2PX3A

Crystal structure of flhf complexed with gtp/mg(2+)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
258
structure length
256
Chain Sequence
PEPLRKAEKLLQETGIKESTKTNTLKKLLRFSVEAGGLTEENVVGKLQEILCDMLPSADKWQEPIHSKYIVLFGSTGAGKTTTLAKLAAISMLEKHKKIAFITTDTYAAVEQLKTYAELLQAPLEVCYTKEEFQQAKELFSEYDHVFVDTAGRNFKDPQYIDELKETIPFESSIQSFLVLSATAKYEDMKHIVKRFSSVPVNQYIFTKIDETTSLGSVFNILAESKIGVGFMTNGQNVPEDIQTVSPLGFVRMLCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the third signal-recognition particle GTPase FlhF reveals a homodimer with bound GTP.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Biosynthetic protein
molecule keywords Flagellar biosynthesis protein flhF
total genus 72
structure length 256
sequence length 258
ec nomenclature
pdb deposition date 2007-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1380 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2px3A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2px3A02
3QXXA 4Q00A 2G1KA 4LBZA 4M9XA 5KTYA 4G5RA 4BFZA 2Z4RA 1Z63A 1NMZA 5CDFA 4CEHB 5B57C 3U3JA 1ZM2A 3MUFA 5EXPA 3BE4A 3ADCA 4OHWA 3EARA 2MMGA 1ZM9A 5L3SA 3GLGB 2OUKA 3U6KA 1XPUA 4ACBA 4PSVA 2V9PA 2ZRBA 2FDCA 5FH9A 2D3WA 4US0R 3VU9A 1II0A 1YZLA 3ZIAA 1QG2A 1X3SA 2VP2A 3WHLA 1GL7A 4BRUA 1D9XA 2IS2A 3A1VA 5L3RA 1Z83A 5F9HA 2WWXA 2ZRDA 2HXSA 3AF3A 3LNCA 2PMKA 3HPRA 4PANA 4BRWA 2A2ZA 1E1QA 2DB3A 2XZLA 4F91B 4O2LA 2B6HA 2I4IA 3PR1A 1TQDA 1QHNA 4BWYA 3R9WA 3QKSB 3MSXA 4IOKA 5A5GA 4FXPA 3QXSA 3RS0A 1W2GA 2BJWA 2P67A 5CK5A 4EDHA 1XZQA 3QG1A 2FFBA 4CDGA 4DKXA 1ZD1A 3C14C 3QVUA 5GJVC 3CX8A 1ZIOA 5EE9A 4WXRA 1P62B 4E5UA 1ZINA 1ZJ6A 3BH0A 1UBCA 1E4YA 5EXTA 3EZ7A 5AWFC 1JECA 3PUYA 3AF4A 1P60A 5FOSA 4R98A 1T8TA 3VNUA 1JXOA 3G5UA 1YVDA 1OXUA 2WWGA 1CP2A 2CLCX 2Z0MA 3A1UA 3UG7A 1IAQA 3OIWA 3GJ5A 4XSGA 3AH8A 3JVVA 3LH5A 5J4YA 5AJXA 3GFOA 3CRQA 2BC9A 4JVLA 3RRZA 3OESA 3AVVA 4DDTA 1FTSA 5FR2A 2QENA 4A6PA 3RYTC 1RRGA 4DRZA 3LXXA 4HLQB 1IQPA 1WRBA 4Q01A 1NLYA 1UKEA 3UK6A 1VYVA 1OXSC 1TUIA 2RB4A 5CB6A 1J2JA 2QMOA 3K0EA 2OO7A 3R9XA 4TSFD 3R9IA 3EC1A 4TYYA 2IS4A 3D3QA 2W00A 1DO2A 1H8HD 4TZ0A 5JZVA 4M22A 1CBUA 3CKLA 3KB2A 4PZYA 1LF5A 5TVKA 2ODBA 4BPBA 4C2UA 1A7JA 3BFVA 2ZQ5A 4FMCB 3RS5A 1OYYA 1G3RA 2ORVA 1CLUA 4NMMA 5J4LA 5GVSA 2FSGA 1G3UA 2R44A 1F2UB 3KTAB 1R0YA 5FUYA 4B47A 5KUTA 1T0JB 2Z43A 2JLVA 2WPDD 2JLUA 1TL7C 2J3EA 2PT7A 2RH5A 1E2LA 3FFBA 5KPJA 5JRZA 2ZJOA 4MUAA 4B73A 3TAHA 2VYFA 4HB0A 3RSLA 2KBEA 1G7SA 4BZXA 4NH0A 3CNNA 1JPNA 1UFQA 3PIRA 4B3FX 2W6ID 1G7RA 4NKRA 4HZUB 1E99A 4DEYA 2ZJ5A 2P5SA 3CF0A 3CH4B 4ESHA 3WYAA 4R7ZA 1KI4A 2W6JD 2ZSBA 3FHCB 1CKEA 2QP9X 1MO4A 2KB0A 5K8IA 5F3WB 5TY0A 2J7PD 4A8JC 4V0ME 4B43A 2QTHA 3LW8A 2CE7A 1R7RA 4TMVA 1P2TA 1DAEA 4GPTA 2IYUA 2AKYA 4ON9A 4AKEA 1PV4A 2FGJA 5FI0B 4DBLC 2ZS9A 2DYKA 1U81A 1EFRD 3PFIA 2BOVA 2WV9A 4CVNA 1X1RA 3QKRB 2GJ8A 4M21A 3S1AA 1YZNA 4EKDA 3RABA 3B1VA 3U3RA 4RD4A 4I1OA 4NCKA 1W2HA 1WMSA 2ZXUA 1W49A 2BMFA 4N3NA 3L2OB 3NTUA 4JLAA 2RGBA 1SKQA 2V3CC 1OFTA 1XMIA 4GZLA 2ZJAA 1JEEA 1Z0DA 1P2UA 1NVVQ 1DO0A 4AYTA 5JEEA 3DEFA 3T06B 1E9AA 2VHUA 1A5TA 2VQSA 3AKCA 3REFA 1E9EA 3FKSA 4MYTA 3CX7A 3C5HA 3ZVMA 1KZGB 5BN4A 2EWVA 4NPHA 1HUQA 1EFTA 4YMVA 3BOSA 5CLQA 4RD0A 5EXXA 3KXKA 2F9LA 4D81A 1AK2A 1E9DA 3CF6R 1FMLA 3MCAA 2X19A 1SZPA 2J7KA 1ETUA 1QHGA 1H65A 4JLVA 4RZXA 1HY3A 1NG1A 3PVSA 4QHSA 4TT3D 1QHIA 1EFRA 1ZW6A 2YC2C 3B2EA 4DT1A 5SZJA 2R6DA 2QNRA 1WCV1 1ZNXA 1D9ZA 2YNMA 1Z6AA 2J0UB 3H4MA 1S1CA 3OAAA 5DE3A 4C9BA 1W36C 1W4AA 3UIEA 5KSOA 1P9NA 3CPEA 1GRQA 5JCZA 3ZQJA 4JT2A 2UZ3A 5CJ2A 2NQ2C 2NTYC 3EWAA 3UMSA 3EW9A 2NZJA 4A15A 1IN5A 4HLUC 3RAPR 2VP0A 1QF9A 4TQAA 5EUQB 4M0LA 3KB1A 5A0FA 3KFVA 4LC1A 2OLKA 5B2ZA 2VEDA 4M1TA 4TSFA 3TQCA 1JJ7A 2AR7A 2VA8A 2EYQA 4ZI2A 2V1UA 4ZDKA 4TMTA 5E7IA 2DWPA 2ATXA 2ZRIA 1VIAA 4BLRA 2GHIA 4PC6A 5JCPA 2C78A 4QFMA 4C0HA 3SJZA 4P0TA 1ZM3A 3AM1A 2CK3D 1E2KA 4C7OA 3X1WA 4AI6A 3NH6A 2IYRA 4Z8YA 5L3SB 2IX3A 1R0XA 3ICEA 1NSTA 1D2EA 3KDSE 4OI1A 4GP7A 3EIQA 4U5XA 4M4SA 4NCHA 4BQSA 2WIAA 4TL9A 4FMBB 1KY3A 2CDNA 4CT4B 4EJSA 3D8BA 4LV5B 4JBYA 1E2IA 1P7CA 2QT1A 5DNYB 1OFUX 2Q3MA 3EPKA 4XSHA 4Q9JA 3BERA 3DO6A 1YZGA 1W0KD 2O8CA 4CIDA 3C8UA 3W6PA 2OBLA 2ODWA 1FW6A 1U2RA 2YWHA 1KO5A 2OEPA 5FBRB 1NJFA 1E79A 1KO8A 4KFUA 1OF1A 3T34A 4AYXA 3TVDA 1T5IA 2IF0A 4M9ZA 3VQTA 3O8RA 5ELXA 4JL8A 2QROA 2HJGA 1JNYA 4G3XA 2PCLA 2C5LA 2GESA 2HCBA 5K8TA 1ZD8A 4PAMA 3AKEA 4KYIB 1NVVR 4URUR 1CRPA 2VHJA 3ZS9A 2IUUA 3U4QB 3QENA 4US1R 2QPAA 2CVFA 1N6OA 1GFIA 2C95A 2HDNB 3TSWA 5IK2A 4C4PA 1C9KA 2XNSA 4UKDA 4XVUA 2GILA 1G5RA 4V02A 1YJ5A 3NG1A 1OIVA 3B78A 5JSZB 2B7BA 2VPPA 1Z0JA 2CMKA 1H8ED 1COWD 1ESNA 4W5HA 4DT1B 3A4MA 3FMIA 4XH9B 3X1ZA 1G21E 4PFSA 2WMNB 4M1SA 3QSYA 2GZDA 1SXJE 1Q21A 3OE7A 3RC3A 4A2QA 2ZRLA 2V8OA 4B3CA 4QGFA 3K70B 2FNAA 3VKWA 4BLPA 4MUBA 1ZUNB 1S3SA 2BVNA 3R8FA 2QZ4A 2UVQA 4JJZA 1TEXA 2LKCA 3NBXX 2XNDD 1FP7A 3NXSA 1N6PA 1KSJA 3CWQA 4MKFA 3K0SA 4UJ5A 3OAAD 4HAWA 1Z0FA 4TLBA 5KNBA 3CPHA 5JLJA 2HF9A 3CR7A 2FF7A 1N6NA 3U2QA 2ZVPX 4E22A 1XBTA 4L4UA 3ZZ0A 2O8FA 2I3BA 3DMDA 2XSZD 3C4JA 3SQWA 1R0ZA 3BB3A 4N1AA 3BFKA 1YR6A 4WAUA 4MRVA 3PEYA 4QJ3A 2GKSA 2BCGY 4GMXA 1KDTA 3Q8XB 2XXAB 5JJLA 3RNLA 2X77A 3L0OA 3DOFA 1PUIA 3G0HA 1DTSA 2ZRKA 3LDAA 3LWNA 4MYCA 2HLDA 4NYMR 4GFDA 3SHWA 3VR2A 1G41A 4BGDA 4F4CA 3T12A 4TL8A 5FTMA 2CLDX 3NKVA 3GEIA 3KZ1E 1GIAA 3SR0A 1AJEA 2ZI7A 3BBPA 5FTKA 3KJHA 2QGZA 3QXJA 4DHEA 1KKLA 5FBVB 4JLMA 1KMQA 2GCOA 1Y63A 3UWOA 1NL3A 4YXWD 4OHYA 2GETA 1UEJA 2Y8EA 1LNZA 3QF4A 2FZLA 3P27A 4LJ8A 5J40A 3W6OA 3U4QA 4GMDA 5AJYA 3T1VA 4PHTA 4TYNA 2ATVA 2ODEA 3H0KA 3IQWA 3U44A 3CB4A 4B3GA 2ZRFA 4QBGB 1HYQA 3SQXA 5AR1A 5E7MA 3TAUA 1AQYA 1DG1G 2VIIA 4KVGA 1J8YF 5JSZA 1N6HA 4P4SA 5EP3A 1XEXA 4LC0A 1YZQA 1ZCBA 3AVQA 4Q18A 4C0BA 1R2QA 3A1TA 1WP9A 1E0JA 1OFIA 4G5OA 2IHBA 1AGRA 4IEIA 1R6BX 3SBDA 2HUPA 3I62A 3E2IA 1ONBA 1Z08A 2AXNA 2A5YB 4N0EA 3DVLA 1XCPA 3GFTA 5C18A 5IK2D 3ND9A 3DOEA 5DN6D 1V43A 1VKJA 4PHHA 2QRZA 5BQ5A 4JMPA 4L9SA 3QJYA 3DZ8A 5H1YA 1F48A 4YXWA 4XD7A 1O87A 4DLZA 4YMUA 2NO6A 2WPDA 4FN5A 1XX6A 5JI2E 3LLUA 4H9GA 1L2TA 1VYTA 2EYUA 3OHMA 3R7WB 4CEJA 3RRYA 2QSZA 1P3JA 4HB3A 3W3AA 2JLXA 2A5FA 1YR9A 3GCGA 1YHNA 3H84A 4MKGA 2J59A 4C7OB 2AD1A 2H8KA 1GOTA 3RDPA 4LK2A 1N0VC 4TLAA 5J5CA 1KI1A 4D6PA 3ZLJA 4KBFA 3K0AB 1KK3A 5GJWC 4V0LA 2GXAA 4HLDA 1RRPA 4DDVA 2YWFA 2GAAA 4OJKA 5CYPA 5A4JA 1E2GA 2IYLD 4A0FA 1XJ0A 5M04A 1Z0KA 4QXAA 2ZRNA 4BEJA 2F3TA 3DL0A 1Z28A 3L0PA 4HSEA 4NYMQ 2PL3A 1FUUA 3A4LA 5AUNB 2GTPA 4X8OA 2J0VA 5CLLA 4ACAA 1KK0A 1JR3D 1UAAA 4NYIR 1P73A 3RRMA 3W9YA 2REBA 4ZIRB 4FCVA 2P2LA 5HZHA 4XJXA 3PUZA 4HDQB 4LSGA 1KO7A 2ZAMA 1UF9A 2OBNA 2XOKD 4BE7B 2QPOA 3KJEA 4IOMA 4XVRA 2ZEJA 3M4YA 2WZQA 2ZUBA 1GVNB 2V7QD 1AIPA 4IDNA 2FPMA 1W46A 3DKPA 1Q1BA 2ZSDA 3IILA 2F3RA 5EP1A 1R5NA 4TQ9A 3Q3JB 2AX4A 3THXB 1EWRA 1I4LD 2AK2A 5EE1A 4Q9HA 3QEOA 5F9FA 5FI1B 2G1JA 4Q4AB 3N2EA 2C99A 4M9SA 3LQRA 4P33A 4Q1AA 3CPJB 3TW8B 1XPRA 1ZNWA 1NG9A 5FPHA 2OXRA 1KZ7B 5E7JA 1NMYA 1KDOA 4IOLA 1E96A 1R0WA 2CNWA 2R6GA 3BORA 3I8SA 3A37A 1SVKA 3ND8A 1KKMA 2VP6A 5H8WA 2XX3A 2JJ2D 1E1QD 3CF2A 2F55A 1DPFA 3GFPA 4G5GA 4BLTA 3LX8A 2Z5FA 3UMFA 1OSNA 1U9IA 1N0WA 4IJMA 1GTVA 1KK2A 2NG1A 2OZEA 2PZGA 2P0EA 2XZOA 2GDJA 4JIMA 2ZVQX 2WWIA 2ONKA 2PLFA 3D31A 2DFKB 1P2SA 1QG4A 4LBYA 4Q47A 721PA 4FWIB 1C1YA 4HB4A 4IKEA 3T1TA 1EX6A 2ZANA 4K81B 3QBTA 4GBMA 1HE1C 1ZU5A 2QE7D 4PQFA 4F93B 1G19A 4KITB 3SYNA 3GLIB 1TQ4A 4QG7A 2G9NA 4I1SA 4ZDIA 5FOXA 1AS3A 3HR7A 4AWXA 1M7HA 4QNMA 3VX3A 2FZ4A 2GEDA 1Q3HA 3GQBA 1Z8FA 2QN6A 4P3YA 5JFGA 1WB9A 1IJEA 1Q3TA 1ZBDA 1YE8A 4B75A 4M1WA 2VL7A 4Q7LA 1Q22A 4AKGA 2O8CB 4RCZA 2RGNA 2P3SA 1FX0A 4KV9A 3AVXA 4OK5A 3TMKA 2IA5A 1K6MA 1MR3F 1E79D 1SVMA 1XMSA 4D0LB 4IFBA 2HCJB 1LS1A 2AWNA 4W7SA 3AKDA 4TTRA 4NCNA 3UKDA 4NZYA 5EZ5A 2O52A 3FKSD 4LJ4A 3TR0A 1XXHB 3OIUA 2G0TA 2BMJA 3GLHE 3AF0A 4XWAA 3ZD7A 2OCPA 2O0HA 2J1LA 4U02A 4PO8A 4WVFA 4LJ7A 2F6RA 2FSHA 2EU8A 1UKYA 3ZYCA 2GCPA 1FFHA 2ZETA 4Q1EA 4NONA 2ZRAA 1E2EA 4KFSA 1GAJA 3ZZUA 3EPHA 3D6TB 1YU9A 3RS3A 3ZJYA 4URYR 2ZRHA 4UNSA 3WHKA 521PA 1Q57A 3GJ8A 1GG2A 1EESA 2WVJA 2YWGA 3ZIAD 1N3BA 3Q7PA 3DZDA 2Q21A 4L16A 5B58C 1TX4B 4A9AA 1WXQA 2IBMA 1EFUA 2FFAA 2R62A 2CEAA 3GLHA 3RS2A 3R20A 4Q19A 4QM6A 3X1XA 1G3MA 2GWHA 1FL9A 4Q5IA 4QOSA 1LF0A 2FMXA 4DIEA 4XTRA 1G8GA 2F9MA 1N5KA 2W0MA 3AVOA 3QI2A 2CNWD 2QL6A 2QTFA 4XVQA 2XAUA 1XZPA 3LAWA 4LV6A 4WZ6A 2BMDA 4DLSA 3FMOB 1ZU4A 1P6XA 3KJIA 4ASUD 1Q12A 4RD2A 1KI8A 2RGAA 1I2DA 2PZFA 2GA8A 3GLGA 5IF9A 4DCUA 1NVUQ 4UNPA 4HDCA 2QRNA 1JR6A 5FR1A 5DH9A 1BS1A 3FFAA 1SKYE 3SYLA 2DBYA 3GEEA 2AN9A 4XIGS 5CM8B 2WTUA 1EXMA 2E1RA 1P2VA 4JLDA 1NN0A 1NIJA 4KYUA 1MH1A 4EPTA 2J0QA 1HQYE 2IW3A 1Z07A 2Z83A 2I1VB 3J81k 1T3LA 4ARZA 4WIAA 1MO5A 2NPFA 4MQBA 1EFCA 3P32A 1A2KC 2C9OA 1AA9A 1SVSA 1SXJC 3ZVRA 3OEHA 3NDPA 4LHZA 4EQ6B 5C1BA 1G8PA 4PHFA 4RFSB 5JI3E 3AF2A 4AKIA 4D25A 1ZRHA 3K9LA 3PEVA 4IDPA 4ZKEA 4CEHA 2WWFA 4CGZA 3H86A 3QY0A 5JS7A 2PCJA 1UBEA 4ZCMA 4NCJA 5FTJA 1HQCA 5FPSA 3AUXA 2HJVA 2ZRPA 2ZM5A 2IXFA 1G5PA 5F98A 4BECA 2W58A 3TLXA 2GBLC 4JS0A 1M7BA 3IBGA 4JVSB 2OV2A 2GEVA 3BAFA 1XD2B 4D0GA 2JASA 4BLQA 3MJHA 4BLSA 5GVRA 4S2EA 4M1KA 3UXMA 4II7A 4P4SB 4PO9A 5EQTA 1E3MA 2B8WA 3AV0B 1AZTA 1Z6GA 2ZJZA 4V0KA 2AKAB 3MWJA 4O0MA 4B32A 3IDQA 4W9MC 3SOPA 3U44B 3OE7D 3RWMB 2GJKA 2VRWA 3X2SA 1GKYA 2WJJA 3KXLA 2CVHA 3GLFB 4QM7A 5DLQC 4E03A 4JKYA 3FYHA 3EIEA 4HUQA 2QBYA 4EPVA 1RIFA 3WNDA 2QT0A 2VTKA 2WIBA 4URWR 2DFTA 3GJ0A 3TBKA 2Q3FA 1NF3A 1DAFA 1GKIA 3BH7A 4TYPA 2F43B 4MITA 5E95A 3A4NA 1FQJA 1N6KA 3OIVA 4RD6A 3LLMA 1W4RA 3RVBA 2VSXA 2P6NA 3HJNA 3THXA 1UKZA 4AG5A 3LD9A 3DM9B 4UXIA 5DYGA 5KOYA 1V5WA 3FWYA 2XJ4A 1JXMA 1B0UA 1FNMA 1FZQA 3BFXA 3E5HA 1CTQA 3QOFA 1AS0A 3THYA 4CEIA 2FG5A 1A2BA 1NRJB 1GNRA 1SVLA 1GL9B 3KJGA 2I1QA 1LW7A 5DISB 5LDDC 1KSFX 1L4UA 4WOPA 1RC8A 1OIWA 3NBFA 1L7VC 4ASUA 4BFUA 1N2CE 1Z3IX 5FOWA 2HLDD 2EW1A 4KI0A 5D3MA 1IHUA 5JWHA 1G4UR 4GRAA 4JBXA 1W0KA 2OCYC 3Q9LA 2CL6X 3MFYA 1W0JA 1BO6A 4HAYA 4DLYA 2OT3B 2VBCA 2JIZD 4ABYA 1WBDA 1NN5A 5GJCA 2YJTD 4UNQA 2WBLC 1NBMA 1KI6B 2EWWA 4QKQA 2RHMA 1GP2A 1KNQA 5HCIA 1G6HA 3AVPA 1CF4A 4S35A 2NMVA 1US8A 1AS2A 3AKYA 3UANA 1F2TB 1LY1A 2K5UA 5DSZA 3FPAA 2YWEA 3NEJA 3QG5A 2PMDA 2PZEA 4I1UA 4JLBA 2W83A 4URVR 1DADA 3WY9A 3VKGA 1TMKA 1CULC 1E0KA 2NGRA 3K0CA 1PLKA 2CHQA 4LI0A 1A4RA 1IXRC 2P65A 2EFCB 1E9RA 3P20A 5SZKB 1ZUIA 2JLYA 1WQ1R 1VCNA 3WMEA 3PG5A 3B7GA 1DEKA 2GAOA 4E07A 2N42A 1RZ3A 2ZROA 4JLKA 2V4ZA 4TN1A 2XB4A 3P4XA 1A82A 4FCWA 4AC9A 5FOUA 2C98A 1KY2A 2ZE6A 2IT1A 5JHHB 2P6UA 5FPYA 4PZZA 2LWIA 1G7CA 5BYJA 4MRPA 1EWQA 2YKGA 2ZU6A 4OHZA 2GZHA 3K53A 1DS6A 3ZGXA 4I99A 5DN6A 4KLNA 3ZVLA 1QHHB 1IONA 2QSYA 1XDBA 4Q9LA 3SC3A 1D2MA 2O0JA 5P21A 3X1DA 3B1XA 5FL7D 1JAHA 2AD5A 4Q4HB 4NDZA 4DB2A 1XXHA 4JKIA 5KSZA 4M8NE 1E9CA 4MGZR 5FTLA 3SU8A 3MG9A 4BZPA 4Q7JB 1ZVQA 1ZAKA 3R7WA 4CEJB 1TF7A 4OYHA 3K70C 4DLUA 2IEZA 2E87A 5J47A 1OPXA 1LFDB 1OHHD 3PEUA 1AKYA 5H68A 3SEAA 3EA0A 3AVTA 1YKSA 1QBKC 3EIHA 1N0UA 3HP1A 5DHAA 2O8DA 5AK0A 3RWOA 4JJKA 1F3OA 1DAHA 4HB2A 2OSBA 2EVWX 3SE0A 2ZSEA 3HU3A 5EXSA 1SVWA 1XEWY 3QIAA 5EP4A 4DB4A 4B71A 1GITA 1HE8B 4ZDWA 2WM9B 2G3YA 3H2YA 5EE3A 3C41J 3IQXA 4G1UC 4CF7A 5JBQA 2BBOA 1U0JA 1C4OA 3LBNA 3IGFA 4GOKA 5J4HA 2ZI6A 4GZMA 2CHGA 1L4YA 3CZPA 4Y0AA 3QQ5A 1F60A 4IXMA 4LRWA 4Z1MA 3I5YA 1KIMA 3F0TA 4QBIA 4ZI3A 1GL6A 4P4UA 4UNRA 3U60B 5DIFA 4Q02A 3TJZA 1ANKA 3PQCA 3U3OA 3HU2A 4Q9IA 1Z2CA 5KSPA 2NIPA 3TUZC 2CE2X 4TMWA 1ZNZA 2J0UA 3IPXA 4I1VA 4EPYA 5DO9A 4EFNA 1OH5A 2OAQ1 2ZYTX 4LJ9A 1CR1A 1MRNA 3A1WA 2ZUDA 1AKEA 1KAOA 2GXSA 4EPXA 4H1UA 4U00A 2CL0X 3REGA 1RFLA 2W6JA 4DLVA 5G41A 1F2TA 4Q1DA 4OL0A 3IO3A 5BXQC 3KQLA 3QF4B 1MRSA 1E0AA 3BK7A 3EX7C 2YHSA 1H8EA 1XXHE 2H57A 2F1RA 1RYFA 2ZPTX 1BIFA 1T3HA 3SFZA 1ZCAA 4EIWA 1S2MA 2YZ2A 1AQUA 4OBEA 4LPKA 1Z2AA 4D82A 2JIZA 4K8OA 2JEOA 2C04A 2H5EA 2YC4C 4JL5A 3CRRA 4Q4AA 1KHTA 4MRSA 4UJ3A 2R65A 3HPQA 1E32A 2ORWA 2A5DA 2ERXA 3SJAA 2IWRA 2G0NA 1S8FA 2D2FA 4I4LA 2X1VA 1S3GA 1Q20A 1J7KA 1JPJA 2WAXA 3PUVA 2ZU0C 1E2FA 4LHVA 1G4AE 2AWOA 4PO1A 4NP6A 1N5LA 1U0LA 2UKDA 4PQYA 2J7PA 1RE0A 3NC0C 4L15A 4FMCF 1NLFA 1P61B 3ETLA 4TLDA 2WJYA 4CT5A 2FFQA 5DYIA 1TEVA 3RRNA 3X1YA 5EJEA 3CWZA 2F43A 2IF2A 4QNRA 5IHPA 1VPLA 2BM0A 1IOZA 3NEYA 4G01B 2IUTA 4E09A 2REXB 3U7FB 4AK9A 2NZ8A 1BH2A 2QQ0A 4M9QA 2IYSA 1A1VA 2D4HA 3W5IA 3DMNA 3BWDD 1E1RA 2HT1A 3DHWC 4IOJA 2YYZA 5EE0A 5C2JB 2QU8A 3KUCA 1Z22A 2R6AA 5C4MA 5G3ZA 3KX2A 4YONB 5EZ6B 1M6NA 2J87A 5TV2A 4B48A 1S96A 3MWYW 4HZUA 3VR3A 4BFWA 1YR8A 2EFHB 1KMHA 4LYAA 4Q21A 2O8EA 4LX0A 1Z29A 2DPXA 3BXZA 2Q9BA 3FB4A 4HZIA 4V03A 4PX9A 3VHLB 1W5SA 4CRWB 3WYGA 4B34A 1W48A 4C0QC 4DSOA 2V6IA 1XD2A 3CO5A 4EFMA 4TWZA 2KE5A 4PC2A 2VHTA 3B85A 1VG1A 2AK3A 3U7GA 2DFNA 3KKMA 1U8YA 3SN6A 1QDEA 1U90A 1F5NA 1KTVA 1GDDA 4B2PA 2VSFA 2QP3A 4KXFB 4OQMA 1RJ9A 1XEWX 3NH9A 4A6XA 1UM8A 2ZUCA 4C3ZA 4MGKR 4TQUS 1IM2A 3UG6A 1DELA 4EQ6A 5D3QA 3AP1A 3W8NA 1DAIA 1E94E 1JEDA 5JRJA 1TQ6A 3LA6A 2BEJA 3QXCA 4OHVA 3TUIC 1F6BA 3O8DA 4MGYR 1XD8A 4JLJA 2QQEA 3ICQB 4P4TA 2BV3A 2YOHA 2BM1A 3KXIA 4DDUA 1HURA 3PV0A 5KSYA 4AIIA 1FTNA 3LRPA 2VSOA 3GLGE 2PX3A 2CJWA 3SHFA 2FV8A 4A4DA 5E4FA 4MRNA 3FTQA 1MABA 3TH5A 2MSEB 3U61B 2F1IA 5BWMA 1DBSA 1PJRA 2MSDB 4OQFA 1I4TD 4PSKA 3HWSA 3TGPA 3BS4A 1OXVA 5JHGB 2J41A 1DG3A 1E69A 2J5XA 4WBSA 1TTTA 3THOA 4KHZA 5HKKA 3V9PA 2PH1A 2X2EA 1IY0A 1E2DA 821PA 3EWSA 1RVDA 3RANA 2GF9A 1BOFA 2ERYA 4HAVA 3EZFA 3LVRE 3RS4A 2D06A 2OG2A 3MD0A 3IPYA 1RRCA 1G3IA 1G291 2ZRJA 3FMPB 4JSTA 5ANRB 1HV8A 1CJKC 3SJCA 1XU4A 1YZUA 3N70A 3P4YA 3QKTA 3L0IB 4B76A 3F8TA 1XPOA 1OKKD 1FUKA 1SXJB 1QHSA 2JA1A 3K0CC 1D8TA 3NC1C 3BJIC 4IHQA 2P5TB 2R6CA 2Q9CA 1VYUA 4C0SA 1G20E 2IYYA 2ZE5A 4MDFA 4P32A 2WJGA 5FUWA 4IFEA 4KAXA 1FOEB 3BB1A 3K70D 4DCVA 3CLVA 1Q1QA 3VR1A 2GCNA 4PTLA 4ZCLA 2IYXA 1CR4A 1P5ZB 2ZAOA 3K9HA 1X8JA 4ITRC 1ZYUA 2Z4SA 5CDFE 2CCGA 1NBMD 5B64A 2RKOA 2ZRMA 1RPZA 1XCMA 4A82A 2C9CA 2GVDC 1G18A 1OXTA 2WOOA 2QMUA 5BW8A 3E1SA 2RGXA 4LYHA 1W36D 2XJ9A 3VHXA 1BYUA 1CJTC 1ODFA 4UNNA 4B6FA 2F1JA 1VG0B 3HR8A 4JYBA 5DI3A 1P4SA 3KL4A 3MWLA 4GOJA 3AP2A 3WXMA 3QVVA 1CIPA 2J9RA 2HT6A 5FUVA 3BIFA 4CEIB 2J0SA 3A58B 1IN6A 3I32A 5JS8A 2GVZC 3S1AB 3V4RA 2PEYA 4LV8B 3E70C 2CXXA 2OHFA 4XOIA 4Q1BA 4Z1MD 121PA 4OHXA 1HA3A 2XTZA 4TL6A 1G64A 4RCYA 1XCGB 4KJZA 1ZNYA 1U94A 4QBFA 1P75A 2H17A 3OEED 3QEJA 2QUZA 4DSNA 2ODNA 1NJGA 4KSBA 2HEIA 2J46A 1SHZA 2Q6TA 3FVQA 1QVRA 3Q5EA 3SYKA 3U7EB 2ZTSA 1N5IA 3O47A 3ZVNA 2OCAA 2WKRA 1NNEA 2PX0A 3EG5A 5KPDA 1EX7A 1T6NA 3NBZC 4NCIA 1AGPA 1KK1A 1PZNA 1RKBA 1W47A 2OCBA 2R2AA 4B2LA 1MO3A 2R8RA 4A92A 2QI9C 1SVOA 3B1ZA 4RKEA 2YOGA 5FOTA 2VLIA 3NBYC 3VFDA 2FGKA 5FL3A 4FW9A 1YZTA 2QE7A 2GK7A 4YDHB 3QBVA 4A8JA 1FNNA 4L8GA 1ZC3A 2DWOA 3CRMA 3T1OA 2QY9A 3VNVA 1T8UA 1GZSA 2R9VA 3AGQA 4BASA 1DAMA 1GRNA 2NOAA 4M1YA 4A0GA 3I8XA 5HTKA 2FX3A 4KFTA 1CR0A 1JQLB 3DM5A 5UKDA 5KDDA 1BYIA 2HF8A 3CNOA 2QAGA 1NKSA 3I4LA 1MV5A 4FINA 3VR6A 2AXPA 2H1LA 4GT1A 2E9SA 3CBQA 2Q9AA 3ZS8A 1FQKA 4FMDF 4RJLA 4RY2A 4XD7D 3DPUA 3GP8A 1UBGA 2ZRCA 3CX6A 4RZ3A 4BZQA 5HZKA 3ADKA 4JT4A 3ZQ6A 5SZIA 4OQLA 4TLCA 3F5FA 3THWA 1OIXA 5FFMA 5FOVA 4XWOA 1G3QA 2OLJA 1M34E 3BGWA 1PVOA 1D5CA 4J0QA 1NLZA 3IEUA 4AYWA 1U8AA 3WYFA 3K9NA 1VECA 2MMCA 4YMWA 3T15A 3W6NA 4ILEA 3BH6A 4KBGA 3PXGA 4MKHA 2G6BA 2YOFA 3C16C 5FPTA 4GP6A 2XTNA 1G6OA 4GNKA 2DHRA 1W5TA 2OXCA 1UKVY 4A2WA 3FHTA 4A2PA 5HR5A 4HAUA 4RZ2A 3A1SA 4FMDB 2BKEA 1J70A 3MWKA 2G88A 3B5JA 1IY1A 3B13B 4D4KA 1ZM7A 4TTPA 1U8ZA 1GWNA 2A5GA 5CITA 3GD7A 1SKYB 3BRWD 3NIBA 1XF9A 4HLUA 1E2PA 5CIWA 3FKQA 4FIDA 2N46A 1OLOA 3THYB 4NYJR 1WDTA 3L43A 3VR4A 2OFOA 5CM9C 4P31A 4LGMA 2UZIR 3UWKA 2YVUA 5JJKA 4DLTA 2PEZA 1D6JA 3K9GA 1N25A 4FD2A 1H8HA 2A9KA 3EZ9A 5CB8A 5TDHA 1UADA 4DWJA 2QAGB 1OH6A 2GJAA 1T3SA 1IBRA 2FPKA 1XTRA 3K8YA 6Q21A 1X1SA 1COWA 1K5DA 1SXJD 2VP5A 1VMAA 3T61A 1E2QA 2ZJ2A 1LV7A 5C4GB 4POAA 1LS6A 2KBFA 1KJWA 5JMTA 1S4QA 4Q9KA 5IRCD 4DCTA 3L0SA 4EJSC 5JJIA 1Z6XA 4RD3A 4L5BA 2WWWA 4M1MA 3LBHA 1RJ9B 2DFLA 4PXAA 4IVQA 1Q1ZA 2FJUA 5J4KA 4FCTA 3FGNA 1M2OB 4UXHA 4C0JA 3AUYA 1R5BA 3U6BA 2ANCA 4URXR 3TQFA 3Q85A 2XNDA 3OEHD 3NHBA 1D2NA 3GEHA 3GJ6A 2Q3HA 1Z47A 3KQKA 1Z6YA 2BJVA 2HYIC 1TU3A 3I92A 4PC1A 5JWRA 1I2MA 4JVMA 2VHCA 1CJVC 3GJ7A 3PUWA 4D26A 2RGDA 1M1YE 5GJBA 1GSIA 1E9FA 3KKOA 1VCIA 3GJ3A 1G17A 2ZS8A 1E9BA 4UXJA 3UATA 4M1OA 2NO7A 2B7CA 1YRAA 4PAQA 4RFSA 5FBQB 2NPIA 4RFVA 4R2IA 1GKUB 1WF3A 2C77A 2PBRA 2QM8A 3TKLA 2O8DB 3PITA 2BKUA 4F38A 2WAYA 1U0HC 4OI0A 1W7AA 1VCOA 1YR7A 1WBBA 3PUXA 3SNHA 4Y0VA 2VH5R 1T0HB 2N1BA 4Q66C 1TQ2A 4R9UC 4QHTA 5AJWA 1NN3A 4LPSA 4TMZA 5KYKA 4QGAA 4YQFA 2RGGA 2PLRA 1II9A 3HU1A 1BKDR 2AFHE 5EUMA 1UDXA 3SI7A 1E98A 3SS8A 1KNXA 3SFVA 3T35A 3EXAA 3MLEA 3M6AA 1GUAA 2FE4A 5L3QA 4IVPA 1EGAA 2DR3A 4TMXA 3AVYA 2H16A 4B33A 2FOLA 4X8LA 4HAXA 3IIMA 4HEJA 4ZO4A 2IHYA 1XTKA 2ORIA 4XWKA 2JLSA 1KGDA 5KDOA 3Q7QA 2W0SA 2B92A 3TIFA 1ZMXA 1M74A 3SJBA 3JZAA 1NP6A 2IK8A 1OJLA 3A36A 2GJ9A 4CYMA 1G8YA 1AZSC 1G8FA 1UDWA 2C8VA 4IXNA 3V00A 2Q0HA 2FSIA 3EASA 4D4MA 3IIJA 4ZDJA 4LBVA 4EFLA 4FWTA 3IKJA 4QL3A 3N5CA 2GNOA 3FDIA 3BC1A 2D7CA 3L8ZA 2C2HA 4C2TA 1QHYA 1Z0IA 1XTQA 1BMFA 1PUJA 4Q4JA 1KDPA 3WRYC 3O8CA 4AKHA 1VDZA 2LCFA 1ZIPA 4PZLA 1W36B 1U98A 4V0MA 2IL1A 3UMRA 4Q4JB 3NWJA 4NBSA 1KO4A 4NL4H 5FPKA 5IT5A 4LBWA 2AFIE 2OILA 1GILA 4QGGA 1KJZA 5TARA 2FN4A 4PQRA 4AD8A 2ECKA 3W34A 2ONJA 2JLWA 4GDFA 2CBZA 1E2HA 1KJYA 3F3YA 4X8HA 5LD2B 1G8HA 3OIYA 2ZI4A 4HAZA 4LYFA 2KWIA 2BBSA 1TADA 3HDTA 2JJ1D 4JLPA 5FBWB 2RCNA 3U5ZB 3THWB 3CIOA 2A3RA 1IJFA 3K0AA 5KO2A 5JEDA 2IYZA 3AVUA 2ZJBA 4D4JA 1ZUHA 621PA 5KHOC 3PEWA 3RHFA 2GJSA 3RSOA 3T5DA 1W4BA 3QUSA 5AUQA 1CEEA 4PPQA 3SBEA 2O5VA 2L0XA 4WW0A 1UBFA 5KDLA 2W2TA 2NO0A 3B60A 1U99A 4QJ5A 2A78A 1CS4C 2VF8A 2ZJ8A 1XEFA 2QM7A 2BHRA 3AP3A 3CRW1 4HDOB 1OE0A 1SQ5A 3P1JA 4Q1CA 1VIYA 3LO5A 1FP6A 1MT0A 3LW7A 4L9WA 2JLZA 2D74A 4Q48A 3WNBA 3PENA 1SULA 1MOZA 2WWHA 4Q4HA 1XTSA 1FX0B 4JVNA 3WBJA 2O8BA 1KI7A 1NVWQ 4HUQB 2QBYB 5K8UA 3HYRA 1PLLA 4AG6A 4BFVA 2CL7X 2QAGC 3GLFA 1HH4A 1TF2A 5AJVB 1P9WA 1XEXB 1G9XA 1QHHA 4FI3C 4LHYA 4A8JB 4B35A 1NY5A 4KFRA 5AJZA 1OHHA 5DI9A 5SZHB 1Z5ZA 4HATA 4TTQA 1EK0A 4JBWA 2PJZA 1CR2A 3QNUA 2IWHA 1T4GA 2JJ1A 3KKQA 4DIDA 2QA5A 2OBMA 3K0FB 4DEXA 1E4VA 1GNPA 2C03A 1N6LA 5KNDA 1DE0A 2CK3A 1R4AA 1OFHA 4OQXA 1W4CA 2X8AA 3FOZA 2GRJA 3M0EA 1KOFA 1JJVA 5LBIA 1CXZA 3TE6A 3IO5A 4MYHA 1M8PA 2G83A 4JLOA 2F7SA 4IDHA 1G1MA 4F7WA 1DVRA 2YINC 1TUEA 3FHOA 1ZP6A 1KMHB 4KODA 5JECA 1R8SA 2JJ2A 4KCGA 5LB2A 3IEVA 3B9QA 1SVIA 2R6FA 3AQ4A 2ZI9A 3HYTA 3MMPA 1HT2E 2BMEA 3D7MA 1OV4A 3GMTA 4R71A 4ARZB 4C0AC 3MRSA 4Q03A 1OH7A 5KU1A 2IXEA 4IDOA 4BLOA 5AUOB 1IN8A 2FEMA 1E0SA 1LB1B 2FSFA 1XWIA 2H18A 4I81A 1KYIA 2WWYA 2ZITA 2WSSA 3I73A 5D3MB 4OI4A 1S0UA 5J4VA 1E2NA 1JBKA 1P9RA 4A0HA 3C5CA 3C7KA 3Q72A 1NVXQ 2HV8A 2XXAA 3WP1B 2CCJA 3MGCA 3GLFE 4F92B 2OE2A 1QRAA 2HXYA 4YMTA 1GM5A 3H1TA 4LJ5A 3KKNA 2HYDA 3I1FA 1Y3AA 3AB3A 3WP0A 2B8TA 2BDTA 4G5SA 1J8MF 3M1IA 3CRVA 3LXRA 4Z51A 4AY2A 3QPUA 2XTMA 2QEQA 4V0NA 4EUNA 2V1XA 1RW4A 1XNJA 2WMOB 4DLRA 2GBLA 1CJUC 1NKTA 1XRJA 3WNCA 4D4LA 4RZUA 1XTJA 3T1QA 2JCSA 3MJRA 4O25A 3QE0A 2GEUA 1XP8A 4B3BA 4BFYA 1IN4A 3GPLA 2AL7A 2GF0A 1KSHA 2FWRA 2DWQA 4AURA 4DUGA 2VF7A 2NO1A 1U9IC 1X6VA 3CH5A 1KI3A 1MABB 1XJCA 4PAOA 1N5JA 4DSTA 5DHFA 4NE2A 1N6RA 4B44A 4Z54A 3K0FA 1X86B 1JALA 3B8HA 4QRHA 1VTKA 3PCRB 4ZKDA 3ADDA 2CLSA 4QJ4A 2A7QA 2CCKA 5CK4A 2XEXA 2P6RA 3B82A 1R10A 2V6JA 1OKKA 2ZYWX 3CR8A 1QHXA 5FUXA 4C0KA 3PJRA 2KI5A 2G77B 4ZPXA 4TMKA 3EA5A 2LKDA 3ZD6A 2ZJYA 3I5XA 4DZZA 2WSMA 3IUYA 4DDWA 3EZ6A 3WRXC 3EPLA 3AEZA 2BEKA 2BIFA 4OJQA 4GI7A 2O0KA 4EJSB 2ZSFA 1RYHA 4NTZA 4PC3A 1ESMA 2CJWB 2JLQA 4DSUA 1E2JA 1UEIA 4OK3A 1T9HA 2VP9A 3KQUA 4WZBE 2OAP1 4K46A 2OFXA 2JJ8A 2RGNC 2XB2A 2BBWA 3OF5A 2IS6A 2IXGA 1KI9A 1MO6A 1Z0AA 2JDIA 2QMEA 1JQJC 4LYJA 2D62A 4ESVA 1M7GA 2C96A 3LV8A 4GSYA 4JZKA 3I61A 2PJRA 1KI2A 3OFNA 1NIPA 3BD9A 2FA9A 3QPVA 4EPWA 2IC5A 1CJMA 1T91A 4PHGA 2IS1A 2WKPA 3B9PA 3DKVA 4MA4A 5GADl 3KFXA 3NHAA 3WBKA 5DGXA 1Q1EA 2RMKA 2V7QA 3CW2A 3VKHA 5BN3A 2BCJQ 4R2HA 1TPZA 3JVUA 4Z8XA 4RVCA 3EPJA 5FTNA 2ZYUX 3TVTA 2B21A 4TT3A 3B1WA 1S9HA 2IUSA 3SDZA 4EAQA 4GL2A 3V4FA 3T5GA 4TYWA 1E2MA 4YDSA 1GRRA 1W0JD 5TXGA 4X8MA 1WE2A 3L8YA 1GNQA 4DC9A 4F4IA 3RLFA 3B6EA 4JLNA 3A8TA 2XOKA 5HCNA 1VHLA 1OYWA 3ECCA 2W6IA 4LHXA 3K09A 1VHTA 2EFEB 4HI0E 1SGWA 2IYVA 2FEOA 1W1WA 3TSOA 1IXSB 3KKPA 4A1FA 5DI3B 1OT3A 3ADBA 3TW4A 2QORA 4BUJA 2O8FB 2H92A 1EFHA 2WHXA 3G82C 4MRRA 2RAPA 4PR0A 4BFXA 3ZZTA 1NI3A 2YV5A 3C15C 1OB2A 2DCUA 1DAKA 2D2EA 4LJYA 4TYQA 4RSGA 4JL6A 5B30A 1US8B 5L3QB 2ZR9A 4DVGA 4QBHA 1KSGA 1SHKA 2QG6A 5TB5A 5KNCA 2RHDA 2VO1A 1QZXA 5EP2A 2IYQA 1TF5A 3NDBB 4NYJQ 2V55B 4LHWA 1LTQA 4MH0R 4MGIR 5CJPA 4U7DA 4MYUA 2ZE8A 4NU0A 4XTCS 1Q0UA 3VMFA 2EQBA 3SZRA 3NVAA 4DUGD 1XFAA 3BB4A 3KUDA 3ASYA 4IEEA 1B23P 2VHQA 2V54A 2RGEA 4O2RA 4W5WA 1S9DA 2WOJA 3JZMA 5BYKA 5L3VA 1SXJA 3TR5A 4ZIRA 4JYCA 2GXQA 4Q1FA 1KDRA 4IW3B 2ZI5A 2VP4A 5HE8A 1Z06A 1MKYA 4RD1A 3I3SR 3K1JA 4DXAA 2QMHA 5CYOA 1R8QA 4LWZA 3OZXA 4US2R 4DJTA 1NSFA 3RC8A 2FPLA 3TRFA 1W44A 5C46F 1NN1A 3IIKA 5HKKD 4NHOA 3U7HB 4G5QA 3EAQA 3OFND 4PSAA 1E1RD 2J45A 4QHYA 2H7VA 5E3HA 5HE9A 4DCNA 1JR3A 3FMFA 3LVQE 4BFSA 1XD9A 4DLWA 3UPUA 4H1VA 1IY2A 5LB4A 3W5JA 3TSZA 2ZE7A 4MDEA 3AF1A 1EG7A 3B1YA 1RRFA 3ASZA 1ZM4A 2W2VA 1HT1E 2CHVA 4PPNA 2OM2A 5F2EA 2WJVA 1X8KA 2FFHA 4GOXA 1XMJA 1WA5A 2GZAA 421PA 1X8LA 3K09C 3L82B 4HYYA 3AGPA 4D80A 1NBME 2PT5A 1YZKA 3EC2A 3U3MA 5IDVA 2X2FA 1LVGA 1G7TA 1XJQA 4C0LA 2KSQA 3TNFA 8OHMA 2ASEA 4WA7A 1AN0A 2O8BB 2ZYVX 2ZIAA 2JAQA 4KVAA 2OFWA 2KJQA 2WJHA 3R8CA 4LZZA 5G3YA 1JAIA 4TLEA 4W5JA 4ERNA 4Q7KA 5H70A 5HPYB 2XZPA 2ZR7A 4UQOA 1IXZA 2ZR0A 4PPGA 1DOAA 1N6IA 4WXPA 5CIQA 4B3DA 3W8RA 3N2IA 4N0DA 4RKFA 3KQNA 3QXHA 1JI0A 5BN5A 5LPNA 1OW3B 4BFTA 4M2LA 4BEBA 2JGNA 4LJ6A 2NO9A 1E9SA 2WICA 3VR5A 2BWJA 3ZDQA 1VCMA 2RGCA 4LY6A 2W2XA 4NYIQ 2TMKA 2O8EB 4MKIA 1JR3E 1K5GA 3LX5A 5FL7A 2EFGA 4KLZA 1G16A 3O8BA 3CM0A 3GLHB 1ELOA 4G0NA 3DDCA 2A5JA 3ZH9B 2GXUA 4D2IA 3QKSA 2ZRGA 1DARA 1I4DD 2FH5B 4KSCA 1HTWA 5K8LA 1HEIA 1NY6A 4YC7A 4JSYA 4QGHA 1OB5A 2IEYA 1VG8A 2XGJA 3CZQA 3KQHA 1BMFD 2FU5C 2REOA 1TU4A 4OK6A 3W90A 2IYTA 1UJ2A 1CRQA 2DY1A 4F4JA 1L8QA 1OXXK 3LFUA 1IN7A 1T5LA 3I72A 4M53A 4IRUB 1CU1A 2F1HA 1VG9B 3CNLA 2IYWA 2GK6A 5L8VA 3VX4A 3GLIE 3IBYA 3MAAC 3QKUA 1KI6A 4LOAA 4TZ6A 3CUEF 4IDQA 1FPMA 2ZI3A 3LY5A 3QKRA 4D0NA 5G40A 2QP4A 1J99A 1XB2A 1DAGA 2JDID 3VAAA 3WMGA 3GJ4A 3QPWA 3A6PC 1YRBA 3EZ2A 2MSCB 1K8RA 1AM4D 1E6CA 1FMJA 2JATA 1TAGA 2C9YA 3IHLA 3IHWA 4A0RA 221PA 2QTVB 1ZC4A 4KU4A 4DLXA 1PLJA 5AUPB 3P26A 3VU9B 3QF7A 3TUJC 4O3MA 2XSZA 4CZ2A 4B2IA 2WJIA 3CONA 4HUTA 1TNDA 3AVWA 4B3XA 3RS7A 2OESA 4HLCA 2SHKA 4KO8A 2QAJA 1YQTA 5EE5B 1II8A 2D7DA 2QPTA 4TL7A 4LUCA 4Q4LA 4Q7MB 4V0OA 5G53C 1XMVA 2WKQA 5TMPA 3LBIA 2ZSAA 5JWOA 4C30A 4ZCIA 1OH8A 3LQQA 1NMXA 1Z6TA 4PPFA 2BBTA 1KAGA 4B6EA 4OKSA 4A36A 1JB1A 1J90A 4LJAA 2XITA 2ZS7A 3KTAA 1P72A 4PC7A 1O3YA 4YLGA 2AHOA 1XTIA 4URZR 4OQNA 4LCBA 2JLRA 3WMFA 5LD2C 1ZD9A 3OEEA 1II8B 4LDJA 1R5OA 3W3ZB 2Z6VA 4EPRA 2EFDB 3VTKA 1G5TA 2ANBA 3TK1A 1Q44A 2ZREA 5FBLB 1QVAA 1KO1A 4B74A 3GLIA 1S1MA 3Q5DA 4WZAE 4YMSA 3FE2A 4DCSA 2A30A 2GCOB 3ONWA 4OI2A 4ZV4A 4CW7A 2QGNA 3GJXC 4IVRA 1UPTA 4QC2A 3U3KA 2WSSD 1F2UA
chains in the Genus database with same CATH superfamily
1Y6DA 4U2DA 5FOQA 1Q5PA 3AR6A 4FFDA 1FMTA 4FE4A 4Q00A 3VNSA 3ZU2A 5GZ3A 5BW4A 4OBWA 3VHQA 4I5DA 2JAPA 2ZCJA 3ES9A 2I78A 5JISA 3BJEA 2Y1WA 5EFZA 3IJPA 3T3DA 3VR5H 1J1UA 4IH9A 1ZM2A 3DZKA 3HDHA 3LNMB 1FC0A 4ZANA 4PWZA 1QE3A 1CUDA 1XPUA 1C8LA 2J3JA 3HRIA 3U6KA 5KVCA 2GPWA 4PSVA 2XCQA 4RABA 1N1GA 2XCOA 4XX0B 4YO7A 3WTCA 1E6LA 1R4NA 4AF8A 1WV1A 2I6GA 4BZWA 2BTEA 4F6RB 1YB4A 5EKUA 3JU3A 5FH9A 1FMFA 3KJFA 1II0A 3HYLA 1LNSA 2ZKIA 1IEVA 4L27A 3HCDA 5BYBA 5BOSB 1YZLA 2CXOA 4ECEA 5F12A 2PGIA 3UV7A 4FUQA 3ZIAA 1FFCA 1D0XA 2O8VA 4NV3A 4WADA 3A1VA 2G07A 1GPKA 2VWPA 1U5AA 2HXSA 3EVGA 1O8CA 1NU8A 3AF3A 2PMKA 4QQ8A 4URHA 3IRUA 5I7WA 3JQ9A 5JC8A 3GUUA 4OH1A 4B6OA 3I9OA 4RENA 1TQDA 1QHNA 1XVLA 1T1JA 1XZDA 5M29A 2XRZA 2RGYA 5DDIP 2XWJI 1HFEL 5JAUA 2VK4A 2O3UA 5A5GA 1H3EA 4R9VA 3QXSA 1LC3A 1A9QA 1H93A 2QK4A 1VXRA 3RS0A 2QLTA 3CEPB 5CK5A 3QG1A 3CEXA 1NPYA 2FZWA 1KL7A 3GI1A 3G13A 4LDZA 3OD1A 4MB6A 3T7TA 2OGUA 5D86A 1ZIOA 1RYZA 3S5UA 2ZT6A 1ZINA 4QXMA 1N3YA 4E0IA 1TK9A 3BH0A 4MS2A 1HM5A 1UBCA 4PLZA 1QS0B 2BEUA 2AE1A 2Y1DA 4CODB 5AWFC 2VCBA 3HE3A 2D1RA 2EJTA 3RFFA 3KCNA 3IPRA 1H4VB 1PK9A 1FFSA 3RRBA 1XN1A 1YVDA 3U4MA 3K8OE 2O2SA 4GQBA 3UG7A 4KPEC 2AEFA 3TLGB 2AC2A 3S6JA 2DETA 3GJ5A 3SQNA 3AH8A 5J4YA 2Q8NA 4P92A 4R01A 13PKA 3I2IA 3C8ZA 2BC9A 1HMOA 3OESA 3QOWA 2BRUC 1PE0A 2DSTA 3L7JA 4JJ4A 2OBBA 1PDVA 1OFGA 2NACA 5EIAA 4LISA 3TLCA 1RRGA 3GB9A 4G23A 1EP9A 3RYHB 1V8FA 1ODIA 4HLQB 4QX6A 4J7YA 4Q01A 4QUHA 3W4KA 3RIMA 1Y1LA 1OXSC 3ELUA 4L0DA 5CB6A 4NZPA 4PK4A 1J2JA 3IP1A 5I7AA 5K0GA 4TSFD 5E2IA 1DWQA 4TYYA 4JOBA 1PNVA 2PAAA 3D3QA 3FROA 3JVIA 1QK5A 3OJCA 2IXPA 2YXNA 4WJLA 3R6LA 4B80A 3K7DA 3FDJA 5LWQA 4I5IA 3ME5A 4MWOA 4HWSA 1CBUA 5HP4A 2Z04A 3WISA 3IBFA 1V39A 2CNLA 1B8OA 3KB2A 4PZYA 5C8DA 3UMIA 1XWWA 2ODBA 4BPBA 1A7JA 4C2UA 5F28E 4Q7CA 5DKFA 1U31A 3RS5A 3T5TA 1L4HA 1CLUA 3C8MA 5J4LA 3AOUA 4HDNB 4ROSA 3RW9A 1RWKA 3SWWA 4JXZA 1OZHA 1MG0A 2G06A 3SF8A 4GX0A 3KTAB 2MTBA 4CL8A 4AN0A 1OI4A 3ID6C 1Q0MA 2JLVA 2Z43A 1J8QA 2X41A 3EJNA 1WNTA 2FSVA 5GPGB 1ZW2A 1D1QA 3JSEO 3VYSB 5JRZA 4N40A 3B1FA 1QH8A 2PX2A 4CV1A 3KBBA 2ZSUA 2PQ0A 1YCHA 2KBEA 4WQMA 2C2WA 3P2MA 3HTKC 1Z5VA 1CY2A 1UFQA 3PIRA 1WV0A 4OU4A 4AZTA 1CE8B 1OI7A 4J8PA 4NKRA 1XIVA 1F0YA 1E99A 1PYGA 4OLHA 3IE0A 3R0IA 1Q1AA 3CH4B 4DRXB 1YL5A 2Q9UA 1P4RA 3H5OA 3WYAA 4JNKA 4IX9A 4M0EA 1M34B 3OA2A 2W6JD 2J3DA 4BP9A 1FJGB 1DAPA 2B8JA 2GZMA 4WOKA 1AGYA 1M8KA 2O2CA 3SCZA 3DLBA 1ZSNA 5IN5A 2A0UA 1ZWKA 2EARA 5JW6A 4TMVA 1QH1A 1U6HA 4DRIB 3PYLA 4GU5A 3U7RA 4BQEA 4XXHA 5K6TA 3WQBA 1YI1A 1GA6A 1T13A 4AKEA 2UYHA 2ZS9A 3A2MA 5WRFA 1S5PA 2GPAA 2NO4A 5CCXA 1FBNA 2YJ5A 1RWXA 3JZFA 3WV5A 2GN2A 1NXQA 1CP3A 4AMVA 4JQYA 1O8BA 2AIRA 2F59A 3U3RA 5LA6F 3PC8C 1JMYA 1CUHA 2EDAA 4MV7A 2ZXUA 1NMQA 4EEZA 4JHXA 3Q1KA 4TTTS 4U2CA 1Z37A 4RWZA 2LCQA 4CN9A 5BO5A 1OFTA 2BFFA 1XMIA 2FR0A 4L5YA 4NV1A 3ZW8A 3WAGA 1NYTA 3HNRA 1NBEA 1NVVQ 3PK0A 2JFWA 4WCFB 4AYTA 4FOOA 1ENYA 3DEFA 1EBFA 2C2OA 2NPOA 2X7XA 3FSEA 3T06B 4UTVA 4KQ2A 5LP1A 2XCSB 5FXMA 3ED1A 2FP4B 1O94A 1YE5A 3AKCA 3JSZA 2RBGA 2Z56A 4ID3A 1A04A 1E3JA 2EWVA 2Z8ZA 3O1JC 2HNBA 1JIKA 1RKXA 2WTNA 4MIYA 2QJWA 5EXXA 4P8RA 5EMNA 1TRHA 4N76A 2JCGA 1E9DA 1WVGA 2REQB 2GRUA 3D1JA 3F3KA 1XDGA 1EEXB 2X8BA 4KYVA 4REQB 4ME6A 3EXG1 5C5EA 1IB6A 3EC7A 3LVFO 5I4BA 3OQIB 1HE5A 2J7KA 1ETUA 2EKQA 3CUSA 2XDWA 1I5NA 1MAHA 3P0IA 1XOIA 2XBMA 1QQ3A 1HY3A 2O4UX 2RHHA 3RVZA 2XMGA 1SO8A 3PVSA 4JT9A 1JQ5A 1ZW6A 2YL0A 2YC2C 4KNVA 3DYIA 2NQ8A 2R6DA 5SZJA 1WCV1 4F2PA 2GM4A 2Z09A 3T4UA 1Z6AA 2UZAA 5FFFA 3EXIB 1MV8A 5K3BA 1TZMA 2UDPA 3MYFA 3WKAA 5EL0A 3UIEA 4AMUA 4KGVA 1C8VB 1I1QB 3CPEA 3LHKA 1FTWA 2QUBA 3L79A 1DOWA 4A10A 4FLMA 5GZ6A 1YRYE 1T1SA 5CJ2A 5JCZA 2NQ2C 3CH6A 3EWAA 3PCTA 2YN2A 1HT3A 1UC4B 5EVJA 2H9IA 1ZN7A 2Q6LA 1IIRA 5E6UB 1F8XA 4IF4A 3RAPR 3OLXA 5EUQB 1T3TA 4M0LA 5BN3B 1TM5E 1TW2A 4G65A 1HW1A 1EMDA 1RMTA 1QR6A 2IEAA 4EBFA 3WLQA 3TQCA 2C7VA 1YH3A 1KMNA 1OGJA 2OORA 4UTZA 4R2KA 2EYQA 2V1UA 4NPAA 3D6MA 2HRQA 3P2KA 3RU7A 2G5GX 2DWPA 4PLTA 1VIAA 2R4UA 3Q3CA 1LQUA 3F98A 4PY2A 2QNIA 3L6BA 3PT5A 3UMCA 1JFTA 2VKTA 4RKRA 3QVGB 1OX4B 2FPIB 1U7TA 1AMNA 4P0TA 4EB6B 1T2VA 2ZIEA 3GLUA 1EVQA 3M5WA 1E2KA 4TUYA 3Q2IA 1ZPDA 4C7OA 3LPMA 1FSZA 1KYZA 3X1WA 5JT1A 4Y18A 2IYRA 2VDRB 5L3SB 1OJ7A 4KPGA 1UXHA 1NSTA 1D2EA 1U7OA 2OP0A 3KDSE 3HSKA 4OI1A 3RVJA 4JC7A 2VUHB 2JD3A 2ZTVA 4M4SA 4EHAA 3LVBA 3I09A 4NQZA 5KTPA 2XMCA 3A6JA 4FMBB 3I34X 4EJSA 1JILA 4W63A 1P7CA 1RSZA 4Q5SF 4EG7A 5DNYB 3DYVA 2YS6A 5CB4F 3BERA 2H29A 4UHHA 2VCHA 4GSKA 4LY3A 1P77A 2V4UA 1LLUA 2ASVA 2APJA 2Z8YA 5I8ZA 3UFXA 4ZO8A 3HTXA 1H9CA 1FJHA 3SY8A 1P3DA 5TF0A 3RV4A 1I7QB 1BXKA 1H2EA 3RVKA 4CM9D 4I55F 3TVDA 1T5IA 3LLIA 3A4VA 4LF8B 5H83A 5DV9A 1FTYA 3B6KA 2O3SA 2HJGA 4G3XA 2PUBA 1JG6A 1TT5B 2PCLA 3EEBA 2HCBA 2HFJA 4XLPF 2X6QA 3ELYA 4HDMB 3UJ3X 4EGFA 1W96A 3JQFA 1W73A 2VHJA 3JQPA 5H5JA 4D3FA 4EG5A 4ANJA 4I4IA 4OOFA 1Y7LA 3ZS9A 3U4QB 3R40A 4AX4A 3A25A 4PHCA 3W5DA 1V3VA 2Q2NA 1N6OA 2QPAA 2E4YA 1RAHA 4G9EA 3BX1A 4KQMA 2QYOA 3TSWA 4C4PA 2Q6VA 4E7SA 1C14A 4ER6A 4UKDA 2HMVA 4YGXB 3BJRA 4JQCA 1NJ1A 4NF2A 3ASNC 1IZYA 4PEVA 4WT7A 4TYMA 5HZMA 2XKAA 3LNRA 4Z7OB 3CYFA 1A7DA 4W5HA 3A4MA 4ZOLA 4XH9B 3WDMA 4EFKA 4MW4A 1ZMRA 4UQLA 5A05A 4O7GA 1ZMOA 4G25A 6REQA 3AG1C 2W6CX 3OE7A 1H0HA 4P34A 1R1DA 5TQ0A 1RAFA 3S0JA 1ZMTA 3SK0A 4A2QA 5IDWA 3LTNC 1XZCA 4JSRA 4UHJA 3VKWA 1PJ8A 4BLPA 4C43A 1Z8NA 2J0EA 2AF4C 5KOIA 1S3SA 4U5BE 3BVPA 1W93A 2BVNA 4IIVA 4LXHA 3FCCA 4DWOA 4F5EA 1NBOA 1RLJA 3CLTC 4QA9A 4RSMA 1QTIA 1W1UA 3NBXX 2GDCA 3ACBA 4LTDA 3DV0B 1Q74A 1MDFA 7MHTA 3K0SA 4MW0A 1ULAA 5GIOE 3R1IA 2Y93A 1Q0LA 1ONNA 2ZJFA 4Z4GA 3RVLA 4WNYA 5JLJA 2A86A 4CKWA 1MB4A 1XVTA 3BGIA 3FN4A 3KALA 3BTSA 4M0PA 4F4UA 1L5OA 1RI4A 2OENG 4FNOA 4QPZA 4D4IA 2I3BA 1VJDA 2XE8A 5D84A 4DQVA 3C4JA 4QVGA 1MOSA 2F62A 3FPFA 3GCXA 3RNOA 1NPDA 3BFKA 2ETVA 4WAUA 2XB9A 2W9YA 5AIBA 1YA9A 1ZCJA 2RB5A 1NE2A 2GD1O 4GMXA 5CURA 3Q8XB 4D8WA 5HHTA 3RNLA 3L0OA 3DOFA 1K3FA 4JJIA 2WNSA 3MT0A 5EYPA 3AFHA 1JA9A 3LDAA 1MEEA 3LWNA 2HQBA 1TYEB 3Q5GA 3FUUA 1LPOA 4H7JA 1G41A 1Y4ZA 2WSBA 4IPTA 4NYMR 4Q34A 2CZGA 4Y2HA 3WWEA 3I6MA 4H35A 1GIAA 2FQYA 1BCRA 4NFYA 1SUIA 4FYKA 2VT2A 4JK3A 2ZT5A 3FNRA 4G7OF 1RJEA 4PYIA 4YT5A 3SEQA 3SSAA 1ZAYA 2IJGX 3N59A 1RAIA 2WVOA 3MK31 4WXEA 5AI9A 4JLMA 1KMQA 4EL0A 4B17A 1ZFNA 3IEIA 4AZ0A 3SC2A 2D4UA 1ZK2A 1NL3A 2WA1A 4JLUA 1IIBA 4OIQF 2GETA 4YY3B 2Y8EA 4QI2A 3PDHA 2FZLA 3QF4A 3U4QA 3AJ8A 4S12A 1P4JA 4HL6A 1PZXA 1W8DA 2ATVA 2AN1A 2ODEA 2ZBGA 3IQWA 2FMUA 3AJRA 3IT2A 1JDJA 3MYRA 4HDMA 4QBGB 5ED0A 1DUSA 5AI4A 1M76A 2WJ4A 2R7LA 3D2AA 3N9IA 4QXOA 5AKLA 3G0BA 5E7MA 5L4NA 2VTBA 1IUKA 5I3ZA 1EJ0A 1DG1G 4PXYA 2WZLA 1OCRC 2Q4EA 3IP5A 4M1QA 1F1JA 5EP3A 5F7ZA 2AJDA 1XEXA 1Q77A 2GA0A 2B1RA 2ZUSA 4ZTZB 1ZCBA 4Q18A 2A59A 3A1TA 3CX3A 3T41A 1F2DA 3GT7A 1Q0DA 3ZCRA 3FJ1A 2NO5A 2PKQP 4IEIA 3TEJA 4BXOB 4X61A 1YULA 3PX7A 1P0FA 1UBJS 3D0QA 4DXHA 4N0EA 5AKGA 1XCPA 3GFTA 1EGVB 3GPDG 3RLIA 4UVHA 5C18A 5LZ2A 1RIIA 4JITA 3AO0B 2OZKA 4LQCA 5A2GA 1HEUA 1M6VB 4J3JA 3CCFA 3C87A 5FBKA 1ZCFA 2HK6A 3T0FA 4EGAA 1JFVA 5K99A 2IXMA 3PFGA 2AT1A 1GG8A 3FR8A 4ZZ1A 5H1YA 4IO1A 4AQ7A 4YMUA 2XUFA 3VR4H 2WPDA 2ECFA 4GXNA 2PSDA 4H7FA 3C3EA 3PGJA 2QTTA 3NKDA 2PKYX 4EI2A 2D7DA 3AZQA 3WQRA 3NCHA 1AZLA 4GR4A 4EEXA 3GWGA 5FIUA 5BUQA 3R7WB 1K98A 2L42A 3LT4A 1C3JA 3K9CA 3HVJA 3IAUA 5AKXA 1VP3A 3UC5A 4BMPB 1Q0SA 3WQQA 5I7SA 4Z9YA 3OCYA 1Y5RA 2AFIB 2H8KA 3ANYB 4P3PA 3KAPA 4AIRA 2BGUA 1DWPA 3ABSB 4QXRA 3ZCUA 1D1AA 1Q84A 1N0VC 4LK2A 3ZLJA 4ETNA 4RGBA 2Q6IA 3QUBA 1U6KA 4HJRA 3K0AB 4O8ZA 1X7DA 3EXIA 5GJWC 1Q15A 5I7UA 4XM0A 3JQQA 2DZDA 2K2WA 2WV7A 4I8DA 4DDVA 3GWLA 1YC5A 4GMKA 4OJKA 3WK6A 5DS5A 8MHTA 1TWCA 3LRXA 3P19A 4TGLA 5M04A 4BMXA 1T4BA 2JAXA 3CN7A 1XRPA 1WZ2A 4FSDA 1PFYA 3RF6A 3DL0A 1P44A 1EQUA 1YA7O 1KFKB 1M0SA 1JHZA 1SMKA 2CFOA 4HSEA 3A4LA 3PGMA 5AUNB 3GLVA 3Q9UA 4I5GA 3JAKA 1LFAA 1XZNA 3CZAA 3W9YA 3RRMA 4ZIRB 3KE8A 3M5CA 4KR6A 4YRMA 3TOMA 5CHEA 5IBQA 4L8YA 4XJXA 3CTMA 3O4JA 1NF8A 4E6PA 1MFPA 4RD9A 4LSGA 2QTMA 5JO9A 1E8DA 2QR5A 3D5QA 4JB0A 5AM1A 1YTUA 4PRLA 4FYXA 4DA7A 4AF6A 4BE7B 3KJEA 4Q4ZF 3DOHA 4OOEA 5IWCA 3V1NA 2WZQA 2ZUBA 3FCUB 3HNOA 4YP6A 5LQRA 4LXTA 1W5BA 5L7TA 1PRYA 5I45A 2A35A 1IHDA 1ML4A 1U8UA 5LXTA 2O59A 5B4UA 1Q1BA 4TWJA 1VRWA 2YQYA 2H54A 2JFZA 3UK2A 3ZDXB 1QKJA 3ZI7A 3BSFA 1XVIA 3DBRB 2GX6A 2H1IA 2H1HA 4TQ9A 5HJEA 2EKLA 3QTBA 1I4LD 4R1NA 4U63A 2YV4A 5TQ2B 4KK3A 1VQ1A 1M6TA 3GJSA 3HVUA 3W7BA 1KARA 5KC8A 2C99A 1I7DA 4WBNA 3OO0A 1S2NA 2C9MA 3N8KA 4YACA 1SIBE 5KWIA 4QDLA 3MN1A 4GVXA 4NATA 5DLEA 3W0LB 2GHTA 1EXNA 1PJAA 3A6GA 1RXQA 1C3LA 1XQVA 5CTAA 4CM9A 5D6OA 1NMYA 1NZJA 1Y9DA 2AZDA 4IDDA 2CNWA 4EBJA 3M3HA 3COVA 3A37A 3EPRA 1SVKA 3ND8A 1E3QA 1KKMA 1B8VA 1XRRA 3LQ2A 2VP6A 3MW8A 3U8PA 2XX3A 3WMXA 4DNFA 1GRVA 2JJ2D 5BMOA 4R8KA 3CF2A 4FGLA 1F2VA 1EX1A 1N5DA 1YI0A 3EF3A 4HFJA 1NV9A 3D4PA 3F7MA 3SIXA 2YZGA 2C5FA 2Z5FA 3K0BA 3LX8A 4ND6A 3VNRA 4CKCA 1MXFA 2YWDA 4YWHA 2C7PA 1S89A 2V0NA 1N7JA 3BMQA 5E8JA 1YS1X 2OZEA 2P0EA 2PLAA 2IXDA 2LIPA 1HDGO 2QJFA 4JIMA 3LFTA 5SYNA 3RVMA 4Q47A 3W5VA 3SXKA 3MSCA 721PA 5IF3A 2Z2YA 1IHPA 4DCMA 1BOOA 1TYZA 3FBGA 3T1TA 1XKTA 2ZANA 2R00A 1GTZA 1XZKA 1ZGJA 2BM8A 3BCUA 4K81B 4XUGB 3TI9A 4M38A 4OSOA 1IH8A 2XWSA 4PQFA 1WJGA 5EKTA 2XQKA 3W5SA 4JUCA 3SF8B 1ESEA 2QMQA 3I9FA 4O5OA 4ZYVA 4KITB 3MTJA 4S04A 3GLIB 4QG7A 4I1SA 1OTXA 1CY6A 4ZDIA 1OAOC 2HS5A 5I9SA 1B16A 4I6EA 4BMCA 3BEHA 3ZBPA 1U5BA 2WB4A 4YT8A 3L5OA 2FZ4A 2P0YA 2QRPA 4M76B 4P58A 1PJZA 4YJ3F 4B84A 1J0XO 1J39A 1Z8FA 2NPUA 4JB2A 1Q3TA 5M2QA 1YE8A 4EYQA 5IKPA 2C2BA 2POQX 2YRFA 2NZ2A 2WAOA 2FVXA 3N74A 5IFKA 3JWGA 1GG5A 4NFLA 2O8CB 4RCZA 3EQ6A 1FX0A 4KV9A 3E7PA 4EI7A 1DTWA 5C5IA 3MS7A 2R60A 3BZWA 2IA5A 1K6MA 2XNJA 5G4LA 4LF4B 1E79D 1XL0A 1EK6A 2G3VA 1Q0FA 1VFNA 1SB8A 4RK7A 1ZR2A 1OWMA 2BDUA 2QOEA 4W7SA 1CC1S 2FDXA 4TTRA 4BQQA 5EZ5A 2COEA 2OD7A 3R5TA 3T6GB 3BREA 4I9FA 4LJ4A 3TR0A 3FFWA 1XXHB 4B46A 2P7VA 3C8HA 2I7XA 1G63A 5CYFA 2M1XA 4F12A 2OCPA 2ISSD 2XGOA 1B3RA 1QB8A 2WVHA 3KUUA 4DFDA 3T5PA 2FSHA 1BQ3A 3AR5A 3CN9A 3E27A 2OVBA 5B53A 1KGSA 4CIHA 1SWVA 3KZKA 4GDMA 1R15A 2GCPA 3R0JA 5LBTA 1FFHA 1AF4A 1DBQA 3FPGA 4MVJH 4NONA 4Q1EA 1E2EA 4KFSA 1GAJA 1K8ZB 3V48A 2Z58A 2HI0A 2NVBA 3EPHA 4ZVRA 4RH1A 1LDYA 1CFZA 3ZJYA 4URYR 5B7PA 5CFMA 3FUCA 2ZRHA 3MCWA 4G9GA 1CYEA 1H2ZA 1Q57A 3GJ8A 1GG2A 3RF3A 4JUFA 1L7CA 2WSYB 2YWGA 3CVOA 4O6MA 1L4NA 1XV5A 1ZK0A 2Q21A 2X1MA 1ISGA 1EI9A 3CE9A 5A3RA 3AFGA 1EFUA 2P6MA 2HSDA 1R0LA 2QZSA 3IV7A 4GOND 2VNIA 4LN1A 2A5LA 4ZVSA 5K20A 3RS2A 4B3SB 1OBOA 2F3UA 2NZVG 5LDHA 4Q19A 4MV8A 4NBNA 1SAYA 3M6XA 1FL9A 3DZJA 3GVPA 3MAGA 4Q5IA 1LF0A 2FMXA 5EIBD 4ZC8A 1G8GA 4CQMA 3P52A 3QI2A 3AVOA 3NHFA 2CNWD 1KP3A 2C2YA 3PHCA 2J67A 4HFRA 4LSZA 4MTCA 5KOHA 4OP3A 2BMDA 1YZHA 4KO2S 4F1JA 4DV5B 3QVYA 1L5RA 3FMOB 4FFBB 2DR0A 2CLMB 4ASUD 3FWKA 2BONA 4JBNA 4Q3CA 3DBLA 1B6RA 4KPFC 3KQQA 1DO8A 4ZYUA 2C94A 2OL4A 3ZWBA 2JPDA 3EVFA 2XY4A 2I2WA 2RGAA 5EJMA 3WO0A 1H2FA 2O2DA 5IM4F 3WDSA 3WWDA 2G7ZA 3QIVA 3O93A 4HTFA 4JB8A 1T1EA 4HDCA 2PWZA 5BNIA 1LWNA 2G62A 2YWCA 2R79A 5FR1A 1BS1A 1MPXA 2PRJA 1SKYE 3BHMA 4D9IA 1GN8A 4TT8A 4GKJB 1WXGA 4FE7A 2I4OA 4MHTA 1CYDA 2HH9A 2AN9A 1K7FB 5CM8B 2Z8XA 2DTDA 2WTUA 1EXMA 3GZ4A 1PCXA 1UZLA 3KUXA 4JLDA 4KYUA 4WWHA 4J29A 2QUJA 1B68A 3X1OA 1HQYE 4IL5A 3BCSA 3ZYZA 3ZJVA 1AH2A 2Z83A 1C9MA 1P4GA 4V2UA 3MRXA 4Y3UA 4IXWA 5F4ZA 4A5OA 4A5SA 3H5TA 2PUEA 4ARZA 1LLFA 1MO5A 1GNTA 1SHJA 4MQBA 1M8GA 3P32A 3LT2A 4ZC1A 1WXHA 1USGA 3L3BA 3LLSA 5JAZA 2P9HA 3WGGA 3B0PA 4DQKA 5IJ9A 4FX5A 1G8PA 4AKIA 1WZIA 1ZRHA 1TUBB 2BFEB 1OXBB 4CGZA 4M1ZA 1PHPA 4MQEA 3D0OA 1C50A 1P8AA 3KJQA 5B6IA 1BZYA 1YB7A 3NHYA 5FPSA 1UC5B 2ZRPA 1GPH1 5F98A 4BECA 1TJ4A 3ML1A 3PGKA 2UAGA 4J7UA 1GJRA 3IBGA 1UP7A 3IHUA 2OV2A 1TM2A 4YL0A 1XD2B 3I9MA 2G1AA 1NC3A 3QVMA 1ZI8A 3RBZA 2A33A 3VSEA 1NOJA 1RC0A 2Q8QA 2Y27A 4M1KA 1ZBQA 4P4SB 5EQTA 5BV7A 3QRWA 2GKOA 3HBJA 4QZVA 3AV0B 1N3IA 3UW3A 4MVJG 4RKQA 2ZJZA 1W581 2DUMA 3I9NA 3KR1A 1TZKA 4IIDA 4RLQA 1QE5A 4S1NA 3ZGVA 3N05A 2X15A 5KDDA 3GX1A 1QO0D 3E9QA 4O2AA 4W9MC 2AMLA 4HR7A 3WHIA 2CUKA 1OWLA 4EY5A 1ZJJA 1FBTA 2JI8A 1MD9A 3AUKA 3KXLA 2CVHA 4OD0A 4FM9A 3PXBA 1LVKA 3HC7A 2BL4A 4JKYA 5DLQC 4EA9A 2IX9A 4WFIA 2DPYA 4PSCA 4HUQA 2QBYA 3SX4A 3H3JA 2DUWA 4F3CA 4P3NA 4H4EA 1VMDA 5JPCA 4MV9A 4XEKA 2IIVA 3GJ0A 4L4SA 1D7OA 3SP1A 5DT9A 1IXYA 3BH7A 1AVTA 2LFFA 1V8DA 2R6JA 3QOXA 2CCYA 4MITA 3L1KA 4XDHA 4EBBA 1O9GA 2GUWA 4PYRA 4WLVA 4BKUA 2PUAA 1BG6A 2PUCA 2QPLA 1KXZA 3LLMA 2R84A 4J2OA 3LIIA 1GU7A 4KTVE 3V8RA 2P9YA 4EKGA 4DMRA 3HJNA 3THXA 3FJOA 1UKZA 3LD9A 2Z2IA 5A1JA 2QRGA 3FWYA 4LDKA 1JXMA 1E5XA 2VAVA 1AF7A 1NFQA 3GQVA 4XEUA 1AS0A 3C4VA 3HNJA 1NRJB 3OPNA 3IERA 4L8LA 2WUGA 2CFIA 3K8ZA 2I1QA 3D2LA 1NZEA 4N03A 4S24A 3RUAA 5LDDC 4WJ0A 3HJUA 4GWGA 5AW9A 1OIWA 4ASUA 2Y4NA 3BHIA 3IH5A 2H59A 1TYDE 5FOWA 2EW1A 1Y4CA 2YJ6A 5BSRA 4GR9A 5KX5A 1FJXA 4LDPA 5JWHA 1G4UR 1TA9A 5B1IA 3H87A 1Z4NA 4JBXA 5A6VA 2RK6A 3MTIA 1W0KA 3IS3A 4DLYA 3MFYA 4HAYA 2CD7A 1FU8A 2PKQO 4WGZA 2JIZD 3ONEA 1NN5A 1PJ4A 1WBDA 3OOWA 4J0DA 2XLBA 3PLAE 3IXQA 2C8JA 1JPVA 1NBMA 2CDRA 2PXAA 4CLOB 3ANSA 4X0RA 5DGTA 4ML3A 2PV0A 1CF4A 1ISJA 5C32A 1NW8A 3IT0A 3ZCPA 1ID1A 2HK8A 3TD9A 5E6SB 4CUJA 1LY1A 5DSZA 1O5OA 1A97A 2DH5A 2RJNA 3BE6A 3GR6A 3SXZA 5DHRA 2WLTA 1K6JA 4UAJA 5J1TB 4EY4A 4DV4B 3RFTA 1TGVA 3PX2A 4MW6A 4YRQA 2LPMA 4I1UA 2Q1UA 2IV2X 4BOYA 3B9RA 2KYHA 3VKGA 3EISA 3WODF 5CA1A 1KQ3A 1VK5A 3AL3A 1MW9X 3HGQA 2QV0A 4MCAA 4MS1B 4NZMA 4PNZA 3KSUA 4ZCQA 4WY2A 1IXRC 2P65A 4MQFB 2EFCB 1E9RA 3P20A 4P5DA 2ICAA 5JPIA 1WQ1R 4ZZ0A 1K7CA 1BRMA 2ATEA 2QQFA 3PG5A 1RPJA 2SCUB 4E07A 1GTRA 3T54A 2N42A 1Y3BE 1RZ3A 1CDZA 1DHTA 1TEHA 3EFOA 2ZROA 4JDUA 4WHMA 5JLAA 3LUDA 2NSJA 2RHRA 2JZOA 1RWPA 1YU6A 4YECA 1OA1A 2VSQA 3PXUA 5FOUA 2IT1A 5JHHB 3GF4A 2MSNA 3TS1A 4E5PA 2DHCA 2LWIA 1CGME 1G7CA 5BYJA 4MRPA 2XNCA 2G9ZA 3BKWA 4XB6B 2OCCC 1WW2A 1I1HA 1VBNA 2PZKA 2QD2A 2VJDA 3CW9A 2GZHA 2YR0A 1BMTA 3K53A 3N07A 5DN6A 1UWVA 4KLNA 1WB6A 5REQB 3L8MA 2QSYA 5GWXA 3H2UA 1XDBA 4D3XA 3ZWWA 4CKZA 1D2MA 5D87A 2HSGA 1ZN9A 4UMVA 4BNXA 1N57A 2XZTA 2R8EA 1V1MB 2PQ2A 4NI5A 2W2MA 1JAHA 2AD5A 1T4CB 4AJ4A 2F2TA 4FDAA 2ZBEA 3BMXA 4TXNA 1E61A 4Q4HB 5K0JA 5H9VA 4NDZA 4UHDA 4B3IA 1CERA 1L9KA 1XYGA 3EXG2 3HY3A 4FIZA 3ROPA 1KAHA 2FPWA 5LLDA 4GUDA 4MAFA 1ZVQA 1WW8A 4JX9A 4Q7JB 3R7WA 4AUKA 4DOZA 1XAGA 4TZKA 2O06A 3PNQA 1TF7A 3HNIA 4EJFA 3O2QB 4YWJA 1A7KA 5IPFA 3K70C 3W06A 1RXWA 1J9EA 1KWKA 5J47A 5AYVA 4OF4A 2P1AA 3TM4A 1AXEA 3JZ0A 1Z2DA 2NSLA 4UMDA 1YKSA 2WIKA 3ESXA 1ZGHA 2VYVD 3M4XA 4YQEA 1WM1A 4YL3A 2UUHA 2QRVB 3NXKA 4Z0PA 4H59A 4EZIA 2O8DA 3EY9A 4AN4A 1FXWF 1ULUA 2DT8A 1F3OA 4JJKA 3AVVA 2ODPA 4OB6A 4RA6A 3AGUA 1W9HA 3JYPA 1JIUA 5EXSA 4TM7A 2HCFA 4B71A 5CVDA 1EE2A 2XUKA 4NDNE 3H2YA 4HJXA 4L50A 5FYQA 3DKRA 3D3NA 3VPXA 3ZG6A 4C05A 1U0JA 2IU4A 5C4IA 3IGFA 4GOKA 5G4KB 3UH0A 1M6HA 5HRUA 1QONA 1N8SA 3S8MA 1CT9A 5DGDA 3H5RA 4IKOA 2BKLA 1BHQ1 3CZPA 3DTYA 3QQ5A 3GJZA 4IXMA 3SNKA 4M49A 2UU9B 2GVNA 3CBGA 2I2FA 3FMVA 2BISA 1NUTA 5DIFA 3ASVA 4ZGBA 1N1EA 4Q9IA 5EJ4A 3LY7A 3AR9A 1NVBA 2FSSA 2YYAA 1MNEA 1YOBA 2YZKA 3OX2A 3O4VA 4ZI5A 3SEOA 1OPRA 3T7SA 1NUHA 3JRWA 1M54A 4L1KA 4ZJZA 1OH5A 2OAQ1 2ZYTX 2DJIA 2W93A 5EK0A 4NOJA 1BEZA 4FQ5A 4P82A 3MQ4A 3AM3A 1SC1A 1W29A 1QYVA 1U2DC 3UGTA 4CG3A 4I14A 2A94A 1F2TA 4RZSA 3EXEA 3K1AA 3QF4B 4LE2A 4L5JA 4DJ5X 1E0AA 2QTLA 4CTMA 1BCSB 3KHSA 2H8AA 1RYFA 3DEAA 2ZPTX 1GEEA 1YB6A 5ESXA 4UFOA 5E9WA 2A14A 4V1CB 3TVYA 1S2MA 3V4SA 1B42A 2ACWA 1IWBB 4KL8S 5CFQA 1I4OA 3R4VA 3Q2OA 2JIZA 4FYJA 4JJAA 2JEOA 3FHLA 3HEMA 4G26A 5ICGA 3DVAA 1TAQA 2H5EA 3I5UA 4WLFA 5KKAA 1E1CB 5LYJB 4Q4AA 4H4KC 1A9YA 4YBZA 2JHGA 3ANNA 3WADA 1E85A 2R65A 1SBQA 2V9ZA 3HPQA 3DEKA 2ERXA 1N0HA 5JVDF 3KYDB 3B0VC 3K7EA 1KZ6A 3TFQA 2D2FA 2I8BA 1B26A 2X1VA 4I9UA 4C4XA 1HNXB 1FFYA 2PN1A 3RSHA 1J7KA 2WAXA 3D8TA 2OXFA 2AWOA 1DRJA 1SU4A 2ERCA 1U0LA 5DCWA 3K1HA 2IY7A 1L7QA 4U2FA 3RHZA 5A7GA 2WILA 3MX3A 1A96A 3EVNA 4FMCF 5CXQA 2X1HA 4YDQA 1TLFA 4NTAA 1NLFA 2J6HA 2N1MA 3IKLA 1CJSA 2BKXA 4IHAA 4QTUB 5BQPA 1V8ZA 4DMFA 2QZJA 5HFJA 5C7YA 5EJEA 2BKVA 2F43A 1ZVJA 3CWZA 3KC2A 1UL1X 1VPLA 1IOZA 2IY9A 2PXXA 2YWBA 3AY7A 1AE1A 3NEYA 3TLZA 4E09A 3QX7A 4M9QA 1DXYA 2F3PA 2IYSA 3QFTA 2FMFA 5FI3A 3BWDD 1E1RA 4OHMA 4B31A 3CMCO 4IOJA 2YYZA 5EC8A 4YJDA 3UF0A 4NNJA 1DOZA 1HETA 1Z5WA 3LBFA 3Q8MA 4RIIA 4PJJA 1Z7BA 3KX2A 3TQRA 1QQ6A 2J87A 2PTGA 3A04A 1SUPA 3N0TA 1C0LA 2XIQA 4YHBA 5I9MA 1SC9A 3NYJA 4HZUA 4DARA 1CUZA 5COMA 2XHEA 3E0QA 3KKLA 3IJEB 1TD9A 4PS1A 3QBDA 4EA8A 1IHYA 2D00A 4IY1A 4IJ5A 1XTVA 4RMGA 4WA8A 3VDXA 4B4WA 2Q9BA 1SK8A 4HZIA 4PX9A 1M6WA 1W5SA 3OHPA 1FX1A 1W48A 4C0QC 1MUUA 3ABIA 1ORYA 3C18A 4RJJA 5HUQA 3F97A 4ZMSA 4MDHA 3CO5A 2VPXA 2B37A 1FE8A 1V11A 5HGJA 1YARO 4UMEA 5HF5A 3RTAA 3U7QA 5JROA 3H2ZA 1DAOA 2O7SA 4R83A 1FIUA 1TAUA 2R7UA 3ZG1A 2DFDA 4MUJA 3OOYA 4Q1VA 3SYRA 4F9FA 1U90A 1C03A 1F5NA 2GERA 4B2PA 4POOA 1JQ3A 3ONNA 3PNKA 3CGGA 1LNQA 1WUIS 2PS9A 3CUYA 4IHKA 3A0UA 3LT0A 4DBZA 5TRTA 4K3UA 4OQYA 4Y2PA 1UM8A 4A6XA 1LJUA 1ORVA 1UODA 5BT9A 5KHAA 4C3ZA 4MW8A 1JHUA 1QJCA 2VCYA 3TJRA 2I03A 3AP1A 3AV3A 3RC2A 3U7IA 3VO9A 5DM70 3RVQA 1DAIA 4MVSA 1C8BA 4FSHA 4XFJA 1N9GB 2W37A 5IZCC 1OW6A 1PGQA 3D3EA 1CQIB 3KR0A 3DCNA 3JS5A 1Q7CA 1T0IA 4OHVA 3HXMA 1S2IA 1EGMB 4M6WB 4HWRA 4MGYR 1LZKA 2AW5A 3TWOA 1XD8A 4YYZA 1P0CA 4MGHA 4MDYA 4JUBA 4P4TA 3NPMA 4DDUA 3GARA 4LQLA 2H4HA 1N1CA 2ETXA 2YN0A 4Y2GA 3PHBE 5A0TA 1DLJA 3MT8A 5CDHA 2NUPB 4HEAJ 1JA1A 2OA0A 2XF2A 2ZQZA 2PX3A 3HN2A 3W7VA 3E9EA 2CJWA 4QTTB 1S3IA 2FV8A 4A4DA 3GEPA 5L4LA 1ZUD1 1HKHA 3V42A 4WKPA 3V5YA 4S2UA 3PC4A 1C7QA 3AR8A 4HT3B 2X9LA 1PNTA 1P33A 1PWXA 1AUOA 1RM5A 2F1IA 1T1GA 5BWMA 3K6SB 2A57A 3JVDA 2CNDA 3UMHA 3NNDA 3IQIX 3BS4A 1OXVA 3RJZA 1F5SA 1E69A 1E3WA 2DQYA 2Q07A 3TRKA 4AZSA 4DUPA 3SIWA 2OCXA 4MV6A