A 2H5EA 4M9CA 1X8LA 4FXPA 4N8DA 1P2FA 3IO5A 4C0JA 3JRNA 2EGHA 1RE0A 2GM5A 3BD7A 3ECSA 3LRPA 4LSZA 5F1KA 3STTA 3ZUPA 1EFLA 3P19A 5LR6A 2JRLA 2PRYA 5DCWA 1VL0A 3LPDA 4ZTUB 3UA4A 1P5RA 4R9SA 2I0FA 3UWKA 2ZWIA 4W4TA 3SX0A 4YRKA 5TQ2A 3W3AH 1M0TA 2V1XA 1JZSA 1NV8A 1A9ZA 4FYXA 4RVSA 3BH7A 1BS1A 4HAUA 1VMDA 1XZPA 2NZUG 3FSGD 5DB4A 3UXMA 1PKXA 1L7BA 3Q1LA 3U7RA 2WMYA 4TKZA 1R5BA 3K6SA 4G4JA 4KXYA 2GJKA 3ACDA 1PLKA 1K8QA 3K8YA 2ZULA 3QPDA 3PP8A 1VLQA 5JE8A 2HCRA 3DMPA 3NHRA 5CXXA 3PR3A 1J0DA 2JGDA 1BH2A 2GDJA 2WJHA 4URUR 2AFHB 1VB3A 4M2LA 4RD3A 4YVFA 1HFWA 3ZGLA 4D6PA 4R8MA 5ERXA 1OXMA 2TYSB 3K0CC 1KVSA 2OP1A 2GN0A 2B69A 5T57A 2QXTA 4YIKA 2W90A 5JUWA 1R5NA 3I73A 1HDYA 2C92A 3A1FA 4G09A 4DMGA 4EF6A 2X2PA 1XZGA 2YBDA 4O2BB 3X1XA 3F1KA 3M0EA 3FWYA 4MUEA 2Q5QA 4OXNA 3QFSA 4NV1A 3ZY5A 1EDZA 4FBGA 4JGGA 1NQUA 2HEIA 5FBQB 3HXLA 1K6EA 4COOA 5EC8A 5DXAA 1V25A 1JQ5A 1U1IA 3WMGA 4WE3A 3CTMA 2RB5A 4EY8A 4MPTA 4YA6A 3B5JA 1Z6AA 1K89A 3FOAA 4KO8A 3A1TA 4TTVA 4XPZA 2PMCA 4W7IA 2VAMA 4JJIA 2VHUA 5LZ4A 2IDJA 2VYVD 2EZUA 3MBOA 3Q3CA 3C41J 4YMWA 5A3QA 5BVHA 2PM8A 5JI3E 3IVAA 1TTHA 4PX3A 4WQMA 1AV7A 2PT9A 3TTWA 2QLJA 1D0VA 3P0JA 3A6ZA 3CH4B 1ULBA 4XGQA 3W8DA 1N3YA 4PLFA 4YDRA 3TW8B 1AS3A 2O8DA 1RM0A 4YLYA 3ONWA 3FLBA 3SDSA 3RVRA 4S04A 3T9FA 3TQCA 5FIUA 1JHXA 1U6KA 2V7QA 3GBVA 3ANNA 3R44A 4HUJA 3UOAB 1LK5A 2P5TB 1G17A 5HGJA 2OHHA 1DUSA 3CH6A 2VWQA 3DMNA 1YH3A 3A6GA 4GPBA 4C0HA 4DSOA 5INTA 4PIVA 1CP3A 2JFPA 2ZDQA 4AUEA 2HNBA 8ATCA 3MLEA 3DEZA 3MF4A 3UK7A 1V41E 5KSYA 2KLHA 4Y0AA 3Q5DA 1CR1A 4ZDKA 2HUNA 2R79A 2QVGA 5C1BA 5EZQA 1KYWA 4MWSA 3SXUB 3KSBC 3OY7A 3TAXA 1SULA 2KSQA 3AFIA 3KTAA 3MMZA 1XJWA 2B4YA 3OC6A 3TOXA 2X3UA 3UMCA 4P98A 1RC0A 2WHQA 4P32A 2B34A 1DIBA 1FYVA 3SVZA 2DX7A 5ALTA 4EM6A 4F6CA 3S8YA 4C7OB 4JB3A 4IJMA 2QJWA 5DHSA 2ZPTX 4RIIA 4X3OA 1NNSA 4MKHA 1WZUA 5HIIA 1YR7A 5GV8A 2BGMA 2N47A 3GLUA 1KRWA 1I30A 3NXSA 3GLSA 2ZI3A 1EDOA 3G2MA 2V6BA 4A0HA 3BSWA 4ASUD 4CQLB 1VBNA 2DH6A 4K6OA 4ZT6A 4ZDJA 1E8DA 1RWVA 4IM7A 3C2QA 3VSCA 1IBMB 2V7UA 1CUCA 1ESZA 2JCVA 3RFFA 2FUKA 1WXWA 2W4IA 3N86A 3P0FA 2RAVA 3BAFA 4J2TA 4DLXA 1ZIDA 3KVRA 1HY3A 2R4UA 1WDWB 3ILYA 1P18A 1MLDA 1GADO 1V3QE 5L8VA 2LCIA 4AO6A 3ZG6A 2PMDA 4JLKA 3JW8A 4UKDA 3TZQA 1AVTA 4P3PA 1L5HA 1CRQA 1W6UA 4FFNA 4MW5A 1W49A 2O7SA 1U9JA 1XNGA 2FWRA 4N7RA 3K6JA 4GHWA 1KDVA 1V16B 3TTXA 1QAQA 4QPZA 2WAXA 4ND6A 1JYEA 3H11B 3E8SA 3STUA 1UEIA 1V6AA 5B12A 3ENKA 4LYEA 4S0ZA 2ACEA 1NXWA 3CJQA 4FMDB 2NVUB 1OXTA 3Q9NA 1TD9A 2MINB 3PPVA 1U0BB 1PKEA 2F62A 2PA3A 1KQNA 3PVCA 2WLTA 4HDSB 2AI3A 2AE1A 3UMYA 3EVAA 3V7YA 4AIRA 3VU9A 3PWKA 5DNDA 2BMVA 3AR8A 1ODFA 3HUDA 1QCYA 1Z0AA 3DVLA 4YONB 1QOQB 3FTDA 3HKBA 5HOEA 1NW7A 4A16A 1R12A 2YHBA 1M1UA 4CEJB 1YZVA 3FWHA 4KDFA 2MSWA 1BXRA 4TSRA 3CWZA 3LBFA 4A2PA 1X7ZB 1RSZA 2JGNA 2YC2C 1KP2A 3LUKA 4FDAA 5CLGA 2HQBA 5AQ1A 1KQOA 5CBKA 4OGWA 4CU5A 1ZOLA 2XB4A 5KQMA 4J0QA 1MT3A 4W5RA 3AKEA 1ZJZA 3OPNA 5JD4A 1L5MA 3VFDA 1R0CA 1CY6A 3VU1A 1J9ZA 5IEBA 2VAPA 1M74A 3IXQA 4BE9A 2VK4A 1O6BA 2EX4A 1XVTA 4DJDC 4DOMA 2H29A 5I4IA 2GF9A 5ICCA 4GIBA 4BGVA 5AJTA 2VRNA 4Q7MB 3CUVA 1M7BA 3UH1A 4ETMA 1D1QA 3WGTA 4Z9YA 3QFFA 2NADA 4A73A 4KXXA 4EB6B 5JCOC 3GLFB 2ZGVA 1KIMA 1M8FA 3D2AA 4NZMA 2P0AA 5BQOA 4MWGA 1GHTA 4FGUA 1XJ0A 4BQFA 1W4AA 1SK8A 4AW9A 1DX9A 2O3JA 1CP2A 1GIAA 1L4KA 4F72A 1TMYA 2XKBA 1MX3A 3H5WA 3HEAA 1GLNA 1RQ2A 2XYPA 1ZN9A 5LDGA 3LT5A 4KWTA 2H1VA 2NVWA 4HR7A 4AJHA 4NMHA 1DTWB 2AN4A 4MW0A 2GEVA 3AJ8A 4ZVLA 4FMCB 1YK1A 5THKA 3MJ4A 3BHNA 1G42A 3NHSA 2UZAA 2QIOA 3G9TA 5ALNA 2ZATA 3GCZA 2IC5A 3OCZA 1MP0A 4Q1DA 4HB2A 5KSPA 3C1UA 2JFHA 4X5OA 4RYDA 4MW6A 2O8CB 4PBSA 5GP1A 4PHTA 1SHTX 5ITWA 1SZJG 3QLJA 3L41A 4MIYA 3UMSA 5CA0A 3GJRA 4A3SA 1AZTA 1CEQA 2GB4A 4N8EA 5AESA 4MQEA 3ZD7A 4JJFA 3Q3VA 5DBFA 1QIEA 3GT7A 5CIWA 4CV2A 3FUTA 3KOUA 2FUG6 1O54A 3PNLA 1CY7A 1Z5WA 4D8XA 1O8CA 2VQFB 2X15A 3BD9A 1P62B 1PR4A 1X9IA 2QNRA 3KYDB 2ERCA 1PS8A 1X38A 1M0WA 1Z56C 1OD6A 1NYRA 1JV2B 3ENWA 4MRMB 1EM8A 4ND3A 3HU1A 4G85A 1GVNB 5I8PA 4RTRA 2PX2A 3W90A 4KYUA 4IJWA 1WRBA 3I6QA 1E98A 1JBEA 1WD7A 2GO7A 2PLAA 1ADYA 2X0IA 1DRWA 3GDOA 3CR3C 3V34A 3VUFA 3STXA 1N0VC 2FLKA 2ZJBA 3H13A 1KSJA 1DU4A 3MTEA 1QZTA 4QUGA 3WKCA 1MFPA 3HY4A 1ZD4A 5LZ7A 4FM9A 3G5LA 4MI6A 3LXMA 2EHDA 4IJUA 4BFVA 2P3OA 3UT5A 4UVGA 3L8YA 3D3EA 1VP3A 4TVBA 1OIWA 4KVGA 1L5WA 3C3EA 2C2WA 5DT2A 4AT1A 2B1GA 4D9JA 5ECYA 1HL7A 2P4HX 1HDEA 4GPEA 1NU6A 3ZCRA 3GPCA 3UK6A 1PNRA 3DDZX 1ZZGA 3N58A 4AP6A 5THXA 3C0KA 5J23A 1UMDB 4GQBA 1IY9A 1KZGB 3N2LA 4EG3A 1EUZA 2LP4Y 2ISCA 4IQ0A 4QHTA 1KFKB 1RZRD 1EUQA 1NF8A 2FN4A 4PGHA 4BNDA 1ZNQO 4BP3A 3DV9A 3T7AA 1C8VB 5DNAA 1KJNA 4BFLA 2K4MA 2ZRKA 1U90A 2EQ5A 1NRXA 3ZGYA 4A36A 4B4KA 1ZMBA 1RFLA 1P1RA 4TLCA 3PGJA 4MWEA 2Q2NA 3G0BA 1KC3A 1MA0A 2V58A 4N9QA 2TSYB 4BPBA 3SJ7A 2Q2QA 4H6PA 4M1YA 4MZXA 2IEBA 3O1HB 4D44A 1UC9A 2J6BA 3LC1O 1H8ED 1CRPA 3GYBA 4AY4A 2ZYSA 3FNGA 1UIMA 1CPYA 2XMGA 1OHHA 2AG0A 1REQA 1YU6A 4V1CB 5M34A 1ADGA 2AFHE 2CLIB 1CVRA 1W25A 2D0IA 2Y1FA 1X7YA 2FPUA 2J6HA 4C06A 3RTCA 1EM6A 1OWMA 1I1NA 1T2CA 4WCFC 2ESRA 4RIEA 3KKZA 3O0DA 5KVQA 3TL3A 1A8SA 2PKCA 3V8EA 1HYGA 2C7GA 4CM9D 4YT2A 5E95A 1Z7WA 4CLOB 4Z1OA 1XN4A 3UGJA 2JHCA 4JGIA 1JRLA 3AZOA 2ZJ4A 4AY5A 2Q5FA 4XYGA 2ERXA 4MUKA 3EIUA 5J4VA 4MRSA 3I9NA 2XXAB 3Q4GA 5LBTA 3CCFA 4HNAA 2WAYA 3JAKB 4UMVA 4C2TA 2CMHA 3GNTA 2IYWA 2BUBA 3F2VA 2JIDA 4BQPA 1J8YF 3AR6A 1ONPA 3G9UA 1OA0A 1KK3A 3UUFA 5IS2A 2P4QA 5B3JA 3JATA 1E2PA 1QWSA 1ZESA 5DO9A 4FR0A 3WLIA 4YCNA 3DHWC 3BXXA 5T64A 1PYDA 2ZPUA 4NS1A 3SEZA 4QOFA 1CD5A 4C4SA 3CG0A 1HMYA 1HLDA 3Q11A 4UZEA 5FTWA 5CM2Z 2OYCA 3KQOA 2F4VB 5IANA 4KXQA 4AQDA 1GAXA 2G82A 2A33A 3JALB 1DNPA 5FWXB 3LOPA 2NV0A 3C16C 3GRFA 3ZE9A 2VAXA 2WG0A 4HGPA 4TXMA 3HVUA 1JW9B 3RIXA 3OIVA 3KJNA 2OFFA 5JSFA 3KQUA 2WDZA 2X5JO 1WPGA 3BQBA 2NP6A 2QTCA 1VI2A 4J16A 3OF2A 3GGGA 1Z4KA 1Y1RA 2P6PA 4X0EA 821PA 3D43A 1E94E 2GEFA 4I81A 4X8HA 5EVJA 3X1YA 3TZBA 4C7MA 3HXTA 1R8XA 1PNTA 4FHDA 3BHIA 5L4NA 4JJZA 5JHHB 2WJ6A 3ZIDA 4DLKA 3B1VA 4RO0A 4BMZA 2GN8A 1A8PA 2GR9A 4H3VA 1Z2CA 5J63A 3UAVA 5I7FA 1V11B 4TL8A 4V2UA 1PFQA 1Z4OA 5H70A 4KJZA 3RIMA 1ZU5A 2XUIA 5AQEA 2FFQA 1RXUA 2OGWA 4RJLA 3VZSA 3EIOA 4JR1A 2WKWA 1PFYA 1LI7A 4C08A 2BGKA 1TKCA 5FPHA 4BO0A 4R16A 3P2JA 3OQOA 1CY8A 3TG8A 5HG0A 2OYRA 1EP9A 2ILTA 3DD5A 1I94B 2R7MA 3N5KA 1X8KA 5A5EA 1T26A 2G17A 2JH9A 3DG9A 2BTQB 4MCAA 3WKEA 4BLQA 5K8IA 1VKRA 3HWWA 4KQKA 1BD3A 1ZC4A 3ME5A 4A0GA 4QPDA 2KJQA 4B9AA 2E2WA 3KRTA 1V5FA 1Q20A 5EZYF 3VC1A 5ABPA 4DR5B 4Q1EA 4DRXA 1K6IA 1L5VA 2YZGA 2R6FA 5JDIA 3GQVA 5TEWA 3K9QO 3E15A 3JRWA 5AFSA 1TF5A 2P6RA 2BBOA 4IO0A 3SBOA 3LXXA 3GDWA 2RK4A 1L3IA 5NLLA 3CF0A 2PVPA 3R24A 1YA6A 2VWPA 1SHZA 3EAGA 2VZLA 3VNQA 4KI7A 2ZRLA 5KVCA 2XUDA 2R96A 2V9CA 1WSDA 3LI2A 4ZQFA 1NQTA 2PJHB 2WT8A 4B85A 3V4PB 1Q0PA 2FR0A 2ONZA 1DE0A 1LWOA 4BLOA 2A30A 1YD7A 1R15A 2QMHA 3HSSA 3P4UA 1OX6A 1S0UA 4LRWA 2NNWB 2B61A 3TW4A 3Q8LA 1G21B 2H1OA 1WNFA 3ZCXA 3BAZA 4P7FA 1IRXA 1BVHA 3COJA 5DBEX 3TPFA 1MC4A 2AN3A 2GAAA 4MUAA 2RGDA 2G1AA 3AVOA 5CFNA 3AF3A 1TFUA 4BQSA 3KZKA 4LYAA 4KAXA 4XI9A 1SCAA 2XKKA 2R1ZA 4GNRA 3FPLA 4IX1A 3IAHA 1FQJA 4XPIA 5DP1A 3VV2A 1OLUA 1KJQA 1D4ZA 1DJMA 3FNEA 2ORWA 3C7KA 2DECA 1L0BA 1UPXA 4LDNA 5EOVA 1SGWA 4CDRA 3A3PA 4ZGWA 5FEMA 4KWCA 1IB0A 1HA3A 1PZEA 3KEQA 1QZUA 1ZJJA 2PX3A 3OAAA 3P9PA 4WMLA 4WY5A 2VF4X 2PZKA 5CIQA 2G4CA 3RAEC 2MHCA 3A9RA 1T0BA 4LDJA 1HT3A 2NU8B 4E30A 5BW8A 2Q5OA 3SBEA 2FG6C 5K3CA 3MM4A 3QG1A 1SCIA 1L9KA 1E7SA 1C3XA 1VCHA 2JD0A 2BMFA 4AJNA 3GJSA 1USIA 1M2NA 3F7TA 1P1JA 2HU8A 3I32A 3JVDA 1XHFA 3FRJA 3PT5A 2PLNA 1LQTA 2WLSA 2YJ4A 2FEOA 2Y3IA 3H04A 4I50F 1R3DA 2HF7A 1QFXA 3ONFA 4NZZA 2XMPA 1ZISA 4IIFA 3UMFA 1OLOA 1M72A 4NG5A 1IN6A 2IF2A 2IUSA 5B1SA 4P5EA 2PUCA 1T9ZA 1EHIA 1T9GR 4J0CA 3I9KA 3DBVO 4UUNA 4EEXA 3P32A 2ACWA 1P2VA 3H16A 4FYPA 4HWKA 2FW8A 1XLVA 1AZSC 1TD1A 1QWOA 1ZEMA 1VLJA 3P0HA 3R0QA 3WLKX 1M5RA 4Q3NA 5A06A 5JAZA 1XK7A 1E1RA 2K2QB 4XVRA 2J85A 3R20A 2AN5A 3MK31 2X0FA 1T4DA 4QEZA 5ALLA 2ZE6A 3WKDA 3ESRA 2P4UA 4NMXB 3ADDA 4W99A 3KAJA 4P4UA 1ACJA 3PQDA 3CISA 4GGPA 4R3UC 3ZV4A 1Y9DA 2VOJA 1I7PA 3T5GA 1KZ6A 2UYGA 2YJ5A 1D8AA 1JG6A 3TIVA 1Z29A 3E7PA 4YUWA 1ZY2A 5EG5A 5KX5B 2AC2A 2GTIA 3HJFA 3X1DA 1QPBA 4GDMA 2IHVA 4GI1A 1GPWB 2M6LA 3EHEA 1ISMA 2NAFA 2FETA 4LVCA 3H5VA 3EFOA 3M34A 1P6QA 3T9DA 3STYA 1NP3A 3V4FA 2XOKA 2PZBA 2VNHA 3PJFA 3DEJA 1WV1A 4GGMX 4QSHA 4DLZA 2ZSJA 2QYHA 1Z6YA 2P30A 3M4XA 3ZIUA 4BMPB 1FDOA 2J9YB 3IH5A 5AHWA 3V8RA 1EIWA 3ZBTA 4B45A 4O4HA 3SQMA 2FR8C 4RJKA 3WY9A 4IW3B 1CR5A 2QWXA 2DHCA 2GKGA 2MJLA 2OAEA 3G2JA 3QA3E 4KI0A 3SGLA 3T7TA 1T15A 3IALA 3PQ2A 4DM7A 1L3BA 5IHXA 3UO8B 3KWLA 5A4FS 2GERA 1F1BA 3VNVA 1B0ZA 4CG3A 1HC7A 1K66A 3FXAA 4DWOA 1ZLXA 4HFNA 4MRVA 3GEPA 3MJRA 1LLQA 4HYTA 4Q82A 1LI4A 1N2IA 1SXIA 1N2BA 2WC1A 2YIJA 3EA5A 3F1LA 4AQ7A 2XIQA 3AY3A 3PEFA 2AZXA 3F6EX 4RKYA 1NY6A 2ZIEA 4DQVA 3OWOA 3UHOA 1P1CA 1AIPA 3G5MA 2CL7X 3FMFA 1Q91A 4KTTE 3TZKA 3VU8A 2JAOA 2PGAA 1OF1A 1XPJA 2ZI4A 1LEHA 4AJEA 2Y1WA 4I6GA 4BLVA 4IO1A 5IH7A 1CIVA 2DQZA 4OH7A 5K09A 2JBHA 1EFPB 2EX0A 2YC4C 3F67A 1TYZA 4L6CA 1FUKA 3S1AA 5KQSA 2HA7A 4XQEA 4D0RA 5CAEA 1Z33A 5CLJA 1OYVA 5EWMB 3PFBA 1AO3A 1LVGA 5B7QA 3CZAA 4LHWA 4M7RA 3U4DA 2VC2B 2G0NA 3AYXB 1DIOB 1L5ZA 2EV9A 1VHJA 3A3OA 2Q07A 5HK8A 1L3CA 3OJOA 5J58A 1M0EA 2MSCB 2YWFA 4WD3A 3B2EA 3HGMA 1X1DA 1N9KA 2F90A 1ESMA 3UIEA 3V8MA 3RR2A 4UC0A 4DT1B 3N8IA 5KJ6A 5JTUA 1UPCA 1W5AA 3I9OA 1VPDA 1I4EB 1SBCA 4LUCA 2V7TA 4J3FA 4PXYA 3WLTA 4W9RA 1ECJA 3RYTC 2NTVA 1H2EA 1S2MA 4OQLA 1XFDA 3JYQA 4HLCA 2AOTA 1H9AA 2ECKA 2OE2A 3EZFA 4PRZA 1A50B 4C9BA 2BHRA 1MC5A 3N76A 1FBTA 3O21A 3V1MA 1QFSA 3O2NA 3AFHA 4PFSA 4QGGA 3MS7A 4ZVQA 4H77A 3JASB 2R8XA 1NP7A 3EUEA 1PAUA 4UUPA 1T2DA 5TS2A 2R8PA 1SXGA 1G5QA 2B94A 3HADA 3NHAA 4C7VA 2Y8EA 5DOZA 4M1SA 5TQJA 1Z74A 1IVSA 5A0FA 1KDPA 4FW8A 5E9JA 3K9LA 5TQ0B 1BN7A 2FUNB 1L4FA 3HUTA 2OV3A 4MQ5A 4W1PA 4CM5A 4L8GA 4FXOA 4EABA 4AMYA 3FUXA 4DSUA 4YCCA 2KPOA 4HWRA 3ZLJA 1HYQA 3ANXA 3PR2B 1YUNA 2HK7A 2R85A 4JJGA 4RD2A 5DN9A 4GUDA 2Q6VA 3KJIA 2CNKA 1M76A 3I5MA 4P35A 1HLGA 4XX0A 3WP1B 4QXRA 2IXTA 3O94A 3NNSA 5AIAA 4NE9A 4O4IA 1RP1A 5BN1A 3R6DA 3GVHA 3PQ4A 3RVNA 4D79A 1K5GA 2WE8A 1YL5A 4XGIA 4HPWA 1A9TA 3KHSA 3CNEA 2ZDHA 3G8YA 4ZV7A 3TLCA 3MYYA 1KL7A 3JQGB 4JEIA 1LLFA 3TSYA 1NNLA 1E63A 4U7GA 4YX9A 4JYZA 1PR9A 2O1XA 1PVOA 4DR2B 1ENOA 2E55A 1MRZA 2JIMA 2VJKA 2WKSA 3LC0A 1TZCA 3ZXSA 1EK0A 2QN6A 2K7FA 4ZOCA 2DH5A 1R0KA 2QUJA 3GLHA 4DAEA 5EJEA 1X7XB 2ZKLA 3QE2A 1JI3A 1SN7A 3VZBA 4F92B 2C31A 4I5GA 1G6Q1 4CLXA 1JGTA 3VAAA 1JPNA 3FCSB 1YONA 3H5LA 4RBNA 5CT8A 3RRXA 1Z45A 1SM4A 1HEYA 1UM9A 2QM0A 3JAWB 5JYEA 3JARA 4MVJP 2XYRA 4BX0A 4OHWA 4EVQA 4F9GA 1FTGA 1Y98A 1O1YA 3KB1A 2BFCA 4LPKA 4AKIA 1MH9A 3NETA 3ZZUA 4EFKA 5T6MA 4F7DA 3IAS6 3O1IC 1ZJ4A 2Q3JA 5DLQC 1KBZA 1PJSA 2WTBA 2ZXEA 2BRUC 3HN7A 1ZH8A 3PWZA 5FPQA 4E5DA 4IV5A 1T29A 4DNFA 2XKAA 4FCWA 2A4MA 1ZM2A 3IEIA 1VE9A 4IXWA 3FVRA 1FJHA 1XD9A 2BFFB 1A5BB 4FEGA 5FA5A 4DR1B 2DFKB 1LDNA 4AMUA 4X65B 1UT5A 1IZYA 1JQBA 1ZS9A 2C2KA 2ES4A 1OR8A 2K2WA 3B9PA 3DPUA 4RADA 3TMAA 3LC2O 1Z0SA 3CNOA 4N7BA 4RLSA 4QLOA 2C2HA 3RRFA 5U4XA 2VKTA 5HDBB 1PEDA 2QVZX 5FOTA 5B3AA 3GLIB 2VRCA 2BP7B 4XIFA 3NORA 3T3GA 1APBA 2H3EA 4PVDA 1XBTA 3D1JA 2ZKIA 3L46A 3W6ZA 4CDNA 4FDTA 4GW3A 4DIOA 3T3DA 3E23A 5KYWB 3QW4B 5JZVA 3GRAA 1NKTA 4HDAA 3GRYA 3VO9A 2XDPA 1IRIA 1QHFA 3VISA 1KY3A 1II0A 1URPA 4EPRA 1BJTA 2XUFA 3E3OA 1RVDA 3A05A 3HZZA 5ALZA 2D1TA 3UMGA 1NHWA 4EGQA 4P36A 2AFIB 2ZE7A 1E2FA 1ZQ1A 2D4HA 1OI4A 4K5QA 4PX2A 3RYIA 1G21E 3HL4A 1Q3TA 2I4NA 3CU5A 2GCNA 4Q3LA 1FDIA 4B09A 2CVQA 1AD2A 5BYAA 1S7CA 5F5NA 2X5NA 3NMUF 3QKTA 1OPXA 3U3ZA 1ZD3A 2XB9A 4UHKA 1YZ3A 2A7XA 1T2NA 3QKWA 4R98A 4FZ3A 2GJ9A 2IYSA 2ODQA 4WKPA 3UQZA 4Z9BA 4ZZ1A 3NT5A 2X3FA 3QVTA 4ZAZA 4JXXA 4EYOA 1E9DA 2UUPA 1V7PC 1UMKA 3OJCA 4CMKA 2A67A 4MROA 5CB6A 3U40A 2WJWA 1ZNXA 3FMPB 2XW6A 4PTLA 1PNOA 2HMTA 4IEIA 2DR0A 1CR0A 3EDOA 4MKRA 1CUSA 4MWTA 2IE8A 1ATZA 1JR4A 1ZNZA 3H0KA 4Q16A 1D5CA 3BZWA 3PC2A 4J8PA 4LISA 4O4LB 4WNCA 1CT9A 2FSGA 2RGUA 1Q7EA 1ABBA 2HF9A 1XPRA 1KETA 2XUOA 1ISFA 2OORA 4YR9A 4QVIA 4LKRA 1T9KA 3BGDA 4L5CA 4NCJA 1QHYA 3L5OA 4DHWA 1ZJYA 4IDEA 3BH6A 2PXHA 2DBZA 5GGXA 5BNZA 2RHDA 2M32A 3EDRA 2PHZA 4MR9A 4RZ2A 5BORA 1B8OA 1SCQA 4LHYA 2OV6A 4TXHA 4UHEA 4BLPA 1LGYA 1MHPA 3V55A 3Q2IA 6Q21A 1A72A 4HP8A 2FZWA 2WF6A 1D6NA 3AL3A 5JAQA 3G5TA 4KQJA 2Z04A 4DSZA 2ONJA 5AIBA 2DT8A 1VPTA 5FEUA 5KVSA 2VK2A 1MEJA 4U7DA 3B70A 3ZN2A 3MTIA 2GWHA 3MAJA 4G0YA 2WILA 3OPYI 3JQCA 4OXRA 3INYA 4DUPA 3FDZB 3IC5A 1DGQA 1ORVA 3A14A 3AP1A 3BILA 5DGCA 2TS1A 2WW8A 3A9CA 4QQ8A 3E3MA 4HLDA 3EIXA 4XCXA 2HRQA 4JKYA 1FFWA 3FNRA 3IAXA 3TLZA 3HKDB 4AP5A 3RSQA 2KX7A 3TLGB 4M49A 1MX1A 2TMGA 5T8KA 4QOSA 1YCFA 4ZOLF 4TQ9A 1O5IA 1YJ5A 3ESBA 4TT8A 5BMVB 3HVHA 2OBLA 3L0DA 3LQ4A 5IAGA 5EVCA 1MXFA 2C1EA 4OG2A 1FZTA 1WVIA 4ALIA 3BPSA 2CXSA 4H08A 4JI7B 3TIIA 4G86A 3DSRA 4Z99A 1J2JA 3ABQB 1R9JA 4H17A 1NVWQ 1FUYB 1Q7TA 2HF8A 3U17A 4RQBA 3A1DA 3MUFA 1GR1A 1KEUA 5AW0A 2IH4A 5F64A 4HEHA 5CVDA 5EJ5A 1Y3BE 2MT9A 2NUPB 4QM6A 2JZCA 2FUEA 4UHHA 3ZE6A 3AVUA 1D8TA 4XDHA 5EJFA 4HZUA 2R00C 5K0EA 2J9ZB 2RHOA 4IOJA 3DD1A 5JD5A 3JQFA 3L05A 1POWA 4LGCA 3THYA 3TFWA 1U1EA 1VSUA 4MWZA 1FPQA 4D81A 1F9AA 4CETA 3DMRA 1KEVA 1JA1A 1IN1A 3QFHA 1Z47A 3C3JA 3EPKA 1OA1A 2LZ0A 3ZCVA 4ZCIA 4F3CA 4WXMA 1L7OA 3RFCA 2OTCA 4UXJA 2YJTD 3M5PA 4AK9A 2JDIA 4MB6A 1Z17A 1HE3A 3AG5A 4FMBB 3CZCA 1NBAA 3AZQA 3CVOA 3EXFA 3JPWA 3QEOA 4G1BA 4II7A 4YCMA 5JAOA 1CV2A 1JKJA 1NOJA 1V48A 2BPOA 4HQ6A 1WHTA 1W35A 4N5HX 5C80A 2YQZA 4AICA 2CWWA 2OCIA 3T4EA 3FDJA 1OWNA 1XIVA 2K5UA 3H6HA 4MA0A 2WF9A 1ETHA 1QANA 2D0OB 3TZCA 1NXVA 1YJCA 1TEVA 3C3MA 2VDMB 1ZYUA 3EW9A 3KBBA 4PZDA 4QU5A 4RHFA 5KU7A 3CINA 1PT7A 4K8OA 4Q4JB 4RVUA 2M1ZA 4C0WA 4OUDB 4MHTA 3WP0A 2HIAA 1C0KA 4HF7A 3DDHA 4NCXA 3VNRA 1EP2B 3HDHA 3PFCA 4NC9A 3VR6H 4S3MA 1UK6A 4JCCA 4Y2YA 3HO8A 3DAHA 3TRIA 3M1YA 2VDOB 1Y82A 1WB9A 1UANA 3KBOA 4RHYA 3HKEB 3V4VB 3H97A 3DE2X 2VQSA 1UKZA 3ZXYA 3PFWO 3HCRA 3AVQA 1ITZA 3ND5A 1GN9A 5IVHA 5B6JA 4DR3B 1G8AA 1B14A 2VP6A 1AKTA 3WGHA 1Z39A 1QAMA 2WTNA 3QF4B 1F0YA 2YQ4A 1PUJA 2R1TB 3CMCO 3HY3A 3NYIA 5K3FA 3TSOA 1QQBA 3CEJA 1JEOA 4IKPA 4O5OA 3VTKA 2ZRHA 4ANFA 3S5UA 4IDHA 1Y3HA 3S8MA 4PYQA 1B16A 5CJ2A 3X1JA 3HUEA 3GVIA 1X39A 3CJTA 5G40A 5TPWA 1TNDA 3KXDA 3ZZ0A 4YUVA 3HU3A 5TF0A 1A2OA 5HUQA 3H4TA 1NA5A 1NVKA 1ZINA 1Y5NA 2R48A 1DO0A 3KKQA 3DLBA 3N2YA 2VJMA 1PRYA 3W4JA 1XA3A 3PUIA 1PWEA 5HNKA 2C82A 4RVDA 3MT9A 3UH0A 3VPXA 1R4MA 2QL9A 2FSVC 2UAGA 3A10A 2YV3A 4B40A 1OFVA 2X40A 3VTZA 5B7NA 1NPTO 4TV9B 2H4FA 4RTQA 4RTOA 2B20A 3DPIA 1X3SA 4JJEA 1FDVA 1HDCA 3HWSA 4P3NA 4DIKA 1YR2A 2KE5A 1P2TA 5HM6A 3WGJA 2X5XA 3HJTA 1GAQA 2EAUA 4W5HA 4BX3A 2O7VA 2RFLA 4FYJA 4Z53A 4E2YA 3FFXA 3BMQA 5BW6B 3OJLA 3OKCA 2E4AA 3DEHA 2JZOA 4B0PA 3DB1A 1M6HA 3QKUA 1PBTA 1FMJA 3G0DA 3IAM6 3KD3A 4GFDA 4HX2A 4M3NA 3G0HA 4BNJA 2Q5EA 2QZPA 3HA7A 1U1CA 5FHRA 1BZYA 2V7XA 2OA0A 3HJBA 3QPBA 1NTOA 2FTKE 2QTVA 3G6WA 1PR6A 2YXEA 3Q7IA 3LV8A 1QYCA 2GCGA 4I4LA 3DOUA 1YGPA 2O5EA 2J9XB 2AYYA 4L08A 3OWXA 1DJLA 1QS0B 1T8PA 2FN7A 3JX9A 2W2QA 1FFAA 3OCJA 4BNKA 4N6NA 2GZRA 1TQ2A 2Q2WA 4KWIA 5CD9A 1E3TA 3TUJC 3N0WA 3BXOA 1IJEA 4E08A 3GG9A 5KC9A 4YQZA 2AYZA 1I8TA 2ZAYA 2FX3A 2JLRA 3AEQA 3R0ZA 2ZR0A 4LGMA 2DQSA 1T36A 4KMSA 1JX6A 1LDMA 2OO7A 2C5EA 1QNLA 3MXTA 4LBZA 5F78A 1KHHA 2PKRA 3UWOA 2FWMX 3MJFA 4IJ6A 4X1YB 2CLSA 1IE3A 1CB7A 1HEUA 1USUA 2IEIA 3PGXA 3RLFA 2VK1A 3T1OA 3KIPA 3LT1A 3WL8A 4BTEA 1JR3E 1W73A 2H1CA 2SECE 3T7RA 3T3HA 3ZQUA 4DCNA 2PX6A 3O8OB 3AESA 1NQWA 4MI1A 4EKEA 4YYZA 1OLXA 1T3ZA 5ADUS 3GLIE 2O19A 4AS1A 3VM6A 1KQGA 1YF3A 1W0KA 2H2GA 3MTAA 1KMHB 3ZNOA 3VU9B 5ED4A 1TTTA 1GXSA 1NF3A 2V54A 1U8YA 1QYIA 5FDFA 5HUJA 5CHEA 2PJZA 2VTKA 1T0UA 4HMQA 4OU5A 4AZ0A 1XEAA 5E3JA 2NUBA 4M83A 2EZTA 2XHEA 5B58C 3PKZA 1VE1A 2FWAA 3BSSA 3PPXA 2X0EA 4IIBA 2HDNB 4OP1A 4ZEOA 2AFIE 2WSBA 3L7AA 4R41A 5E7QA 3VOAA 3ZDFA 3K1AA 2O2IA 1M9NA 1ZG3A 2ZOSA 3KLBA 1TVMA 3L01A 3PXEA 1V3UA 2N1MA 4V3BA 4ZCTA 4G5FA 4MCHA 1EDEA 2B21A 1N0IA 4QXMA 1QF6A 2C8VA 4A5SA 1Y63A 4P0QB 3CSDA 4KN5A 3W5CA 5BQFA 5CDFA 1UDBA 1ECBA 1ZUHA 1FZQA 4Z8YA 1XCPA 4YJ3A 1MEOA 1UEXC 2GAIA 3PBKA 1Z0JA 3TRHA 3LUDA 1DIHA 2W2NA 4OGGA 2ZUEA 2VF2A 4JLAA 2Z08A 1QC5B 1W4BA 2C2MA 4N01A 3KAKA 3THOA 1CRLA 4BO7A 4NYMQ 2XVZA 1FL9A 2AMVA 2B4TO 3TR6A 2FWJA 1ZH2A 2EX1A 1ENZA 2O6LA 4MLPA 4F5DA 1OC2A 4M0LA 2COEA 1M34A 2WABA 4D25A 1DKNA 3S28A 2F9MA 1D2EA 3EQZA 4Y2TA 3SSAA 4B2LA 4LJ7A 2QORA 5DKFA 1XMQB 1PTJA 2D8MA 2Q45A 1NJSA 4RDCA 4ER5A 2X9LA 1WP4A 3OZEA 4Q66C 1LW6E 3RVQA 1IHUA 5DLPA 1O94C 1U3GA 3BIXA 3LXUX 5ALYA 2RHMA 4UTOA 4ER7A 5ETJA 2XSZD 1QK3A 2TRSB 3ICOA 4RQTA 1AG9A 2PD6A 2FLWA 1G8KA 3R74A 5EHZA 3PHGA 4E33A 3NTQA 3NALA 1EBUA 1IHPA 4FFBA 1HNZB 2LW7A 2BKUA 5E6UA 1O95A 3B6ZA 1GPKA 2AUMA 3GEBA 1MJGM 1D0SA 2YV1A 3MJTA 3UA3A 4GOMD 2OQ2A 1LSJA 1PDWA 1T5BA 3EGXB 4KQ1A 5BO5A 4OATA 3WLRA 1J23A 5A5FA 5KOYA 2XECA 2PZAA 2XVYA 3VVCA 2H51A 1JKMA 1XQWA 1R5OA 4Y2XA 5LKAA 3M4NA 4TTAA 2ZRFA 3S44A 3R6WA 2VJYA 1GZDA 1FSPA 1DCFA 2XYGA 5AXCA 2M2IA 3KQKA 2X4DA 1OX4A 2YMPA 5KJEA 4ZEVA 4MS4B 1UJ5A 4Y6LA 4B3GA 1OYOA 2FMTA 1B6TA 4UM5A 4C4ZA 3U09A 3D3NA 4W1QA 2PUFA 4JL6A 2R2GA 1D07A 5A4AA 4JI0B 1CLUA 1E1DA 1SEPA 3U81A 5FTJA 1FXWF 1USGA 2ZI6A 4Q24A 4A23A 3M6FA 1EE9A 3PUVA 2BEKA 1YRYE 5C1DA 1DPFA 2CXUA 1R4ZA 5E4FA 3T5DA 1KH1A 1ZUD1 2IYOA 4WDQA 2X6QA 1Q0TA 1K7FB 1KYQA 5E1MA 2NYRA 1ANKA 3OIDA 4C5BA 3QKIA 1K4KA 4OGLA 3FFAA 4YUYA 5DGTA 1M2OA 5TXGA 2J3KA 1F12A 3KJQA 3NXKA 1XKXA 3VTFA 1O6ZA 3D3WB 3HVJA 2OWDA 2EZ8A 5IJ0B 1C9NA 1VIMA 1LS6A 2ARKA 1VI5A 2G7MC 4R8KA 3C6YA 4IGIA 4WFJA 4BX2A 2VXOA 2EXXA 4IUYA 3QOFA 4MUYA 2OEPA 1XXHA 1QR2A 1LPNA 1THTA 3WMEA 3FY4A 5JZOA 1Q77A 1BKSB 5HUHA 1EMDA 4ZO7A 5D7BA 5I9LA 3SMVA 2Q4EA 3K9FC 3ITKA 3CLSD 5BRJA 2GA9A 2Q3LA 4UVEA 1I6LA 4CT5A 4FHEA 1GKIA 3F5DA 5ALJA 5KSZA 3OVMA 2ZIVB 1MAVA 3EODA 1KFJB 4HGRA 3KPWA 4DQKA 2GN4A 1I9GA 1GDDA 1L5SA 3G2QA 3P7MA 1I0ZA 4NVRA 2P6MA 3L4JA 4IFIA 3SYLA 2ZVDA 3UJ9A 2EW2A 1RI1A 4DIUA 5EWLB 2W2XA 4HNRA 4YS6A 4BIIA 4PSKA 2CDBA 4WKGA 4R0VA 3M9LA 4LRSB 1KNQA 4F3YA 4TRMA 3PT9A 1UFVA 3VRHA 3VVLA 3UHPA 2GHTA 3BL8A 3T95A 1PSDA 3TKAA 3HA2A 4IUBS 4XWYA 4DMFA 3K70D 2IVZA 3QJYA 1OXUA 3EZLA 3HB7A 4F2DA 1U7WA 2AJCA 3F4BA 4YRTA 3RF6A 1HG0A 1UJNA 2O2ZA 1T5DX 2O2CA 3SFVA 3EIQA 4XB1A 5TRTA 4NWIA 1JMVA 1ZNWA 4RY0A 1YIAA 3IAUA 3SU8A 2WI8A 3GP3A 4RZHA 5AM3A 1M6NA 4JP1A 2YOGA 3OM1A 1D6MA 1SKMA 4W5NA 4CLEA 2BMAA 3NAQA 1MVOA 3C1AA 4L51A 5EJAA 5HA5A 5ALKA 2PLFA 3CZ9A 2D3WA 3X1KA 4CZ2A 1ZMOA 3JATB 4C4OA 3DXYA 4WOCA 3LT0A 1WBJB 5K8UA 2DBYA 4JBXA 4QOIA 2BMWA 2DULA 5HJ7A 3H99A 1OPRA 2HSGA 2QD3A 5TMDA 4AKGA 3F5FA 1UFKA 2Q3CA 3BK2A 3IPRA 2WSSD 2XAUA 1MAAA 2XVMA 4FN5A 2QX4A 5IKPA 5FI1B 4N76A 2VTDA 3DC7A 2WYWA 5C52B 2OBNA 4WLVA 5EXXA 4OREX 5DTRA 3SDBA 3GQBA 1AUVA 1LPOA 3ZWBA 1W4CA 2EL9A 3JQBC 2QF7A 2NO9A 4EHJA 5KCMA 5EHNA 4HY3A 1YIOA 4U7WA 2PZ8A 4UFOA 3WRVA 3OQMA 3JPYA 3M2TA 4FILA 4ZAYA 3MT8A 1SQ6A 2I6UA 3C74A 3L0IB 3RRBA 1KOJA 3L40A 1CBUA 2RHRA 1RQLA 5L3SB 4NE7A 3BIWA 2ZB7A 5JIBA 1FP1D 1CVIA 3PXXA 5HJEA 3CC8A 4V39A 4RFLA 1AA6A 4YRLA 1W87A 4ZPXA 5G0TA 1GG9A 4KXMA 1UP6A 3F47A 4F12A 5LIRA 1CNEA 4MVJA 2IXDA 3D0QA 4YJHA 3GJYA 4UEJA 3GBPA 1KRXA 2P3QA 3IXMA 3C3XA 4ZALA 4QATA 4JR2A 4BVLA 4M9ZA 5F2OA 2VO1A 1A77A 3I0MA 3K8OE 4UCXA 4YT4A 2J7PD 1OZFA 4EENA 4XCVA 2EFGA 5D2CA 3TFOA 2SICE 3ONEA 1FJXA 1J1ZA 1M1YA 1N1DA 4WFIA 1R16A 1G63A 3VZDA 4BV9A 2WKRA 3E27A 3URMA 3U3KA 3OPMA 5KNCD 5LP1A 5GJBA 3LUFA 4ERXA 1XA4A 1X70A 2ZBRA 2ZU6A 3QHQA 4K9DA 2AX4A 1SUDA 1EG7A 3IPXA 2HF2A 3E2PA 3KZCA 4WKNA 4YACA 4HMPA 4E31A 3A58B 5CA1B 1CQXA 2WIGA 3FVWA 1B1CA 3OZFA 4ENPA 1U5BB 1EVZA 5FV7A 1N36B 4X1IA 3DEKA 1QZXA 4Q12A 1X0XA 2AS0A 5AVXA 1MJHA 4M22A 1TW3A 4GSLA 4LXQA 4YP0A 5SY6A 2C4UA 1V2HE 4KXLA 3QW2A 2PZJA 2H5JA 4DDTA 1XD8A 1LBQA 1Y3DE 3ZVKA 2BFMA 3S68A 1II8B 1NQ5A 1XZMA 1D03A 1KZYC 2XITA 4JZKA 1HTBA 1QXSA 4U4AA 4US1R 5GOZA 3T41A 1TKAA 5HVNA 3KWFA 5K0ZA 2XE7A 5CLLA 2QTFA 3S2IA 4EUNA 4S05A 1C7FA 5K1ZA 4ENSA 3NVDA 2WZQA 3L02A 3O75A 3ASUA 4AN0A 3L8FA 4UOEA 4RC9A 3ECAA 3H0CA 2ZB8A 4GPAA 2ZZMA 2WSYB 2B9EA 1EXVA 2I3AA 4AD8A 2J5QA 1L6IA 1NF2A 2HLDA 1MGPA 3BKXA 2OHXA 3LZ6A 4DLTA 4G9EA 4CTMA 5ALHA 2V8BA 1KORA 1Z5ZA 1XNHA 4A0FA 3OT4A 2FUCA 3IMGA 1OLUB 2CLEB 1HNNA 1XU7A 2B3DA 2MTBA 5AJUA 5JBIA 3VDRA 4QQFA 2E4WA 3CW2A 3IKVA 2X2EA 3EGDB 3PQ6A 4LZPA 5I51A 3KPYA 1RAAA 2C9ZA 4M8LA 4LHSA 3WADA 2JGJA 3BGIA 3OPXA 3LUCA 3WRYC 1BKYA 4GC5A 4OJMX 4LF7B 2PO5A 4RKQA 5L3ZA 3RUDA 2RH4A 2C3MA 2O2GA 2YFHA 1QBKC 3WWYA 3ADPA 1JQJC 3AX6A 4MVJG 1Q22A 3LWZA 5KYUB 3JQQA 3HXMA 5TGTA 5F9HA 3WNZA 1V4NA 3P9KA 1AMUA 2LPMA 1Y5LA 3FDXA 4IIJA 1RXWA 2Z8ZA 3G2PA 4PSUA 5IYZA 1GUFA 2FSFA 5DXFA 2BZSA 4M1TA 3RBZA 4G0WA 4X8MA 3S2YA 2RAFA 1WMSA 5DN6A 5HE9A 3Q12A 1OUMA 5BQ5A 1JIIA 2IP2A 4DNPA 2VDPB 3BN3A 4F4HA 2W6ID 4WVLA 1E3QA 1D2MA 2FOXA 3A9WA 4BTVA 1VPWA 4LCJA 4D3YA 1GQRA 1YB2A 3BRWA 1KOLA 2IOQA 5IJWA 1MN6A 2H7VA 1ZJ5A 1E66A 1ORRA 4ZGGA 5HS4A 4OI4A 1T1GA 2HNKA 3LF2A 1SBTA 1F60A 1THGA 1TK3A 3RHSA 4ZV4A 3DKIA 1UUFA 1P4RA 5FUVA 3WDSA 4R7ZA 1QIJA 4XQ0A 4HATA 4CMIB 3HM9A 4KVFA 4WLUA 2BE9A 1EBFA 3A36A 1NNUA 3OLCX 3EWAA 2W2TA 2D2IA 3QEJA 1OTXA 2J6CA 4QASA 3USES 3GJ3A 2XNCA 1HKUA 4O8ZA 4YQYA 3BCRA 5A3RA 1WLFA 1RRGA 3LHDA 1E79A 3M7IA 4QBHA 3RRNA 1BGWA 4IGAA 4B87A 4ZI7A 5EXPA 1F17A 1NJ2A 4KDLA 3LPNA 4V0ME 1OGIA 3CX6A 4M8SA 4N6OA 4RK4A 2C7PA 1P33A 4R1LA 3ROFA 4N0PA 3JD1A 4GKVA 1N1GA 2P9GA 2AOUA 3DTTA 3ELWA 3Q40A 5M5BA 1A4XA 3ETHA 1STOA 3N0XA 1G16A 4HGNA 4F1WA 2Q1AX 1BSVA 2GPJA 2P8JA 4QBKA 1H4TA 4ZOQI 1FW6A 5BY2A 5F7OA 3I58A 4H4EA 1MB4A 2JLZA 3K0KA 1A5SB 2JB9A 4JWTA 5E4JA 4HDNB 1QORA 5CHYA 1ZSNA 3SC3A 1PT5A 1G8FA 3B53X 4PHGA 2WUGA 3QXGA 2J87A 3GWZA 4U9HS 1T9DA 2D7JA 1V9CA 1RLIA 2VRWA 4UXIA 5IHPA 4AN4A 2V3WA 4HB4A 4L4UA 4XVQA 1U2RA 1U2QA 4YQEA 2E18A 1KC1A 1DKOA 1I4TD 4ETNA 1HFEL 5A9SB 1PEYA 1XROA 1HZJA 3E84A 3AETA 2ACVA 1Z6ZA 3VZQA 2ORVA 2Q9CA 3WSWA 2GHIA 1SKBA 2QN7A 2XBMA 3V4SA 1KK2A 1S89A 3LGAA 3B9QA 2HB6A 3CPEA 2A1TR 4QHYA 4I7EA 3QUAA 721PA 2JVIA 3GEMA 5KVAA 1WZCA 3RYHA 4BAGA 2WQ6A 3EWSA 3L8EA 5J4YA 1FFEA 5H9VA 3I52A 5H3HA 2VK8A 2ZSFA 5CVJA 2FMUA 3B3AA 4D8YA 5HRUA 4IUDS 1XTVA 3AW8A 3B89A 5C5CA 5FAKA 4Y30A 2JFQA 5HQJA 2IYNA 3AJEA 2HI0A 3D81A 3GU3A 3L7OA 5FL7A 4CKBA 4XFDA 1NFRA 3CPHA 5CAEB 1P9RA 4ZDIA 4EG5A 5B2FA 1D2RA 1THMA 3CUUA 1BXZA 1ZI9A 4OXXA 3G89A 2HSWA 5JALA 1JLLA 2Z3ZA 3T5PA 1DRVA 1QO0D 1Z25A 1P6XA 1GZ7A 1R4NA 2QQEA 3P1JA 4GX5A 4MXDA 5HDQA 1A7JA 2PEYA 5ECDA 4AUMA 2Y1DA 3GFSA 4G63A 4KLRA 1I5EA 2W8ZA 2DLNA 1D2CA 4TTSA 3REFA 1DKQA 2QPAA 1LXCA 2R87A 3QE3A 4ID9A 1VIYA 4O63O 2HBRA 3F9CA 2GBLC 3WGLA 2C5AA 1P7ZA 2AOTB 3B1WA 3DDSA 5AM0A 1P9LA 3HCOA 1RLMA 1BEUB 2JLSA 2CBZA 2KYRA 4PYRA 4BUCA 4HK4A 2QRQA 5KYKA 5IUNC 4NBRA 1L5RA 4P0TA 3CKYA 3TZEA 4PTZA 3ZV3A 4EY5A 3UT0A 4ODIA 4TZTA 4B6SA 1WWKA 1U6IA 2H1IA 1XKQA 3H84A 5AOBA 5JYCA 3C5HA 4CKCB 2M6RA 3A6FA 4KV7A 1J33A 1JKXA 4QEDA 5EYPA 2GKOA 4I8IA 5DNYB 4UNNA 3ETNA 4PGAA 3MCUA 1N9GA 1TJ3A 4KIWA 5KOHB 5THQA 4ZKDA 1DQRA 4CDGA 2WIDA 4JLJA 1QHEA 5A05A 4HEA6 1CQWA 1S3GA 1SUAA 1GUAA 2CNBA 2R00A 2YVKA 4JVOA 2A9VA 1AN9A 4GI5A 3SE0A 5ICGA 2HA6A 4RF2A 2K6GA 1GGHA 1Q95A 3KQPA 2ZCVA 5CITA 2Z95A 1N4DA 4O4IB 1TZBA 2JJ1A 5DLDA 1ISJA 1ZD1A 3RT9A 4I4TB 3DKKA 5K5EA 1EUDB 1R8QA 3I3OA 4GRIA 4KGXA 4O02B 5IKMA 5J2UF 2Q29A 5KHAA 4KO2S 2EDAA 5B6PA 3C4QA 3AVVA 2QQ5A 1V5WA 4C01A 2GPAA 3LDGA 4N3GA 1QVWA 3NATA 3PSHA 1GA1A 3GROA 3N28A 1RJ9A 1IY1A 2V6FA 2AQIA 4RQAA 2BFOA 1MHTA 3PQCA 2PX0A 2IELA 3WSTA 3DMTC 1PI3A 4G6ZA 4N7MA 1ZC1A 4M6WA 3TVTA 2J9FA 4CCSA 3GGJA 5EMJA 4KXVA 1TYBE 2GUGA 3VSAA 2IEAA 4ZC8A 1L7EA 1VIDA 3LMKA 3ROEA 2HHLA 3WBKA 2QYSA 3DL2A 4MVYA 3C39A 1K8XB 5BNWA 3LK6A 1J09A 4YRMA 1WF6A 4KGDA 1TAHA 4NYJR 4RNCA 5EPPA 3TRKA 5TF4A 1U5AA 5CYOA 5F3RA 5SV2A 3VO1A 1GNPA 4H7HA 2X9VA 4OKIA 4IFEA 5FOVA 2PS1A 3WGNA 3WL7A 3U61B 2UVPA 3PHHA 3OEWA 4W8OA 1UXIA 1XA0A 4RLFA 4R40A 3TTUA 5HFAA 4NCAA 2CBXA 2I8CA 4D4LA 3OIYA 1EJ2A 5F5LA 5JYDA 2P9CA 5DI3B 2XADA 3GMSA 3BWDD 2DWUA 5BV0A 1U2PA 3HJRA 3OJXA 4JC8A 3FPUA 1LTKA 3BXHA 5H4GA 1YZQA 2AQHA 2IODA 3AQ4A 3I1IA 2EP5A 4D74A 1YSCA 2FPPB 3UICA 1T1SA 2ORIA 5J1TB 3LG2A 3DOIA 2NU6A 4RA6B 3EJ6A 4MWOA 4BYGA 3QOXA 3VMMA 5KTPA 3TDKA 4YAFA 3TNLA 4WWHA 3AVYA 2W0SA 3L9WA 4ZQCB 3LBNA 1M3SA 4G37A 2L18A 2YHAA 1ULHA 3PIRA 3S70A 3RJTA 1VGVA 4M0UA 5BR8B 1ESCA 1U9IA 4ZPJA 4A10A 1C4OA 2FGKA 5EXEA 2BCGY 4QVGA 1J8DA 2CB0A 2QD1A 3FWKA 1Z0KA 2O8NA 1PL7A 4GU5A 4PQYA 2PXXA 4EG4A 5TT1A 1EK2A 2F4NA 3F73A 5KJCA 3QEBZ 2Q4DA 2PKEA 1WBBA 4KFSA 4UTVA 4LQCA 3UJ7A 1NN1A 5HIKA 3JRXA 3C6BA 1QK4A 1GPMA 1V45E 1JF8A 2VCYA 4BN0A 5HK9A 4AZWA 3RHTA 1TO1E 1JDSA 2LKCA 3N59A 3ZV7A 5KTNA 1GG8A 5FLYA 1JDTA 2FQ1A 5FPKA 1XC7A 3KAQA 3KDAA 3NTUA 1FFBA 5FUBA 4BMVA 4DCCA 3KQHA 5ECWA 5JROA 4G0VA 4GI2A 2A1IA 4IDNA 1N7JA 4TXJA 4MKIA 3BF7A 3DLAA 1XEFA 2QKYA 1KDOA 3N9IA 4OAPA 3WBFA 2FSHA 2Q3BA 3G3EA 3NTVA 4LK3A 2RGXA 2Y1OA 1LY1A 3TGPA 4QA9A 5GVRA 2R6JA 1Y8RB 2X8LA 4ZZ0A