2PWYA

Crystal structure of a m1a58 trna methyltransferase
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
251
structure length
251
Chain Sequence
b'GPLLLKDRKGRAYLVFPKEGGVFHHHKGSVPHEALLEAGPGGVVRTHLGEELSVHRPTLEEYLLHMKRSATPTYPKDASAMVTLLDLAPGMRVLEAGTGSGGLTLFLARAVGEKGLVESYEARPHHLAQAERNVRAFWQVENVRFHLGKLEEAELEEAAYDGVALDLMEPWKVLEKAALALKPDRFLVAYLPNITQVLELVRAAEAHPFRLERVLEVGWREWEVRLPVAHPRFQQVGHTAFLVALRRWKGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (adenine-N(1)-)-methyltransferase
publication title Crystal Structure of Thermus thermophilus tRNA m(1)A(58) Methyltransferase and Biophysical Characterization of Its Interaction with tRNA.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 68
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature ec 2.1.1.220: tRNA (adenine(58)-N(1))-methyltransferase.
pdb deposition date 2007-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2pwyA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2pwyA02
4P58A 2ZBRA 3O7WA 3OE4A 4KIFA 3HA7A 3LBFA 5E8JA 1R8YA 3OE5A 2I7CA 1NV8A 3ME5A 4F86A 3BKXA 1G8SA 2AOTA 4EK9A 4QTTB 4PYMA 4X41A 3G89A 3GRYA 5E1BA 5ICFA 2JJQA 3CKKA 4RTNA 3UJDA 4LWOA 3HVJA 5BP7A 3UWPA 3GXOA 3UJBA 3RW9A 3PS9A 3FRHA 1U2ZA 3O31A 2EX4A 3B3FA 4X1OA 2AOUB 3MTEA 3PFGA 4GEKA 4LWPA 5K05A 1NT2A 2QM3A 2C7RA 4R8RA 4AUKA 2V7EA 3X0DA 3A7DA 1YZ3A 2FK8A 4FGZA 3KQYA 3UJ8A 1SKMA 3ER8A 4ER5A 2PLWA 3G5LA 4K6MA 1JQDA 2YR0A 5HIMA 4YV2A 3G2MA 3HCEA 2P1DA 3TRKA 5F2OA 2R6ZA 3VC2A 3SSNA 3LDGA 4Y2HA 3FPEA 3BWCA 5EMLA 4KDRA 4IV0A 2GLUA 2O07A 3HP7A 3FUWA 3F4KA 4HGYA 5DM2A 4BLUA 4C04A 3SR4A 2JG3A 3G7UA 2HNKA 4V0QA 1X1CA 3LDUA 1X1AA 2FRXA 2K4MA 5G02A 3T7RA 5CUQA 5FADA 3EVDA 4AZSA 3BGIA 4HTFA 1XTPA 4HH4A 5EPEA 1DUSA 2ZZMA 5F2NA 1D2GA 5DX8A 3L8DA 5E2BA 4IKPA 3GU3A 4PCLA 5EMMA 7MHTA 4ER6A 3C6KA 5EVJA 3NVKI 3NDJA 2AVDA 4PCAA 4YUZA 5LQAA 1NW7A 1KR5A 5GOZA 2PT9A 2QRVA 3FUTA 3M6XA 2OPBA 3C3YA 4RV9A 3CC8A 3LECA 2G71A 3GO4A 1B42A 4HRAA 3DOUA 4E2YA 5CVJA 2XYVA 3GDHA 4RTLA 2OB1A 2PX8A 2XYQA 3FTFA 4RTMA 5BW4A 2PXAA 5ICCA 2XBMA 2PV0A 4E2WA 3LCUA 1XJ5A 2IIPA 3TKYA 5LQCA 2ZZNA 2ZTHA 3V8VA 1H1DA 1TPYA 5K03A 4E32A 4ISCA 5F2KA 2PX5A 2ZWVA 4X61A 5E9WA 2AOWA 3EMDA 4DM3A 3M6WA 3BKWA 2IH5A 4C07A 3HVKA 5GM1A 2P3QA 1XDUA 3SMQA 3KQSA 1N2XA 1BKYA 1N7IA 1YFLA 4OA5A 4MHTA 1PRYA 2BR5A 2XVMA 3SM3A 2P7HA 3A7EA 4XCXA 5FHRA 1XCLA 3P9IA 1TW3A 2ZFUA 4FP9A 1VL5A 1O9GA 4HSGA 3P97A 2FYTA 4GOOD 4KRGA 5K09A 3LCVB 1ZKDA 3P8ZA 4PGGA 3U81A 2AZTA 3OZTA 4YUWA 3IHTA 1XDSA 3R24A 4RVGA 1WS6A 3ANXA 5EKUA 3A27A 3GWZA 2AOXA 3FYDA 2ERCA 2PT6A 4PYOA 4WVLA 3EGIA 5CVEA 3EVFA 5EQJB 5CVVA 5D1NA 2WA1A 2OYRA 3ELDA 4POOA 2IBSA 1SUIA 3QOWA 3GRZA 3TR6A 1RI5A 3FRIA 2P35A 3GRRA 1NW6A 2C7QA 1VP3A 4QDJA 3A26A 1G6Q1 5EIWA 1Z3CA 2VDVE 1VQ1A 2Q41A 3TKAA 2P8JA 1ZGAA 2KW5A 2UYOA 4PYKA 3LHDA 2CWWA 2ZBPA 3AXTA 4PIPA 4CKEA 3GRVA 3DMGA 4RYLA 4YMGA 3MQ2A 4C03A 1KPGA 3UFBA 5U4XA 3FPFA 3CJRA 3MTIA 5ICGA 1NBHA 3GGDA 5C0OE 2V74B 4BLWA 3M6VA 2YVLA 1RI3A 1KHHA 3T7SA 3HA5A 5EC8A 1NE2A 1RI4A 5H02A 3EVCA 3DXXA 2B2CA 2ZIGA 9MHTA 4PNEA 3QOXA 1EIZA 3B89A 2EFJA 3TM5A 3BXOA 5ERGB 5DSXA 4AZWA 1VBFA 1NKVA 1WZNA 1AQIA 1M6EX 1I4WA 1EAMA 2BR3A 4PYQA 2HTEA 5GM2A 4P7FA 1FP2A 1D2HA 2ESRA 3AWIA 4DCGA 1SQGA 2NXJA 2YXEA 3GRUA 3M33A 5EIFA 5FWDA 1R00A 4F84A 3PFHA 5JUWA 3TQSA 3P2IA 3R6TA 2PX2A 3P9NA 3PX3A 3MCZA 3PX2A 3EVAA 4GOLD 3KR9A 5EKXA 1G38A 2JHCA 2AN4A 2PKWA 2NP6A 2PJDA 1FPQA 4ZTBA 5BXYA 5KS2A 5HIIA 1IM8A 5HILA 4M7RA 1M0EA 3HCFA 5GIOE 2NXNA 4R05A 3ER9A 5K01A 2B9EA 3I58A 4RTKA 2O57A 5HIJA 2BZGA 2XYRA 4M38A 3SXJA 1JSZA 4EVIA 5LSAA 1ZQ9A 3EVGA 4OBXA 3CGGA 1JQEA 1NBIA 3EEYA 4P7JA 3ELYA 5FA8A 4BP1A 3E7PA 2IBTA 2H1RA 5FQNA 5C1IA 1JG2A 2WK1A 4PYLA 5KYGA 1D2CA 1VLMA 3HCBA 2I9KA 3GIWA 3KPWA 1VE3A 3KHKA 4E70A 3HCCA 3B5IA 2O0LA 2IPXA 1YZHA 3HEMA 3UBTA 5CCXA 2OBFA 5B1SA 5CCBA 1XXLA 3CJQA 3I9FA 5DT2A 5IH3A 5KVAA 5DTRA 3BT7A 1UWVA 1P1BA 3SX0A 4OQEA 4C08A 3HVIA 3MB5A 1Y8CA 2O06A 1MHTA 5T67A 1YUBA 1R6AA 3M6UA 4GOND 4QTUB 2YQZA 5HFJA 2ORED 4MTLA 2CMHA 4BY9E 4C4AA 1DCTA 5D1HA 1JG3A 2OZVA 2PWPA 3M4XA 1R74A 4QVGA 5EEHA 3DUWA 5CVUA 1P1CA 2Z6AA 2FPOA 5E8RA 3EVEA 5E1OA 1EQAA 5JR3A 3M70A 3Q7EA 4V0RA 3THRA 5LQNA 3OU2A 3BGDA 1NW8A 3KR2A 3KQOA 5T64A 3DLIA 3BZBA 5CIYA 5E1DA 3HCAA 3I5UA 3FTDA 3DLCA 4AX8A 2C7OA 2VDWA 2OY0A 3R0QA 2C7PA 2VDUE 2LD4A 3EPPA 1FJXA 2PSSA 3BUSA 4RTSA 2GPYA 3KQTA 1SVUA 1KIAA 4MIKA 2DULA 1P39A 4PYIA 5EMKA 2NP7A 1YF3A 3BWBA 2I6GA 3P2KA 3PT9A 4R6WA 4FZVA 4IV8A 3KQMA 1JQ3A 5P8WA 3DXZA 5E1MA 5K0LA 4QQNA 2PX4A 1OR8A 3ELUA 3FPHA 5LQJA 3EEOA 3DH0A 4EMSA 1AV6A 3LCCA 1L1EA 4NECA 1RJGA 2P40A 3EVZA 1FBNA 1NV9A 3REOA 3OZRA 3TMAA 2ZWAA 3R9XB 4FR0A 2AOUA 4M36A 4CKCA 2IH4A 4P7KA 3VYWA 4IWNA 3HCDA 2A14A 2JHAA 3WSTA 4DCMA 2G8NA 2N47A 4ER3A 4YUXA 1Q0SA 3KQQA 5DX1A 5DTMA 2PVCA 4CTJA 4XUDA 5EEGA 3KR0A 3TM4A 5K0EA 4RVFA 4JXJA 5K0BA 2CKDA 3HNRA 3IV6A 1MJFA 1P91A 4KW7A 1VP9A 3O4FA 1BOOA 1DL5A 1HMYA 2BR4A 2AN5A 2FK7A 2DPMA 3KPJA 4YV0A 3MERA 3Q87B 1AQJA 5HZMA 3E8SA 2UZ4A 5EMJA 1M6YA 4FS8A 1QZZA 3DTNA 4EQZA 3UZUA 1ZG3A 1UIRA 4OBWA 2VZ9A 2GAFA 2VS1A 2XVAA 3IYLW 2B25A 1QANA 3KQPA 3C0KA 2ZIFA 3P9KA 4R6XA 3JWJA 5FQOA 3MCTA 4QQKA 5E9QA 3LGAA 2ZSUA 3LBYA 4OQDA 3UA4A 2IH2A 4EKGA 4ATNA 4HC4A 3TOSA 4R8SA 1TW2A 4AZTA 3UJ7A 1JR4A 3ERCA 3I64A 1X19A 3RODA 3G5TA 4CWAA 5DTQA 4GC5A 2OXTA 2F8LA 2R3SA 1V39A 3BWYA 3NWEA 4YV1A 1SQFA 1PJZA 3LPMA 4XUEA 3B3JA 2G72A 2NXCA 4E31A 2BH2A 1QAOA 4P7GA 3VC1A 2ZLBA 4KIGA 3P9CA 5MHTA 1KXZA 2PGXA 4PONA 1R8XA 3UJAA 3BGVA 4DQ0A 4FT4A 5DX0A 5EHGA 4RSRA 3NMUF 5M5BA 5FHQA 1XDZA 1KP9A 2JH8A 2VP3A 4GUAA 3LL7A 1ZGJA 2Z6QA 3JWHA 5K0NA 2PWYA 1RJFA 1O54A 2P41A 2ZIEA 3T0IA 5ICEA 2P3LA 3ORHA 2BM8A 3EGVA 2HV9A 2P7IA 3PLAE 3CBGA 3K0BA 4B17A 4MWZA 5GIPE 3DXYA 2H00A 1SG9A 1R18A 3K6RA 3KQVA 4FSDA 5T6BA 4YUYA 4PYJA 4HG2A 3NDIA 4GC9A 5GINE 4YMHA 5GWXA 2H11A 3SSOA 3FTCA 3TPZA 2EJTA 3G2QA 1F3LA 4DF3A 3CVOA 5HIKA 3FUVA 3OFJA 5CVDA 1L3IA 3S68A 1YB2A 3HM2A 1JTEA 1QAMA 3T7TA 5EZQA 4RVDA 4CXMA 3EVBA 4AZVA 2HMYB 5GP1A 5LR6A 3FYCA 5EGSA 1O9HA 2FHPA 1UFKA 3B7PA 4U7TB 1I9GA 1KYWA 4M37A 1XCJA 4O29A 4KWCA 3SGLA 2PXXA 3PVCA 2YTZA 4KVZA 5DM4A 1NW5A 3DP7A 2IFTA 3G8AA 3QV2A 2IGTA 2AOVA 4A6DA 2BM9A 2WA2A 2YX1A 3E23A 4C05A 2Y1WA 4CTKA 4KDCA 1EG2A 2NYUA 5DPMA 1XVAA 3KPVA 4FSXA 1SUSA 3B3GA 4OA8A 2QYOA 2ONZA 3GCZA 3KU1A 5CM2Z 3A4TA 3LKDA 1JTFA 2Y1XA 2AVNA 5EHIA 4DA4A 1KYZA 3EGEA 3KQWA 2AS0A 3UJ6A 4ER0A 3NVMB 4EKIA 3LX6A 4OX9Y 1YFJA 3HTXA 1ORIA 4XUCA 1EJ6A 1I1NA 2ZBQA 5DXJA 3NWBA 5K0GA 5KQRA 3SSMA 2OB2A 3AJDA 3LKZA 2GS9A 1AF7A 1WG8A 1G55A 5DXAA 1JG4A 4RX1A 5DM1A 1RJEA 3KKZA 5FA5A 5LQUA 4DZRA 3OU7A 5LQRA 2UYHA 2ONYA 4BP3A 3MGGA 4WXHA 2FCAA 2G70A 3EMBA 1FP1D 3PB3A 4QVKA 3HVHA 3FZGA 4RVHA 3AY0A 3RIEA 3FUXA 4DMGA 3VSEA 2ZZKA 5E9JA 4QPPA 3MAGA 4CKBA 3P2EA 3R3HA 2O05A 3FUUA 4E2ZA 3AXSA 1HNNA 3NW9A 4G56A 5E2AA 2IDJA 5CD1A 4YUVA 3UJ9A 2YUIA 1NW3A 1RI1A 4QPNA 4UOEA 5FTWA 4F85A 2P3OA 3NTVA 1JG1A 2I62A 1ORHA 2OO3A 1WXXA 3OU6A 5DRTA 3UA3A 2E5WA 4GQBA 1T43A 4RWZA 2ZVJA 4MQ4A 2UYQA 2ZW9A 3FPJA 4LECA 4PWYA 4PINA 1ZHFA 8MHTA 2YXLA 4BLVA 3G2OA 4RTRA 1EJ0A 5DSTA 3NJRA 3TFWA 2YXDA 2QY6A 3DMFA 4GBED 1L9KA 3DR5A 2NNWB 2IDKA 3I53A 1IY9A 3C6MA 3KPYA 2CMGA 2GA9A 3LDFA 4Z2YA 3C3PA 1JSXA 5C9ZA 3D2LA 2HWKA 3OCJA 1F38A 5IKMA 3OFKA 3OZSA 2AOTB 2G1PA 1G8AA 1N7JA 4GOMD 3G88A 1VIDA 3HA3A 3TLJA 4RTPA 3CCFA 3G8BA 3KPUA 3H2BA 3KR1A 4E2XA 3DULA 5K0FA 2NXEA 3CJTA 3BWMA 1QYRA 2EG5A 2ZCJA 2ADMA 2PY6A 1BHJA 5HOQA 5K0JA 4RTQA 10MHA 4RTOA 4U7PB 4X63A 5FCDA 2CL5A 3LSTA 2JH9A 4H0NA 2OKCA 3A25A 1RI2A 5HEKA 2GH1A 5FWAA 3V97A 5LQKA 2JHPA 2QE6A 1WY7A 4C06A 4PYNA 5FULA 4A6EA 5K0CA 3THSA 4DKJA 5EOVA 4RTJA 1INLA 4HGZA 3JWIA 3IEIA 3E05A 1IXKA 4FT2A 2UYCA 5FUBA 1QAQA 1X1BA 5DLYA 3P71T 2ZULA 4ER7A 5DM0A 2PBFA 1VPTA 3ELWA 3MHTA 1RJDA 1L3CA 4PIMA 2HR1A 4QDKA 1KPHA 4LG1A 1X1DA 1Q0TA 3FTEA 3FPGA 4HTFB 3SVZA 2GB4A 3JWGA 4E30A 2PXCA 2AR0A 3UJCA 5K8VA 2EJUA 3GJYA 5EZSA 5BW5A 2IP2A 5DWQA 1L3BA 3PTAA 4GF5A 5KQSA 2Z6UA 1KPIA 3G2PA 2B3TA 4X60A 5DRYA 2B78A 1WXWA 3ID6C 5EG5A 2QRVB 4Y30A 1G60A 2AN3A 4L7VA 1BC5A 3GNLA 3DMHA 4E33A 4PGHA 3OPNA
chains in the Genus database with same CATH superfamily
3I09A 4KDEA 4KXFB 3FWHA 2ZBRA 4H7DA 2IYVA 4MVCA 3REGA 4LF6B 4KIFA 3SP1A 1P72A 1Y9JA 3DDOA 1UXIA 2V54A 1CV2A 1DRJA 4V0NA 3A4NA 4DNFA 1I30A 4OPMA 4GMKA 1BEZA 4R7ZA 5CA0A 1J8QA 2ZT5A 3EW9A 5AM2A 5T8KA 4QOSA 1PT8A 2G25A 4J0JA 4B3SB 1ZH2A 2JJQA 3PYMA 4GG1A 3RSLA 1GYRA 3N59A 2HJVA 3EXG1 3VBEA 1JBQA 2CNNA 3PNLA 2YUJA 3H42B 1ESEA 2IEZA 3L49A 4KXNA 1JRLA 4QXOA 1Z63A 1HORA 4EA8A 2YW2A 1E6CA 2FSFA 5ED4A 4HXYA 3JYNA 4PCUA 4TMZA 4I08A 4CMEA 5A4MS 2C95A 3PXAA 1R0KA 4MUMA 1EK1A 1N0UA 1VJDA 2QRUA 3IHKA 3LP8A 4I5DA 1A5TA 4NG5A 4TKZA 2CXNA 2XB9A 1SBTA 3DBRA 3Q8WA 1MGPA 1ONSA 4RK1A 3TRKA 4QTZA 1UCFA 2EW1A 4REOA 3ZDFA 3C1TA 3PQCA 3QVSA 3UQYS 5JBNA 5IH7A 3KLNA 3HP7A 2FLVA 1F2UA 1E4EA 3AKZA 2JG3A 2EX0A 2WTXA 3T0GA 1FTQA 1UDXA 4M86A 3MLAA 4OD0A 1R7RA 4DA0A 1X1AA 3OFND 3FOFC 1QKKA 5H82A 3VO1A 1JXMA 3DMNA 1A5SB 3DR3A 1WDLA 2OZLA 3FBWA 4ZZ1A 3NONA 2NV0A 2Q4EA 3WLJA 3JQFA 4L02A 1F4LA 2WUEA 1SC4A 3MXTA 3FSGD 3NUZA 3GLGE 1UFQA 3KKKA 1BXGA 1Q1ZA 1JEOA 1SVKA 1QB7A 3EIWA 3DF9A 2BKEA 5FTMA 1V5FA 3E9YA 3VYUB 4ARCA 2C4VA 4HRVA 5H83A 3AVVA 4DCOA 1X0VA 3L7CA 3ZHTA 4F3YA 1E6EA 4YT2A 1F7VA 4HRAA 2PU5A 4J0FA 2JCXA 2QQSA 5T4BA 5AW6A 1BH6A 4OMCA 3GUUA 1LDMA 4RY2A 5TPWA 4G0MA 2IYNA 4ADSG 1YMVA 1TK3A 3DS8A 4UQOA 2QW1A 2WJJA 2XBUA 2GM9A 2WD7A 3ECSA 3TVTA 5DHFA 3OQIB 4ZDJA 4N3NA 3NYWA 2HSDA 3MNFA 3RTBA 4MQ6A 1ISPA 2IHYA 3PZRA 2P1ZA 2NO4A 2WJGA 3OEHA 1YC5A 1LSOA 4WOPA 2PS0A 4OQFA 4ENUA 3HDGA 1NXWA 1V7ZA 1XRLA 2QMHA 1J1UA 3HP4A 1IOWA 4RGBA 4IRMA 2EYUA 4FP9A 2OENG 4ZZ3A 1DDGA 2HADA 2AI1A 1NMEA 1Q7TA 1GFIA 1ZX1A 2OZPA 2ZRHA 5EAIA 2OT3B 3DTTA 5FJIA 5IJAA 2QVCA 2UZ1B 1OU4A 1ZOLA 5LP6B 5J2UA 1M6HA 2I22A 1FMJA 3GWZA 5FBHA 4JR2A 2PL3A 5DIFA 5EQJB 1N6KA 3QOWA 4R01A 3WDKA 3KE8A 3OE7A 3QSYA 1DUVG 1EEHA 5DHSA 2C7QA 1CZNA 1V9SA 2GEKA 3ETHA 3M9XA 4D3XA 3A26A 1G8HA 1NXXA 3EBOA 2RAVA 1IPEA 1VQ1A 3CUKA 4NONA 4YJHB 3OEED 3GJRA 3LHDA 1SUDA 1P5ZB 1XLVA 1WCXA 5D2CA 3AR3A 3DMGA 3L7LA 1UJMA 3HKBB 2ZXUA 1CT9A 1ST2A 2HJSA 1UPBA 3GJTA 5HHTA 2Z83A 1Y1SA 1YL6A 1Z5NA 4B3GA 3I4FA 2GQ0A 2W37A 3L7JA 1WBJB 3DBIA 5KVSA 1DJNA 1UANA 3GDGA 5KOIA 2JLUA 2QD1A 3LF2A 2GF2A 2AGVA 4I6EA 3BMQB 2A0KA 1E7YA 2RI6A 2XGMA 2Y4OA 3GFSA 4TTVA 1TMGE 2AEJA 2C29D 1U2DC 3DXXA 3HNOA 1K08A 3A1NA 3AT1A 3E22A 2C7GA 4D5EA 4PNEA 4LRQA 1JIQA 3D7SA 2WPDA 3C3KA 2HHHB 3D8UA 1NW4A 3AOEC 4MI6A 5C5IA 1QB8A 1L7DA 1GQSA 5CT4A 1FS5A 4DR7B 2CN1A 1FTSA 1R64A 1FE8A 4P7FA 3NTLA 2Q46A 2YXEA 1AQNA 3NKFA 4A8TA 2R25B 4DLNA 4YBRA 2XUDA 4GP9A 2ZYTX 3AFGA 3L46A 4U6NA 4J0EA 4B48A 5BWNA 2BHNA 3QEOA 1E6LA 3VVLA 1QP4A 2G82A 1YUMA 2YOHA 3OZ7A 1GTG1 1Y6JA 4BJHB 4X65B 3QNUA 4ETNA 3GCWA 4A82A 1U0RA 4PLWA 2CL6X 2QX8A 2XDWA 3GFQA 2YMMA 1WX1A 4L4YA 4M7RA 1DT5A 4GPIB 4MWSA 5JU6A 2H0RA 1U5CA 2PAFA 2GK3A 3LI2A 2PRZA 1X0XA 5HIJA 4NE7A 3ZOZA 4BO9A 4EHAA 2LCQA 1WZ2A 3E3MA 1E3TA 1SBYA 2IDZA 5IZCA 1TCVA 3OKPA 5FPTA 4Y7CA 2AK3A 2ONKA 1E58A 1BU8A 5AKIA 1A7AA 3HCBA 5ALVA 1QZUA 3CF6R 1IFXA 5ESRA 2AX3A 4DRXB 3INYA 5L3SA 3HBAA 1KRHA 3BTOA 1Y4UA 1GVHA 1YZHA 1M6NA 2Y67A 4RVSA 4D6XA 1J6UA 2P0YA 4DRYA 3UCEA 4E14A 3R8XA 2A1UA 1P5FA 3E3NA 1I2DA 3DVSX 4D92A 1UWVA 3DEJA 3R7NA 2EOAA 3NTRA 1VA5A 1VE7A 4BAGA 1QHXA 3MQ4A 4QDUA 1QHHA 3DLHA 3ABOB 1I5EA 1NVKA 2FEKA 3N8GA 3KDSE 4FEAA 4C4TA 1R50A 2CV0A 3AGQA 3E81A 4UQLA 2C3OA 2ZR8A 4QOGA 2IHBA 4I4TF 1ZZEA 3CEMA 4CQLA 5EEHA 2QQRA 2OECA 5AQEA 3W2HA 1P1CA 1OYVA 1AJEA 1XF9A 3OPMA 1I1OA 3OUUA 4TX1A 4C6RA 3U6BA 2WMNB 1AZWA 4KXLA 3SY8A 4CHGA 4IDAA 4XH9B 3UAWA 1O03A 1SU4A 4U9HS 2JGKA 5FOUA 2R8XA 4QFBA 4C01A 1I7QB 5KNCD 3HCAA 3L0IB 3RVSA 4JC4A 3UXEA 2WFMA 1VYTA 1CUVA 2ZBUA 2VDWA 4I6GA 1MX5A 4CMHA 2YWRA 2VPWA 4CR7A 1KXJA 1XMXA 4PG6A 5F1PA 4FE4A 1FJXA 5P21A 1FTYA 5CJJA 4RY0A 2GCOB 3K0CC 1FC0A 1Q1BA 3F7TA 1QCYA 3P0RA 3SICE 4CM9A 4EABA 2QT0A 1R4ZA 3UAXA 1SZJG 2VQSA 2W2NA 5TE9A 5B2EA 2WZCA 2XMZA 1E4OA 1XROA 4BLRA 3V2UA 1HG0A 3SKVA 4U2KA 3RVLA 5P8WA 1IBRA 2X8LA 4HWSA 2PMWB 4FDLA 2WJIA 1A3CA 1LV8A 5AKGA 5THXA 4IIJA 1MO2A 1XZMA 1GPAA 1L1EA 1OILA 1R5NA 2NQ8A 3LAWA 4PHCA 4V0OA 3A1UA 4BP8A 4ZI3A 2A9VA 4U2BA 1HYQA 3OZRA 2OA0A 3PGMA 4FIDA 4PWZA 3EH2A 3OZWA 5JTTA 1IZYA 2FMKA 3IPRA 1AQUA 1YTUA 1M66A 1J2JA 2ZKLA 1OYWA 2XVXA 4ND3A 2II6A 2QRPA 1XMIA 1PWYE 3ZGNA 2CMFA 3DWIA 4W5HA 4QBKA 3UK2A 1U0LA 4L3VA 2HYDA 2Q9UA 3QYAA 4K9OA 1KDZA 2BHTA 3JV7A 1N2JA 3T7CA 2QVBA 1NVUQ 2XD9A 1U1FA 4OKNA 4PQFA 1QHIA 4L75A 2C4HA 2HPZA 3ROEA 2FMXA 3A9SA 4JUAA 4MVJG 4C0BA 2VJYA 3MTQA 1ESNA 4Q9NA 4MLPA 2VJAA 5CX4A 3ZY3A 4BVEA 2JFQA 2YH2A 4LY9A 2ZIFA 5EYPA 2R65A 4G9EA 5B7GA 1P61B 3AHIA 3QPAA 1J23A 1JILA 1QJ4A 1SA0A 2CNBA 2IHZA 2XQGA 3BIOA 1KAMA 3EZGA 3LHSA 1GPNA 2OXCA 2P4UA 1C3JA 2X4DA 5CITA 1JX6A 4Y6PA 3UJ7A 1DLIA 1POWA 3NIBA 4G8CA 5A06A 3OD5A 1M2WA 1GQYA 1QE0A 2C58A 1AF4A 2E4UA 2ASVA 1M1NB 2FRDA 2JIQA 2YJ6A 3FBTA 4ZCLA 3ZWXA 5JWOA 2H5JA 4G0OA 4O0LA 3L5KA 5DTQA 3OZXA 3PUIA 3W7VA 2R4QA 2RI0A 3VTZA 5AW0A 2QUZA 2YFQA 1RQLA 2FXVA 3JRWA 2CEAA 4OJYA 4YHBA 4I55B 3IIMA 5ALKA 2P9CA 4KIGA 2IY7A 3ROFA 3P9CA 1M1ZA 4J4TA 3PQDA 4FBLA 3HY4A 3WNQA 2Y1FA 4A5OA 3Q6IA 3I76A 3VISA 3EZ6A 4DV7B 1UBEA 5A2QA 1X74A 1RQPA 1LW6E 2KB0A 2VJNA 3GFRA 1X9GA 2D7DA 1G6OA 1L7QA 1MQSA 3K09A 2O3JA 1DTWA 2BF7A 5K0NA 3V8RA 2R7MA 2LP4Y 2Q1UA 3QMPA 5CDSA 2IPAB 3C24A 4TSKA 3U48A 2JAPA 1QS0B 1TVKB 3P2MA 1X7ZA 3CBGA 4JI4B 4N9QA 5GZ3A 5KZMB 5AHOA 3KEOA 2IF0A 2FWMX 3OA0A 1XZCA 1Z0DA 1AB5A 1PDWA 4W6ZA 1N4AA 3RD5A 5LPNA 2FG6C 2QNBA 3EDCA 4XJSA 4EYOA 4ZCRA 3C3DA 4DSAA 4YMHA 1RPAA 3G1WA 1C30A 3NU1A 4PS0A 3TMYA 1P74A 2PA3A 1EVYA 2BT4A 3USCS 2YV5A 1R6DA 2CBGA 2P5TB 3QVTA 4GPBA 3WS7A 3HM2A 1JKJA 1GGKA 4GW3A 2OM2A 2DT8A 3EVBA 3PPVA 3A4VA 4WOJA 4D41A 1UK9A 4GECA 1NULA 3HRHA 5J9FA 2WF7A 5L6MB 5JSKA 2XWBF 4JENA 4RK6A 4ESOA 5KC8A 4B2IA 3M6LA 2CXQA 4X95A 1NW5A 2CV2A 1L2TA 2I87A 1I3LA 3KKOA 4DDKA 3OLXA 4TTAA 1SCDA 3T1HB 5L95A 3K4QA 3IKJA 5GLFA 3QE3A 4HQ6A 3WYEA 4KI0A 1EG2A 2NT3A 3NCTA 3PA8A 4XEHA 4CEJB 1NSYA 2EFGA 3FDZA 2X76A 3KJQA 4ZVNA 5DXFA 4DCJA 1UMCB 5B57C 1C4WA 1EINA 3DHVA 3EXAA 4F93B 4R81A 1B2RA 2CSXA 1RQXA 3RTEA 4Q18A 3SVTA 1ABEA 5AVZA 2Z6QA 5FIUA 1SPXA 4PGFA 1O5TA 1GO2A 2IELA 1IPHA 1G1AA 3N8NA 1M2NA 1OF1A 4Q02A 5DXJA 3VJMA 5IANA 4MV1A 2MSKA 3JAWB 1U63A 4TYYA 4UM5A 4LHSA 5FOTA 3IT1A 1RDFA 2O5RA 5J4YA 2YJ4A 1NNI1 3NHWA 4QEDA 2R8OA 1XZQA 2Z5GA 3AM4A 3LPNA 2ONYA 1ZXLA 4OI2A 5EXPA 1QGUA 2ZCUA 3KO8A 4G8DA 3EEQA 5KNBH 5F76A 2QAIA 3RI3A 4HAWA 3VPXA 4G0UA 2A57A 4RV0A 4PLFA 3PCRB 2CNWD 4UEWA 4N12A 5CW1A 4AKSA 2X9NA 4B3HA 3VYVA 1CRZA 3UKDA 1ZD2P 3KSZO 1SQSA 1JDUA 4E5KA 3M89A 2FPPB 3OPQA 1LNQA 5ELMA 1V47A 3BT7A 2Q5EA 4P38A 1WF3A 2W2MA 5FTWA 3AU9A 5DI3B 5FUYA 1JG1A 1I36A 2AQ8A 4N3CA 1QXSA 1WXXA 1Y1RA 2FR8C 3EDOA 2R1TB 1DPGA 3BWDD 3Q3GE 2E5WA 3FJ1A 3R44A 4QA9A 3S44A 2EGGA 2FG5A 2VTKA 1YQGA 1F9EA 3BIXA 3OPYB 4RFSA 4ARIA 3WL8A 4IO0A 4Y7DA 5ITSA 4MCIA 5HYVA 3C5HA 2C98A 3O94A 3WYAA 4TKUB 1AURA 3V32A 2YXDA 3DMFA 1GR1A 3CTMA 2ZJFA 1UPXA 1NM5C 4DV5B 3NLLA 2OESA 1W85B 1WKVA 3IVGA 2ZR0A 2RAUA 3ZU4A 1V9LA 3C4QA 1ZCAA 1UDBA 2D2IA 3C3PA 4IMJB 2OE2A 2Q4OA 3OJCA 1I5RA 1U99A 4F5DA 1PWZA 2PL5A 4G8BA 1O7JA 3AVXA 1K8YB 1I7LA 1MO4A 2YWBA 1V16A 2IGBA 4GMXA 3WICA 1RAEA 2GZSA 1HDEA 1EZZA 2VQ3A 3TTYA 3ZWWA 5L3VA 2NXEA 4ND4A 5TY0A 2EZTA 3FLMA 3ZX4A 1QYRA 1ZSYA 1DWQA 4DJTA 5MN5A 5DWDA 2IX3A 3OTOB 3KLOA 5IBRA 2BI7A 4PQEA 3I3SR 4XD7A 4GBJA 4QEKA 1WOYA 2J31A 2CL5A 5A4AA 4MOWA 2CWDA 4YECA 5GOTA 1F4VA 3TD6A 2P2SA 5FTLA 3FOEC 1NBWB 3HJCA 1E9VA 3K9FC 3L40A 1V5IA 4DQXA 4JBGA 1KF0A 2OCIA 4FKBA 4RH1A 4E4YA 1S1MA 5JWHA 2ODBA 3SZRA 2REOA 1VDMA 2YYAA 3AF0A 5SYAA 2IEDA 4DKJA 2DUUA 1QTRA 2ISSD 2JAUA 1MKYA 2YRFA 4FT2A 4BB6A 1BWRA 2OQIA 3L0BA 1TADA 1XNJA 4NIMA 3IAS1 1UEJA 1RWXA 1OGIA 2QRHA 3AEKB 4TT3A 1CQIA 1KKLA 2TECE 2WKPA 5F1OA 1ZDMA 1VFPA 1Y5IA 3CKYA 1CNMA 3R9KA 5KTKA 1XJWA 2RHJA 2VWPA 5I7RA 2RH8A 4CMEC 4O4IF 2B21A 1R9JA 2GN0A 5A7GA 1ZMBA 3UJCA 5BV2P 4XYEA 4IP0A 4NF2A 4Y2YA 2IY9A 4HRXA 1G0NA 2C83A 3IB3A 1DOHA 1TVEA 3PC6A 4BWGA 5CDUA 2Z6UA 1L4YA 5DJ5A 3K5WA 1JVSA 3R4VA 4M1QA 5FAXA 2WVGA 4YPFA 2KYRA 3W90A 1ODTC 4E08A 4F3KA 1W25A 4EPRA 1M2VB 1ZU4A 1W48A 1NTRA 1CD5A 2YC2C 3OPNA 4PGHA 2ZAMA 3DM9B 1GNTA 2ZSIA 4BKOA 1YB6A 1R8YA 1A95A 4MZDA 4PTZA 7REQA 121PA 1G8SA 2GJ8A 2GLTA 4J2TA 2RGXA 5KWVA 1QQBA 1J09A 2QRNA 4LZPA 5CEEA 4KO8A 3DBOB 3JQFC 4LHEA 4PYMA 4G6ZA 3L4EA 3WLMA 1XQ1A 3DV9A 3AJEA 4IYJA 1MPXA 2FCRA 4I5GA 3VO8A 3ZV5A 3QTTA 5D6NA 1MV8A 3I1JA 4C4OA 3L0SA 1G8YA 1GM5A 3L41A 2Y4NA 3TF5A 1JKIA 2FWAA 3O31A 4G4IA 4JL5A 4EHIA 4X0EA 4CKCB 4J7AA 4QYWA 3HJAA 4I9FA 4QT0A 3L7DA 3EIHA 3JAKB 4K2HA 2WIDA 5HQ3B 4CGYA 5CXUA 1TM1E 2O4UX 4D3ZA 5C5CA 4ACAA 1PNQA 3EFHA 2JFGA 4MJXA 2B83A 3SHTA 2WSMA 1DX4A 4CL3A 1DQYA 2B1JA 2ZE8A 3H1FA 3LXUX 4YEDA 3JVEA 3ZI7A 1GLNA 3ZGZA 3PJFA 3AVQA 4NFSA 4OAQA 3RH0A 3A06A 2QTVA 5B4VA 3K4PA 4X7RA 4EYEA 3A37A 1GGHA 3ZCRA 2WU1A 1BCSA 1LQ2A 3H8VA 1ZJ4A 3WRVA 4BLUA 1N2CE 2DMRA 2NZXA 2ZI3A 3QVJA 2ZI9A 4MW1A 1DQPA 2X77A 4X6LA 5JS7A 2VJKA 4YDSA 1U8CB 1XYGA 2GCPA 1R27A 1GA4A 2VH2A 3GZNA 5AP9A 4AZSA 2ZR9A 4RGYA 4KMOA 5DBEX 4A0GA 1AKQA 2R2AA 4WASA 1TFUA 1OC4A 4B9EA 1U9IA 2OD7A 3D31A 4OM8A 5KYYB 1I94B 3RTAA 3TS1A 4XDHA 3IH5A 4DUYB 4HO1X 1KR5A 3W05A 5BO5A 2Z95A 5HFNA 4A6XA 2W11A 5CBPB 1D1SA 2VBIA 2Q3DA 1J9GA 3EIXA 1KU6A 4OFBA 1T34A 1LDYA 1E7SA 3ZE8A 4E2YA 3WLIA 5BNTA 4NAVA 1KMNA 5LD2C 1HQKA 5ICCA 4LTNA 4XRGA 3RJTA 5LQCA 1O8CA 2XZTA 3MSCA 5AVJA 2AG0A 3LHFA 1BFKA 1SQ6A 4L6CA 3GVXA 3KFVA 3BRWD 3IBGA 4RK7A 1X1QA 4UHKA 4DSUA 1HTWA 2EP8A 3RFTA 4B71A 5J4LA 5AUNB 1MC8A 1BS2A 4WSOA 1TQDA 4RNDB 1HNWB 1KZGB 5K8LA 4XCXA 4FGLA 4DIMA 1PGPA 4D80A 2RHDA 5EL0A 1T4DA 1VL5A 5FBWB 1MVNA 3RC3A 3VU0A 4DJAA 1F7UA 3MOGA 4XJVA 6GPBA 2ZJ0A 4K26A 3S27A 5JFTA 1XWFA 3GGOA 2A3RA 2ZJ8A 3LZCA 4MDFA 3LW7A 5JADA 5KX5A 1NNUA 2NZYA 4G1MB 4FZ5A 4XR9A 1NVFA 3ELDA 1P2VA 1EFCA 1ZIXA 1FEZA 1QGDA 2IXBA 4NCXA 4XGNA 1M1XB 1BYUA 2P35A 2JCBA 2BDTA 3UJ3X 4BLQA 3HJNA 5CFZA 1VP3A 2YWDA 3DL4A 3I9LA 1T2NA 4G0VA 1KMIY 4B5LA 2QROA 2OZEA 4HB3A 4CKEA 3ANLA 2J48A 3GRVA 2WAAA 3NQ41 5JVDF 3GRAA 2WBLC 3QBJA 2QRKA 3TNJA 4U2EA 1Y5LA 3LCJA 2REXB 3PD7A 3PENA 4RK4A 4K9RA 3IUJA 1ZUIA 1UZAA 1Z75A 2VSXA 4FFBA 2ZIUB 2B36A 5IAGA 2AHOA 4ZOQI 1JHMA 5IZCC 5IT9A 3V8NA 2DC1A 1Y3HA 1GQFA 2LW7A 2DFLA 1RC0A 1ECJA 3DFKA 3QIAA 1PFGA 1QQ6A 1M8PA 2CVZA 1N6IA 3NP9A 3B1VA 4TVBA 4JLBA 4OGKA 3RAGA 1M3SA 2EFJA 3ONWA 5BWBA 5ERGB 3D0KA 1T1EA 3CBQA 3R3YA 4RIIA 2VC2B 1QLHA 2COEA 4I99A 1VE6A 1QIIA 3R41A 3AF3A 4IJMA 5LXTF 4BUJA 2TMYA 3MCAA 2H1WA 3CW9A 2XCSB 2B30A 2HMAA 4NS4A 3PFIA 4NR0A 3OQIA 4K9MA 3TQOA 3P9NA 1XXHB 4EY6A 1GAXA 1I7DA 4GI2A 3WGZA 4F1WA 3LZDA 1VLLA 3MUNA 1TIKA 2W6QA 3F7OA 1Z36A 2DUMA 1EFKA 3BMOB 4N5LA 1MX9A 3MBKA 1GUAA 3G0IA 3IUQA 2FJPA 2XRFA 3GGPA 2OXFA 1PCXA 1TQ6A 1JQEA 4MV4A 4P5PA 3WYCA 1BXKA 1Y3FE 1V4NA 2UZ1A 3OJ0A 1LQUA 1WMEA 1O87A 5BSMA 4ZJYA 3CNHA 3KOXA 3HWX1 3DKIA 2HDNB 2TS1A 4W1QA 3B1KA 3MSXA 1U3DA 1EA7A 2HF2A 2IPXA 3NHYA 4WEOA 3A1WA 3VKFA 1W36B 5KVAA 5IH3A 5AIBA 1B16A 4ZCQA 3AR6A 2H4HA 4LXXA 3ICCA 4YJHA 3MB5A 1Y8CA 1AS0A 1GPMA 1DUIA 3I0NA 1NX6A 3O9VA 5CURA 1J4AA 2QM8A 4HNGA 3ZWMA 5EE0A 4BNZA 1PLLA 3LBAA 1Q7BA 2ACKA 1DEHA 3THWB 5BR8B 3JQ8B 5D6YA 3O4VA 5K99A 1RRGA 3UBMA 2W9XA 3G9UA 3KYIB 3B9BA 2I4LA 3UMGA 4UDOA 4OREX 3O8QB 3CLSD 3TLZA 4BQNA 2JJ1D 1ZVJA 3G3EA 3LTEA 2CE2X 2FMUA 4DVJA 5LKRA 2MYTA 3PNQA 4N41A 1AQLA 2AUMA 3P5SA 2PH1A 4B43A 1RYMA 1S01A 1VSBA 3V4PB 2QD3A 3VNBA 1TKAA 1W5SA 1QGYA 3KDAA 3KT3A 3N8DA 1K68A 3ASVA 2IZ7A 4IHKA 4C4YA 4D9FA 3LRPA 2FDRA 3OMLA 1FRQA 4PYRA 3FTDA 2WWVD 1SWVA 2ZDQA 3VU8A 3NM6B 5I7FA 2IS1A 2ANCA 4ILEA 4BU0A 3HUFA 2RCNA 4UHDA 3PPWA 4XQGA 1ONPA 3ODPA 1F48A 2XF8A 3NPAA 5EY5B 3V7YA 4BVKA 1EP3B 1S3IA 2O2DA 3EXEB 3HC7A 3M6FA 5EFZA 3U3DA 3X2SA 3H8WA 4J6FA 2AG5A 4PYIA 4XX0B 4Q7LA 1O95A 1RPZA 4EG8A 2GJAA 1N8NA 3AFNA 4NY1A 4KK3A 2A59A 1FTGA 1GAEO 3LUPA 2KS6A 4J7UA 5KEIA 1YB1A 5EHQA 1YE8A 1ZVKA 1NBOA 3A1FA 5ADUS 1J8VA 3PD0A 1JFFB 3HEBA 4K1XA 1RIIA 2GHRA 1L5QA 2FRDC 2VO1A 3HUTA 3WBKA 4PLVA 2ZUVA 1TIPA 4FZRA 4JMLA 4X8OA 4DRXA 2BKXA 4Y18A 2DAPA 4UMEA 3STUA 4EMTA 5A6SA 5BVGB 2FDCA 5AKYA 4Z4IA 1A2KC 5EZ6B 1AD2A 4K6OA 4JKYA 2JS7A 1YRBA 4YRDA 4HH1A 2ZRGA 4DDUA 2EBHX 4H17A 1WVGA 4JFRA 3UM9A 4F3TA 1IMJA 4ZXFA 4V0LA 1UFRA 4PW0A 1HEUA 2FK7A 3E18A 1V0JA 3K09C 3COSA 1RKQA 2VK4A 4FS8A 4HEQA 5C5EA 3C7AA 3FGOA 4CIYA 4ZJZA 1IJFA 5F9FA 4LZAA 3TW8B 2HREA 2B94A 2OUIA 1JLLB 5ILGA 2VJMA 5SY4A 2IHJA 3WC4A 1G5TA 4X71A 2Y93A 4BFUA 1PJLA 3TOSA 2X86A 4HWRA 2CXSA 3H7IA 2H54A 1II9A 4Q3LA 3W8DA 4NBVA 5KQGA 3WGOA 3VA7A 5EZYB 5TEWA 3HJTA 4H6PA 5AK4A 4MGZR 5K6RA 4DLUA 2CNKA 4UM9B 1HETA 4OY3A 1U0HC 3PFWO 1A69A 5BQ5A 1QTNA 1RBQA 2FWPA 2R8ZA 2Z2YA 4GMGA 3CR3C 1O0SA 1SUBA 3GPIA 4MLCA 2R0QC 5AM3A 2I7DA 4O33A 4ZT4A 5HJ2A 4RUKA 4QPZA 1ZD8A 4U6SA 4D8VA 1I1QB 1W34A 1PQ4A 2IXGA 2OORC 4GH5A 4LQ4A 4BV8A 4WN3A 4YDQA 3W5DA 2O7NA 2XRZA 3ZDEA 4PZ0A 3TLXA 1TQ8A 1DQSA 3HYTA 1YJAA 4GUAA 4B6SA 2ZIEA 4OMDA 1MOZA 1GPH1 1QVVA 2EG9A 3GEIA 4J9VA 4JJEA 1NXVA 3GLIE 5HOEA 1OT3A 2DY1A 3SDZA 3CH4B 1NLFA 3A3KA 5C7IO 3D1LA 3TN7A 2G0TA 2IHKA 1H1LB 2FQ1A 3KNZA 4X1YB 4CIXA 4J2HA 1JLHA 1YL5A 1Z6TA 3K92A 5IHXA 3DYBA 1M83A 2AA3A 2EJTA 4LY6A 4BKPA 1HFKA 2YYSA 4GM4A 5LQMA 3GLFE 4M7PA 2QR3A 3RWMB 5C5DA 1YB4A 1XRPA 3GIDA 3EF0A 4Q0MA 2B9VA 1ZN2A 2LRHA 2ODNA 1WTAA 1XCJA 1TM5E 4MRRA 3PXXA 2WQ6A 4PANA 1LU9A 1YDHA 1ZVQA 4DT1A 4ID3A 3CZ9A 1WVMA 5CT8A 2XNSA 4B81A 1CDEA 5TIIA 4RZSA 4BNGA 2G9UA 4J90A 1T9HA 2Y1WA 1L4KA 4TWRA 3T1OA 4EG4A 4UTPA 3BWXA 3RC9A 2ZJBA 3CLKA 3V6MA 3LFTA 3B3GA 3SZOA 4Y2UA 4OA8A 5EHZA 4AJHA 3VR2A 4IW3B 2V5AA 1ZJ5A 1MRNA 2F4NA 4QWMA 4Y98A 1GITA 4DR1B 2H51A 2FGKA 1C7RA 4GKBA 4DIEA 4EKIA 2VCYA 1HDRA 1GQRA 1UP4A 2CL0X 1OFHA 3IUBA 4FC6A 1V6SA 3HMKA 4CN8A 4J75A 3E1GA 3AV3A 5DM1A 3MGBA 1Z74A 3GNQA 2Y66A 1DAKA 2V7UA 4QX6A 4TRRA 3VPDA 3EZXA 1K06A 4BDTA 5IJWA 4HAOA 5DTJA 4MKZA 4NV3A 3L6CA 4C7XA 5LM3A 1B8VA 3H1PA 3L18A 5JT1A 6ADHA 4NU8X 3FZGA 3ZHYA 1MJ5A 2QI9F 5BSWA 3VSEA 4WLUA 4N01A 4KV7A 4URFA 3L07A 5LZ2A 2DG2A 1UJBA 3DJYA 2IUUA 1ZW6A 1TVKA 4EG3A 1HNZB 4N5MA 1IL0A 1RWBA 1SOAA 3RO7A 1HC7A 3Q0TA 2ST1A 4TS3A 5AM1A 3RS4A 3SFTA 5T4FA 2HPVA 2JBAB 1JZQA 1U65A 1E3SA 2OYSA 2HFKA 4I0WB 4JR0A 2ZYRA 4RS3A 5MN4A 3QX9A 5E3IA 1C7QA 2PGDA 4W1RA 4HLDA 1P0MA 3S1LA 2ZB8A 3OH8A 4FYIA 3O38A 4JVMA 3BTSA 2CEKA 1ZHFA 4PNZA 3AF2A 4CQLB 2GK7A 1IK6A 1IHYA 2JIRA 4BWFB 3UXHA 3I9V6 1JXQA 3K2EA 5FXMA 2PZLA 4QUHA 5DSZA 4LFAB 4X20B 4ZC8A 4CR6A 1E2LA 2RAFA 3FSJX 4QYIB 5C9ZA 3Q8XB 3NV9A 3WWCA 3PI6A 3WKDA 3VNAA 1CFZA 3OFKA 3R2JA 3MRSA 4CEJA 1G8AA 3HCOA 4QNNA 4KE9A 4W5JA 1M2EA 3LNCA 3TLJA 1L4FA 3UOAB 4PZYA 1UMCA 1QOQB 4TXNA 1MMFB 1XAGA 3IDAA 4YQYA 5D3QA 1BDBA 4BNTA 4PLCA 1X7YA 1KTVA 4N8EA 3BWMA 2X0NA 1UH5A 3RRNA 2CYBA 4IHQA 4D6PA 1D2RA 2JFZA 4P86A 2JGFA 3TUIC 1IDOA 3IVAA 3TSCA 3JAWA 4YC7A 5C31A 5C52B 3C5WP 1O5IA 3L02A 1Y42X 4P5DA 1QRTA 4FWTA 1YZKA 2YKGA 4PO9A 4U8GA 1FFAA 1P4RA 1PYGA 1ZMRA 4Q9DA 4G4SP 3EWAA 4JDPA 2R97A 4MKIA 3BQ9A 3LWBA 3ANSA 1JHOA 1DAOA 3UATA 4RTJA 1W47A 5KYWB 1PBTA 1DEOA 1KEPA 3AESA 1COWA 4MHSA 4BFZA 4M0EA 4IXNA 2A5JA 2NSHA 2P62A 2AXQA 3IVMA 1HE5A 1YGPA 2GR9A 3ET4A 4PIMA 1DO2A 1L0BA 3LPAA 2NADA 3INNA 2CXPA 3MCVA 3OQ1A 4GFDA 4QDKA 1GL6A 4W7HA 1Z06A 3SS8A 1L8AA 3HJUA 3W5VA 1A27A 1V96A 4XSVA 1OUMA 3ACCA 2R1TA 2R87A 4FDAA 3WLRA 3AEUB 1W88B 1JEAA 1PZHA 1D03A 1Q5PA 2C94A 3NXSA 5HK9A 3OPYA 4QATA 5GV7A 5HTOA 3G2PA 3V4ZA 4YLGA 5IT0A 5B58C 2PGNA 1T6YA 2YOGA 3MPOA 2Z8ZA 4E4TA 3U7GA 2RD2A 2J8ZA 4TKUA 3HGMA 4K3UA 3MYYA 4QAQA 1UUFA 1W85A 2A1IA 2F3TA 3IKVA 2GYVA 3O7WA 2JI9A 3AYXB 3OE4A 4O4JB 2FZEA 3RYFB 3TBFA 3T41A 4BWVA 2NUPB 3PIRA 5FR2A 3IIKA 4RPLA 5PNTA 1H05A 1ZCFA 3HADA 2WU0A 1G16A 4LK2A 5AHRA 3HPQA 4KIUA 5K3BA 3L8GA 5LB4A 4MVJA 1ZMOA 3ET5A 2J7KA 3NAQA 4YGXB 4CEHB 3LA8A 2PTHA 4MRVA 4RTNA 4ODIA 4C89A 1U9IC 3BQBA 2FW8A 4LWOA 5IFLA 1PHRA 5JPDA 1MPTA 1RAGA 3QXJA 5F5LA 2PXHA 5JJIA 3AEQB 5IK2A 4LC9A 1EWKA 2GM3A 4X7MA 4U5XA 1MG0A 5F4ZA 5K0TA 5ALUA 1NJ2A 2F9FA 2SKCA 4MLZA 4XFDA 3IE0A 2V7EA 2GILA 3WK9A 4HMOA 2YYZA 1R0ZA 2GXSA 2FK8A 3UJ8A 1W6RA 4ZI7F 2YIDA 3WV4A 2WDPA 2P6PA 3C7DB 2AL7A 3LQ4A 3ZC3A 4UNSA 5H3LA 3WRXA 1QG4A 4CKWA 1DBWA 1LC3A 2EBFX 2NO5A 2PT5A 1UDWA 2JIMA 3QM1A 4R1MA 3FZYA 1JIJA 3VPFA 1RRMA 3UFXA 1Q0LA 2IYYA 1S96A 1E9RA 2PG3A 3GUCA 4QUAA 3RS2A 3MMZA 5K8TA 3EIOA 3MN1A 1VLHA 4FKMA 1L4BA 5G02A 1J33A 5ERXA 3AEKA 3MIIA 5AI4A 4MQEB 4WGGA 5F52A 2XNJA 1ODLA 1AVTA 5KOHB 4O2AB 1QG0A 1OBHA 5DHUA 1DUSA 1P9LA 1Z33A 3DMTC 4M9ZA 1D2GA 5FTJA 3FBGA 3IP6A 5E2BA 2PUCA 2Q0SA 4BNUA 3MJFA 3R20A 1GNRA 2GI4A 1RKBA 1XZLA 2RHWA 2W22A 4IS3A 4IJQA 4K9LA 4G41A 3RJMA 2O8DB 2PA0A 3CC8A 1XHLA 4BMXA 5AVYA 3W9UA 1XMOB 3RU2A 4C5AA 3R76A 1P8JA 3E9QA 5MDHA 3H0KA 2XYQA 3NIGB 2GARA 4OQZA 3DYIA 1P1KA 5CLGA 5E6RB 1L8OA 2W2KA 1BTOA 1D4ZA 4WTOA 4HQ0A 5B1IA 4AY3A 5BW4A 5MGNA 2PX3A 3B5EA 3LCUA 4I9GA 2VP6A 4FJ2A 1WCV1 1TUGA 1H1DA 3C3MA 2AOWA 3HCRA 2XH8A 1W8DA 3VOBA 3NP7A 3GLRA 4F7DA 1BKYA 3AKCA 2DY0A 5EJ6A 1YBHA 2G1UA 5EI5A 1ZR2A 3CUYA 3QTLA 2XVMA 5HF9A 5BRNA 4IINA 2CFRA 3LUGA 1EBFA 1MQ9A 1JWBB 2ZFUA 3OC0A 2G5PA 3KOYA 3JAKA 3WYDA 4RZ3A 4HI0E 2YCBA 4E21A 2XUKA 2GCGA 2AJLI 2A5GA 3RRJA 1PNOA 2ISCA 2VYND 4TMVA 3ZLUA 4EOGA 3E15A 3JQAA 2EEPA 2GSWA 2J87A 1XDSA 2PGJA 3M5PA 4GQAA 3RG8A 3WK4A 4MVJH 2CB9A 4IUBS 1Z2EA 3ZW9A 1DG9A 4XM2A 1T2DA 5LR6A 2ACWA 1JR6A 2OXRA 4A1FA 2VP0A 5ECYA 3RS8A 5DIZA 4FI3C 1NZFA 2EF0A 2RGGA 3AVOA 3FRIA 4D3DA 4JOSA 4NARA 4RKWA 3Q8MA 1Z16A 1NWHA 4K1LA 1FFSA 4S2UA 3ZH2A 3NBFA 3IKLA 3DGFC 5C18A 3UCFA 2ZM5A 5TQVA 5DVZA 1OFVA 1Y8RB 4I1IA 2E5FA 2GBGA 1Q1EA 1KYTA 2DHRA 2PFGA 3DMDA 3VR5A 2B92A 5FOXA 4YRIA 1SKYE 3MPUA 2OLJA 1IWPB 3GGDA 3S2ZA 4DTIA 5KYYA 2A4MA 1EWYA 1KHHA 1DDOA 5G4KB 1P4SA 2C82A 4MI9A 3UB4A 4AXBA 3QRWA 1ECBA 4IVQA 3IESA 4TWZA 2X3YA 3T6KA 1QV7A 4QJ4A 4C29A 4PZUA 4K9PA 5CBPA 1BA3A 3E1SA 4Q6BA 3U7FB 1VOTA 4BCBA 1Y1KE 5L9AA 2BTOA 1RRCA 1CP2A 2FOXA 1ULZA 2XYPA 4KBFA 1R9NA 3IP3A 4UTVA 2R8EA 1PLKA 2JK1A 1D6SA 1RYFA 3U4IA 3KJZA 2HTEA 3D3JA 1EXVA 1JQLB 2W6JA 1Y1LA 2CZCA 1E5XA 3WGVA 2ZJ5A 3SN6A 1VE1A 2X4IA 3WLEA 4ZT6A 2NGRA 3WP1B 2QHXA 4ED9A 3TTTA 3V9AA 4LJ9A 3QE4A 2BSQA 1SXIA 2IVFA 2Z1DA 2FE4A 5EKSA 2G4VA 2CB0A 1K5HA 1I6WA 3BC1A 2JI4A 1ATIA 2ZETA 3HCFA 3JRNA 5GIOE 4QGAA 2ORYA 5TV2A 4EHDA 3ER9A 1KAGA 3G2JA 4N49A 1N6OA 2O57A 1GZ7A 2WZBA 3DYVA 4BMCA 4JI7B 1OI2A 3OHPA 2I5PO 1Y34E 4UTNA 3KKNA 3H6HA 5FA8A 4Z53A 2HOQA 2WHXA 4LCEA 4PC2A 5EERA 2HAEA 3VSDA 2AMYA 4KE7A 1JXAA 1K8XB 3DL7A 2O8BB 1E1LA 4FR2A 2C59A 3ORQA 4R7GA 5LOVF 4HAYA 4HOYA 1MXFA 3MWDB 1A8IA 3A1EA 2H2FA 3LHIA 3RAJA 3UTDA 2D7CA 4Q3DA 4CTMA 4AD8A 1CUCA 3IJRA 4WBXC 5J2TB 1O95C 4HFRA 3HVIA 4TMTA 1H4QA 5ER6A 1WXEA 5FL7A 1J0DA 4XGQA 2RHHA 3P9ZA 4PX9A 5FWXB 4GOND 3ND5A 2H2DA 1PL7A 4YT8A 3KFLA 3IVXA 3OTQA 5D01A 1T4BA 4J3NA 1ZD5A 2OGWA 3TD2A 3NC1C 5KJEA 4M7WA 3PP8A 4PHHA 1I6MA 1XHEA 1DV1A 1DAMA 1LSSA 2I2BA 3FCCA 2HRCA 5E8RA 2WTUA 2E82A 1EQAA 4ETMA 3LRTA 5JR3A 3CUTA 2VRNA 4UM8B 3FH0A 3THRA 4W5TA 2GAJA 4UCXA 1QUEA 1R6XA 3R9WA 4US2R 3KUKA 4M1EA 4E88A 3K94A 1A8SA 4ZICA 1BG6A 2CCJA 4NCIA 3DOIA 2GZ1A 4DEXA 3D5EA 5A7HA 5I8WA 1OB5A 5LZ5A 1IBMB 4WIAA 4NFHA 4G2NA 4QYMA 4XVHA 3NBYC 4AROA 4JU9A 1P0IA 3H97A 5JYBA 4UTZA 5FPYA 1USGA 1T4MA 1XN4A 2E9SA 3BMOA 2QJFA 3FMPB 3HXPA 2QWXA 1XX6A 4UUNA 5AJHA 4WBSA 2O1EA 1TA9A 4HDQB 4KQEA 1M74A 1W5BA 4YS6A 4YWHA 4CM7A 4QU8A 2C96A 5ALFA 2GRUA 1QQTA 1ZW1A 4G65A 2FSHA 2NU8B 4KFSA 3VO9A 3NVDA 1AO3A 1NV9A 2GXAA 4F04A 1ID8A 3LX4A 1JTVA 2PX0A 3CPHA 4HUQA 3KZKA 5K6TA 2W6MA 3PQ5A 3VYWA 3GOQA 1PUXA 3I01M 4NX2A 1L7MA 1JHRA 2Y0BA 1NR7A 3BTUA 3EOZA 3FZNA 1K6JA 5JLAA 1Z2OX 5I4IA 4TGLA 1J2TA 1O0CA 5DCLA 3K16A 4YJKA 2I3ZA 4HN2A 3SC6A 1U6JA 3MT8A 2FPSA 4G67A 1OWNA 4YAEA 3U61B 4YAUA 3WLLA 4HGOA 1YO6A 3O4FA 4GKJB 2WB2A 1UT6A 1H2RS 2I66A 2QX6A 3JQ8A 3R0JA 1KFEB 2O3QA 4I6JA 4J3JA 5DYWA 4CCYB 3AH8A 2O7RA 2WTEA 3AEZA 2UZ4A 3UZUA 1ZG3A 1KI3A 3R0ZA 1TRHA 5E38A 3N3AC 2H1LA 2VS1A 4BX9A 4ZMSA 3TQQA 2FSVA 2PQ6A 1TPZA 2IBMA 3AK4A 4FGSA 2H0AA 4QC2A 4ATNA 1H3EA 4TSFD 2P9FA 4AZTA 1J8YF 1C14A 2XF2A 3DLTA 1T0HB 2FW1A 3FCYA 4LI3X 8GPBA 5J4HA 3FI0A 2REQB 1JAYA 1UWLA 5I3ZA 1BEUB 5IAOA 4QXPA 5ALHA 1BGWA 2MSCB 2RK4A 2M6KA 4YV1A 4OP2A 1Z56C 3AC0A 4NMLA 4RD3A 2IYQA 4OGFA 1IIRA 1RW4A 2TYSB 3EXEA 1S8AA 4X66B 1GN8A 1H0SA 2Q6TA 2E4AA 3QBDA 4G9BA 4OTZA 3TGLA 2EJWA 2CCGA 2GASA 3DGEC 4OKSA 3TW4A 3WIVA 2D5LA 3ZEIA 4XYLA 5B7QA 2AXEA 1VRVA 5DX0A 2J3DA 1YS4A 5L4NA 3NMUF 4NJOA 2MYPA 3B12A 1ZGJA 4GD3Q 3GA7A 1QFYA 2J3KA 4JQCA 4LV5B 3MZ0A 1JFFA 3RUIA 3BJRA 2I1QA 5JMWA 1H65A 1W581 2YZMA 5GVRA 4P98A 3KKPA 4NC9A 2WJWA 3NB0A 4H6VA 1WETA 5BVGA 2HQ1A 1PSDA 4DSNA 2K2WA 1WXHA 3ESYA 4V3BA 3ZLJA 1R4MB 3I1YA 4MRNA 4CXMA 4B44A 4GI5A 3X1JA 1D09A 4AZVA 3Q2KA 4YCMA 4QSHA 5FBKA 2O8FB 4PU0A 3MGKA 3BULA 5JI2E 1C8VB 2TMDA 1IB6A 3OAAD 1HDXA 4QRIA 1NVBA 4QBTA 1E20A 4UXHA 5SV2A 1XCPA 1KWKA 1ORWA 2O8BA 1I7PA 4M7OA 4DYHA 2YX1A 1YIDA 5DGIA 1BWPA 4AJOA 1GTRA 2BF4A 2X9LA 4KV9A 1PD0A 3A2NA 1WSWA 4KUHA 3TW8A 1JLLA 4LS3A 4KNVA 4QWWA 2JFPA 3ONDA 1WE2A 5C8YB 1SUSA 1E0KA 2V7QA 5E0KB 4R51A 5CM8B 4Q4LA 4NU6A 1PKXA 1J24A 2FY8A 2ONCA 1RYHA 2FX5A 2GF7A 3LG2A 2WE7A 1L4HA 1M76A 1SOVA 5BW8A 2IU4A 3CWCA 4DEVA 3OPYI 4NYJR 1M54A 4MVYA 1AQYA 3CH6A 3L79A 4N3BA 4FYVA 3KQHA 2V6MA 1WG8A 3DVAB 4Z49A 1U7WA 3TOZA 2RG7A 3HNPA 5F7OA 3FMVA 4LTMA 4P4NA 3BX1A 4V24A 3RRYA 3TYXA 3DUFB 4GGMX 1DWPA 1HUQA 2VHTA 3BORA 3ILYA 4JJIA 4BRWA 4AY4A 5BYAA 3GUVA 3ORRA 4KO3S 4QOJA 3MGGA 1YR1A 3DJFA 1PT7A 5JLJA 1Z28A 3CR7A 3KWMA 3BILA 1FDOA 3OD1A 4LWQA 4UU0A 4U02A 1G20E 1LZKA 2GJ4A 4J0GA 1TT5B 1W0CA 3EISA 1F2VA 1Y6ZA 3C70A 3IQHX 3SR0A 9LDTA 3C2QA 2QTZA 1CS4C 1BZYA 1N5DA 3MAGA 4DLAA 5CG1A 4TXLA 2O48X 5J47A 3AXSA 5G1NA 1HNNA 3WRWA 3U3KA 1WDTA 2BE7A 2XKAA 1B6RA 1NW3A 1Y6RA 1DZ3A 1H1LA 2XCIA 4QO7A 4LHVA 4UOEA 3QG1A 5AJZA 2AW5A 3NTVA 3UMBA 2I62A 4B9AA 3SJUA 3LT2A 3N76A 1M73E 4EELA 5JFOA 2GN2A 1G66A 2ZI4A 4HS9A 3UGTA 3F6BX 4PINA 3HJFA 1ZXXA 2YQ5A 2PO5A 4GI7A 5BT8A 3NJRA 3BJMA 1KAQA 3TFWA 1QV9A 4DA7A 1HLFA 2ZRCA 1EZ4A 3VX3A 1E2JA 3UWMA 3WE7A 3HN2A 2VPTA 3G5AA 3HDQA 3KPYA 5FNVF 4ARBA 4C3ZA 4E03A 4F7WA 1GSOA 4M8KA 1C0PA 2NPFA 1F8UA 2O2YA 3G88A 3MB8A 3AF1A 1NJSA 2ODWA 1D2AA 3RUDA 4BUZA 1CHDA 3DULA 3FSEA 1Z7EA 1RHUA 4TKVB 3UEOA 5HM8A 3WMGA 2V7WA 1G19A 2W83A 4X63A 4GRAA 2J6CA 1WAMA 3E9EA 4XWAA 3PRKE 3DTVD 3HA2A 3IP8A 3MJSA 5D5HA 1EUCB 1N9GB 2OHVA 4HYEA 3LDHA 2B99A 4JC5A 1QIMA 1APBA 3A25A 3G23A 3QVOA 1YRWA 1WDWB 1NMSA 1Z5PA 3WISA 1TLTA 2W4MA 4DR4B 1WF6A 1AZLA 2FN9A 2HIGA 2QE6A 2RARA 3CHYA 1PT6A 3W4KA 3LUFA 5K0CA 2YNMA 2B8NA 4MWCA 3CUSA 4LDAA 1Y5RA 1TJ3A 2V97A 3UB2A 4COOA 1R0BA 4F4JA 1KAOA 3EE6A 3GXBA 3JWIA 4M1WA 4ZTZB 4TOIA 8ABPA 1SBHA 1TF2A 2HRDA 4FYYA 1EUDB 3WB0A 4DMFA 2VF7A 1FX1A 2AJBA 2QE7A 1SCNE 2PSEA 4G1EB 5DM0A 4AN4A 5SICE 1DBRA 4F38A 5KQPA 4B33A 3IPAA 3K9LA 3RUHA 1VBNA 3BXFA 5AKHA 3QIVA 3ZIAD 2X8JB 5B1HA 4EHLA 1T3GA 1Y1QA 2G5TA 2JBAA 4J94A 3AUTA 4LDRA 4ZVOA 3D02A 4HN4B 2FSUA 1SNYA 4N6NA 4HH3C 5JQGF 4RENA 3I12A 2H5LA 1L7XA 2A5YB 2V7XA 2Z1NA 4ESHA 4D26A 5LZ4A 4LCBA 3FVTA 4F6RB 4P31A 3WRXC 1Z4PX 2IUTA 1A9XA 1T8PA 2F43B 2X4LA 1O6CA 4JJAA 4LK3A 4XWOA 2F1IA 1G63A 4MQMA 3AO0B 1DCKA 4D0LB 2QUBA 5JJBA 1Z37A 4JROA 3DQZA 1IQ0A 4JMPA 5J4VA 2DPHA 3KKQA 4X20A 3ZCUA 1UXJA 5A3QA 4W63A 2SICE 2PAAA 4NS1A 4ZOAA 4QYIA 9ABPA 1QFJA 4GZ6A 3E7XA 1P1JA 4MI1A 2CUZA 4V1CB 3RLFA 5DTEA 3EGDA 4C3OB 2ZU6A 2C2BA 2V7VA 3NFYA 1Y7HA 3RNOA 3SC4A 2EW8A 3D3KA 1C9DB 3TVYA 3C45A 3QZUA 2NSDA 1FSGA 5MN6A 1DC8A 2CT8A 4Q1BA 1ZIDA 4XB2A 2AEEA 3UJDA 4LFCB 3VHXB 6YASA 2P6MA 3AUKA 1XG5A 3EX7C 3GXOA 1WQ4A 5JRDS 3CVWA 2YHAA 1ZJWA 2QL5A 3I9MA 4Q24A 3M4ZA 3B3FA 4RJIA 3RYIA 5IYZB 4FB5A 4WL0A 1OHHD 2TRSB 3ZZUA 1Z5VA 4GXQA 1YZ3A 4CCWA 4AMZA 4B6PA 1FXUA 1B23P 4ER5A 2WUGA 4K6MA 1W44A 4CKYA 4C78A 4Y2TA 1YRYE 4K0KB 2CL7X 5IVHA 5JAUA 4ALNA 1OYYA 2QU8A 4CLRB 1CUAA 4AWBA 5KYWA 3EIUA 4RKYA 4KDRA 4II7A 3ZWYA 3DEKA 2IXDA 1QFXA 1XJCA 1X42A 3KB1A 3IUNA 3D2BA 5FYDA 5BQOA 4AJ2A 2YWJA 2WIKA 2XWSA 1CJKC 1Z5OA 2BMEA 2I76A 4BX2A 1BS9A 4BEWA 4UNRA 4UXJA 1BIFA 2GKOA 4X3CA 2O7VA 4KG7A 1VIAA 1TC1A 2ZDGA 4MW0A 3B3QA 1HTBA 4X6YA 2XJ4A 5ALOA 1WB6A 2R6R1 1W88A 3AEUA 1I3CA 4F11A 3QWBA 3RC2A 3U19A 2GEVA 1Q50A 1HE8B 1ZHOA 4C0HA 2XTZA 3HI4A 1DEKA 1RXCA 3FUTA 4AX4A 1MW9X 1UK6A 2IE0A 1F0KA 3QVMA 4TLCA 2F59A 1UPFA 3KB6A 4FOSA 4XYBA 4BC0A 3LECA 3JQQA 1UWKA 1B42A 2FQXA 1MJGA 2EW2A 2ZSKA 4RH0A 3W04A 5K3CA 3UGQA 1C7JA 3RYFA 4UEOA 3NUQA 2AJDA 1NJ8A 2C31A 1B14A 2FLKA 2HNBA 3I39X 3B7WA 2NUPA 5EUMA 1GU7A 1H42A 1U1GA 1LDEA 3HUUA 4NJMB 4YRGA 4CEHA 1H5QA 4HEA6 4ZU6X 2EDCA 3UH0A 5HZGA 4Y2GA 3HLYA 4C07A 1EE2A 1F6WA 4Z3KA 1EDEA 4Q6WA 3VSBA 4JVSB 3GGCA 4Y9RA 1PQPA 1ZRMA 2G77B 5KOYA 2PUBA 1V43A 3Q6MA 2I9PA 2ZCVA 1N8SA 1SC9A 2MHCA 3FNFA 2YZ7A 3WGUA 3DP9A 3FAZA 2H6EA 3G0HA 4C3VA 1K5PA 1XQWA 3IAUA 3NYQA 3A1TA 4KRGA 5EGNA 2WF8A 2QGZA 3W3AH 4BYGA 5C8XA 5K09A 5FV4A 1RACA 3HMQA 1P18A 2AZTA 3V4SA 4LMRA 2B8WA 4WXPA 1AU9A 5KJCA 3H9QA 1I2MA 3FDXA 2AOXA 4RHXA 1AV7A 2PT6A 4OXXA 2VHYA 1PBNA 5CLQA 5CVVA 2OYRA 3TCNA 4YCAA 3OC6A 1BOFA 3UAYA 1QH9A 4RKQA 4X91A 1JR2A 4L6AA 4L15A 3QYFA 4ZVTA 2IV7A 3L9XA 1CLEA 2G5GX 2H65A 3IHWA 4MIYA 5D5QA 2VEOA 2WTMA 1HRKA 4O4HB 5H1YA 4UE2A 1P7CA 1U90A 1MIHA 2P8JA 2Q41A 3HBFA 4PG5A 4UE6A 1OAOC 1ZCZA 1NVAA 1Z7YA 2UAGA 4MQEA 3VVBA 3MS2A 4OL0A 3X1YA 5KOHA 1U7ZA 1IJKA 1QYVA 4NOLA 4MGHA 5E4TA 1JMYA 1KPGA 4DPMA 4EG7A 1FX0B 4IEIA 4BFVA 3NAGA 2XGOA 1PK9A 4FXOA 3NRJA 1RI3A 4EB6A 4XSGA 2VHUA 4HLCA 4NAHA 3S4YA 2EL7A 1L6IA 4I8DA 4R4JA 4EVSA 1E1CA 2PWAA 2EZUA 2O8DA 3UPUA 2ZIGA 1JHUA 1DDIA 1WY5A 3B48A 2WF6A 4GSYA 1EIZA 5KKAA 1CHNA 3RFVA 2J1LA 3I6QA 1O6FA 3WGYA 1T4CB 1ZRHA 2B4KA 5E6RA 3V34A 4NI5A 1ZD4A 3AKYA 3EF3A 3TJZA 1CUEA 3G13A 4OBEA 1MQAA 3NO4A 5AO9A 1MB0A 4NEHB 1NJ6A 3O4IA 3AKDA 3VVCA 5FBVB 1JQBA 1TT7A 5EE3A 3LUKA 2EHDA 3DD5A 3EASA 2YUTA 2PKWA 4Y6QA 2WQ7A 4X24A 3S5UA 4HUTA 1R9MA 5HIIA 1ZAYA 2F8SA 3AIMA 4R8VA 3VAAA 2NQTA 4GXTA 1XPUA 1CY1A 3ETNA 3DAGA 1H23A 2UXCB 3FFWA 3ZWCA 3RADC 1L8QA 3PDHA 1ICEA 4BQSA 2ENUA 3HKEA 3EVGA 1SHJA 3SLGA 1PG2A 2IBTA 4ZYVA 3E7PA 2BIFA 1V9CA 1ORVA 4M1KA 5E4YA 3WVNA 1EVKA 2F8MA 4E07A 1B93A 3HB5X 1QOPB 2FUCA 1OOEA 1WMDA 3NPMA 4JODA 4L76A 4TVKA 3A9CA 4RACA 3SR3A 2LCIA 1JZSA 5IXYA 4RDXA 3PPYA 1Q57A 5A04A 1ZC1A 2HPHA 3HXOA 1V5WA 2PV7A 2WWTA 3I9FA 3LBIA 1LJUA 3OMXA 1RM4A 5FOWA 1MA0A 3IIEA 4R41A 1Y37A 3SHVA 1RABA 1V3UA 3VZCA 4C08A 3TB6A 1Y8RA 1QZ3A 4CVNA 5AJWA 3I3OA 3GLVA 1YUBA 2P4EA 2FZ5A 1WW3A 3M3DA 2HBYA 1VE9A 3URMA 3WGHA 3E3OA 1XP5A 4MTLA 3L6RA 3ZU5A 1XTRA 4BGUA 1NUUA 4EF4A 4MUJA 2ZUCA 5H59A 1J07A 5K0ZA 1ISIA 5G4KA 4DILA 3QEJA 3SEZA 4DY6A 4UCFA 3B7GA 1C3XA 4LE2A 4J7CA 1BRTA 2Q3CA 1PW5A 5ETJA 4B85A 2J5XA 4BPBA 2XXJA 2P6OA 4PIVA 5TQ0A 2JCYA 4BGIA 3DZDA 1F9AA 4RS4A 4S12A 2Y9PB 3A9RA 2CJWB 3L0DA 3EZLA 3F96A 2NVBA 2PKQP 1EXMA 2FEMA 2PVSA 2WNSA 3IOYA 3F6CA 3KR2A 3MOIA 3QKIA 4FMDB 4KXYA 4BNDA 4LXQA 1VJCA 4KNWA 1G5QA 1UZMA 1WB4A 3E9NA 5H0IA 5K51A 4DLYA 1J90A 1XOIA 3R0QA 4Q16A 4PE5B 1YIOA 2X6RA 5CW2A 2X2FA 1ILEA 4WD3A 1O77A 3R5FA 3RVQA 3FPRA 5JRJA 3LRXA 2M98A 1I2CA 4RZIA 3F6PA 1KNQA 4KQGA 1HPLA 3QEMB 4OBBA 1RJ9A 4Q4HB 3H9UA 3VKVA 2O2SA 3VPAA 2FSVC 1XDBA 1EB8A 2QGFA 2YWXA 3E5HA 5DLDA 1ISFA 3VZQA 3WKBA 1AB6A 1KYQA 1QHGA 5KAPA 1BFUA 1KZ9A 3KXKA 1QM5A 3MUFA 1HT0A 1YMUA 3K5IA 2XNCA 4WZAB 2PX4A 4B84A 4K5QA 3H2KA 3Q3IA 3K15A 5B6CA 3CWZA 1RVV1 1RJGA 3LT1A 3RVPA 2AHRA 1U94A 4JOCA 4TV8B 3WGQA 4C4SA 4EGQA 1CB0A 1SO8A 1SKAA 4QULA 5KSWB 4ZD6A 1OSNA 3T5MA 3O3OB 1LNZA 2HEIA 1KYYA 1X9IA 3AW9A 1N6HA 4PFSA 5TRTA 1W76A 5IN5A 4CW7A 4N18A 4IYRA 5EE1A 4YUXA 2VT7A 3EXG2 2JLZA 1Y1PA 3MWDA 2AWOA 4FONA 1LFAA 3VMMA 1ZCBA 4E5NA 4LA4A 1VPWA 2R6GA 4QNMA 3TRHA 2VYFA 2Z3WA 1P0QA 5K0EA 2WD8A 3AF4A 2JLQA 3FNHA 2VDPB 1XTZA 1WR8A 2X2OA 5GGXA 5B2FA 2WJPA 2H17A 3B6JA 3DSRA 3GDOA 1N25A 4X3OA 5FWXA 3ZZMA 3UOGA 3Q6NA 1NU6A 2BFFB 3UPDA 2IZ1A 3E8SA 1EZ1A 4F4FA 1UIRA 1Z6QA 1KAEA 4ZU3A 2GAFA 3KQPA 4YJDA 4ZVPA 2XDYA 3GCDA 2CLFB 4H4CA 4WAUA 4PBRA 2E21A 2ZBVA 4H6XA 3DQPA 3OVMA 3PEUA 1SC6A 4OK6A 2TMKA 5JZVA 4QXRA 3WNZA 2BEVB 4R8SA 4F4HA 1TW2A 1H4VB 4OKIA 3PR3A 3I64A 5FPHA 3CG0A 1YQ9A 4NPHA 2ZRAA 5H9VA 4EEXA 4BMDA 3T4PA 2JGLA 1XMVA 2R48A 4AKEA 3Q88A 2XT6A 2R7LA 3IDQA 1JFSA 1DQNA 1Z17A 4MWOA 1H2BA 2HLDA 1JLRA 1IN4A 1WNTA 2YASA 3MWEB 4M46A 1Q0QA 2XOKA 2PBZA 1AZTA 1XCBA 3VC1A 3LT5A 3WMFA 2OCAA 2CCKA 3CU5A 4G3XA 1Z0KA 1M0TA 2WYIA 3BSWA 4OHMA 2XLBA 1Q15A 4DDWA 4WK0B 1PWEA 1YRHA 4ZYUA 1VRCA 1VRWA 1T13A 1Z0UA 2P41A 4WKOA 4P93A 2FFAA 1U8AA 3DOOA 3WLFA 5BN3B 5JSQA 1LRJA 2DOKA 4UOQA 5JQWA 1VSUA 3IFSA 3Q0IA 2X13A 5AR1A 3JQ6A 3PLAE 4L8GA 1HY3A 2Q28A 4M22A 4FSDA 2FPUA 2SHKA 4QTXA 4GC9A 5REQA 1QIDA 1Q1GA 1QLJA 3UYKA 5FI5A 2YXNA 3HXKA 1QTIA 2NG1A 5CVDA 3AUSA 2IF2A 3H4VA 5AKKA 4YRBA 5EZQA 4YT4A 2IOFA 1V3VA 4UMDA 1B1CA 1E59A 4CBVA 5E6SB 4OQMA 1AG9A 2RGWA 4E5DA 5KTRA 4MWTA 5T7BA 1W5EA 4UUBA 4H3KB 4OXYA 4CCYA 2PXXA 4ZZ2A 2BLNA 1TM3E 3PXDA 4KREA 4CE6A 2GTHA 2WA2A 1LI5A 3E23A 3K1JA 1JF8A 3A6LA 4OLBA 4ZRMA 3PC7A 4GGOA 2C20A 2RJOA 2YV3A 1KDPA 1MX3A 3KPVA 1ZH6A 3C8HA 3CT4A 4E0BA 2ZQZA 3FCSB 3OLQA 5A4JA 5JIBA 2CVOA 2GFIA 2IK8A 2NTVA 1PFKA 2YHBA 3PJDA 4L5YA 4NTZA 2JATA 3TEJA 1V7PC 1YOBA 4IJKA 3U7QB 5K5EA 1KS9A 3QF7A 3OEHD 3UC5A 2VDOB 1XHFA 2DKOA 5K2MA 5A7FA 3UJ6A 2H1OA 3NVMB 4OX9Y 1BSVA 5SYNA 1WDMA 2FG7C 2ZBQA 1NVGA 2AFHE 2WMYA 3I0ZA 2A9JA 1XCGB 1IIBA 1ZU5A 1VG0B 4F4DA 3LA6A 2X5KO 5AXAA 3UENA 2HIHA 2WHEA 2D7JA 2JAQA 3WGKA 1KZ6A 4PF1A 1CNFA 3C97A 1VYHA 1OWMA 1CZRA 4TXHA 5FBZA 1W2WB 2G9RA 3EA5A 4D96A 2GRAA 2G70A 2ORIA 1SUPA 2CZGA 5CFPA 5LP1A 4BXOA 2RJNA 2BCJQ 4LOHA 4KQ9A 1X9HA 4WBNF 2C5AA 1J8DA 1FQOA 4Z8XA 3OE7D 2XNKA 3R3HA 4P2BA 3SBDA 4EB3A 5A0VA 2IYEA 1Y7IA 1P6QA 1OA0A 5COQA 5B5SA 2ATXA 3NHMA 2UZIR 3MTBA 1W49A 4O2BF 3V7UA 3HDTA 3HB7A 3PGA1 4FEGA 1QVWA 1P2GA 4S2EA 3TNYA 4G37A 1AGNA 4IJWA 3OU6A 4FGJA 3AIIA 4JP2A 2DHCA 1LLFA 2BM1A 3OF2A 1R4MA 1Z2DA 1XZIA 3OFSA 4LOIA 4ZXPA 1LVHA 1ULUA 2V8OA 4J03A 2KMLA 3E9MA 4JB0A 3PQ4A 3V2GA 5A62A 3WDSA 4L2IB 2YNMC 4HNHA 4KQJA 3U9LA 5AD1A 4BZXA 5K6AA 1Q1NA 3DR5A 3IURA 4I8XA 2NNWB 3VH2A 1JFLA 3SX2A 2YCLA 1IY9A 2I55A 3ZVLA 2QRLA 4GIBA 3CMCO 4OHYA 3GAFA 4BKRA 4E22A 2Q5IA 4EVQA 5HUHA 3RYTC 4AG3A 3DEAA 5C8YA 1Q22A 1P80A 2AV6A 3CRQA 1IBCA 4MV7A 1QMPA 5FEUA 3R5JA 4TYNA 2GK6A 1NQOA 5BWCA 1J42A 1XQ9A 3O2SB 2BDUA 2JANA 4RY9A 5L7TA 1R8JA 1ZL2A 3TPCA 5JTUA 4TZ0A 3G0DA 5LDGA 4BYMA 4X6XA 4NPAA 4AJ9A 3O95A 1WM1A 2B6HA 3A2LA 3BBLA 1BVRA 4DCVA 1SM4A 1DZIA 4H0NA 4IJVA 2XECA 3UUFA 1ENPA 2I1LA 2ZIZA 4OYYA 1CR2A 3UNXA 3ZD8A 2CNWA 1GA1A 1RVDA 4HDOB 3QU7A 4OYHA 2Q7XA 3NOXA 4G0YA 5BSEA 4DV1B 3LUDA 1TT5A 4GICA 2DQYA 3PFKA 3PFBA 5K3DA 1C3VA 2D0PB 2YW9A 2D1QA 3UB3A 1QCDA 3M1LA 5FOQA 2OBBA 2VHQA 3JQ7B 5IC5A 5DZSA 3LY8A 1A4XA 3SKXA 4GKKB 4JL8A 2FUEA 3U4CA 4MMYB 2EAUA 5B64A 1PGJA 2VTDA 1C4OA 1AGPA 3HY6A 5HBGA 5FT9A 3RQSA 2I65A 4AFNA 4WMLA 4DMUB 2IEYA 4CMGA 5JZOA 4V39A 5CH3A 2BN4A 1UC9A 3GH1A 4MVWA 1JZTA 3UXYA 4JX8A 4HTFB 4MMXB 3FTEA 1U2TA 2GB4A 3M5WA 1EWQA 2YV4A 2INGX 3K0EA 2ZXEA 3LPLA 2FW7A 2AG6A 1AGYA 2I1VB 1Y7TA 2D4AA 4EM6A 1UINA 1UK8A 1T9ZA 2B78A 3KB2A 3QPVA 1XVVA 4XQ0A 3EPKA 1QUFA 4HX2A 1GYQA 1TQ2A 2OK8A 3WHLA 3FCOA 4G9GA 1P0PA 2FEXA 4PEVA 5LA6B 4B2YA 2OBNA 5CBKA 1ZBDA 1IM5A 2Z0MA 1NVXQ 3H65A 4EECA 2VG8A 3CRRA 2V4ZA 2P4SA 1BRMA 1LRKA 1SXJD 1XTBA 2J4CA 3D54D 3FVQA 3W9BA 1YA6A 4WH0A 4X97A 4WKGA 1CC1S 3IR5A 5HKLA 1AHIA 2IYWA 2BGRA 2I67A 1EX9A 4C30A 4IX9A 2H7CA 4OJTA 4DDVA 3CLUD 3AFMA 3G0CA 2OXEA 3LK7A 1HBJA 2AOUB 2J7PA 4GEKA 2NTEA 4LBVA 1N9GA 1SHKA 1RHMA 2OC4A 1SBQA 1OXSC 2Q1TA 2WT8A 4R0MA 1ADCA 3ZGOA 2WVAA 5E7QA 4G4JA 3AUUA 3LP6A 4D0RA 2FETA 5KTTA 2G63A 3O8BA 4X1IB 4B34A 1JBKA 4CL0A 1YK0A 3C16C 3JTMA 4AI6A 4RDHA 3H19A 1OAAA 3MW8A 3QEKA 2Z6VA 2J6BA 4FVTA 1YZFA 2H9IA 3FUWA 1FUUA 1Z88A 1K5GA 1T1JA 1UXGA 2ASEA 3K8YA 3O1JC 3LUHA 4KQKA 3LKVA 2K4MA 5E9AA 1YZQA 2PK3A 4H1VA 4QXQA 1RXSA 1YCGA 5GJWC 2X8JA 4GR5A 1SY7A 5DCWA 2OD9A 2Z56A 1GDTA 2Q1DX 1FY2A 2ZYVX 3CPSA 1G3IA 3E8MA 4L5CA 5EPEA 1Z8NA 3V4VB 2ZZMA 4PR3A 1WVIA 1ODKA 3RASA 3OJOA 3WZMA 1EP9A 4M21A 2JIOA 2GNAA 5F5NA 2Q19X 3N39C 1E1QA 5LQAA 4WJLA 4F6RA 4PZLA 4A0QA 1ECCA 3B5JA 4RQBA 1CDDA 5LIPA 3H75A 2F43A 1WXGA 4NP6A 4R0NA 2VF8A 3SQLA 2G71A 2G8LA 1RWMA 4PXSA 1I4DD 1V35A 4J0CA 4BBAA 2J3JA 4IHJB 1V8ZA 3BJIC 4D97A 2O3TA 3H4IA 4AO7A 4EI2A 2GEJA 4RTLA 5JXWA 1RNLA 1DHRA 2A5LA 2XDQB 2PXAA 2V0NA 4GPAA 2PRIA 1E64A 3RBXA 1ULBA 5ISMA 3D6AA 1NYTA 3EH1A 3D6FA 3BB1A 4DV2B 1EGMB 4YP6A 5K8CA 3UAOA 2OOSA 3EEOA 1CEXA 2WUVA 3ZQ6A 3DTYA 3M6WA 4Q7MB 3QVWA 4JUBA 1OW3B 2YIJA 3TEFA 4K28A 3VHXA 3ZX5A 2HSGA 1NMYA 3OLVA 1XZ8A 5LQDA 2IHTA 4M8IA 3SM3A 4BO0A 4GOXA 4IAOA 1LPAB 2Y1EA 4HYQA 1Z18A 4H18A 3KEGA 3SMVA 3ZVMA 3BK1A 2VJPA 3P97A 4UCQA 3PF9A 5HK8A 3U44B 1ZVVA 2WSBA 1ZNZA 4D8WA 3J81A 4NU5A 4ZPXA 2OFFA 1ZK1A 1RC1A 3EFEA 3EOBI 3WFJA 2A9PA 4MS4B 1E1YA 4DSTA 3GRCA 3EC2A 4N8SA 2LKCA 1EKXA 4GL2A 1HYEA 4FYXA 4QE3A 1N1EA 1GWNA 4CLRA 4ZVLA 2C2MA 5B55A 4ZALA 1T8TA 4Z5XA 1SHUX 2KQUA 4ARAA 5FKJA 1G6Q1 3LFHA 1RWPA 4F9EA 1CUBA 3CNOA 3I2KA 4LIPD 5HVNA 5LU9A 4A2WA 1YFZA 3O74A 1G21B 1SEVA 1UT5A 3FW1A 3MQ2A 4OQPA 4LGYA 4RKEA 4TQAA 4V0MA 4CLXA