2PX3A

Crystal structure of flhf complexed with gtp/mg(2+)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
258
structure length
256
Chain Sequence
PEPLRKAEKLLQETGIKESTKTNTLKKLLRFSVEAGGLTEENVVGKLQEILCDMLPSADKWQEPIHSKYIVLFGSTGAGKTTTLAKLAAISMLEKHKKIAFITTDTYAAVEQLKTYAELLQAPLEVCYTKEEFQQAKELFSEYDHVFVDTAGRNFKDPQYIDELKETIPFESSIQSFLVLSATAKYEDMKHIVKRFSSVPVNQYIFTKIDETTSLGSVFNILAESKIGVGFMTNGQNVPEDIQTVSPLGFVRMLCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagellar biosynthesis protein flhF
publication title The crystal structure of the third signal-recognition particle GTPase FlhF reveals a homodimer with bound GTP.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Biosynthetic protein
total genus 72
structure length 256
sequence length 258
ec nomenclature
pdb deposition date 2007-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1380 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2px3A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2px3A02
5FPYA 1KYIA 2XOKD 5AUNB 3PQCA 4B2PA 4A8JC 3VKWA 3DZ8A 4DSNA 3CF0A 4YONB 2RGGA 4AYXA 2IC5A 1UBGA 1G7SA 3FHTA 4ASUA 3HWSA 1SVLA 4MITA 3EG5A 2J7PA 5J4KA 5JZVA 2WTUA 2QBYA 4B75A 4BZXA 3ZVLA 1VHTA 1NI3A 1E69A 2IWRA 2ZE8A 4LJ7A 3TRFA 1HT1E 2F9MA 4LYJA 3TUJC 2I1QA 2ZRLA 5IK2A 3KQUA 1OXXK 2GCOA 3ND9A 4UJ3A 3CUEF 4WZBE 3L0SA 1QG2A 3KXIA 2GJSA 4TQ9A 1XTKA 4KFUA 3VAAA 5JSZA 4KLZA 5HZHA 3VFDA 5EZ5A 4IXNA 1YZGA 2V7QD 5JS8A 2IL1A 2O8FA 3IKJA 1H8HD 1FTSA 1XMSA 4P4UA 1P2VA 3MWKA 1W36C 2P5TB 3MRSA 3Q8XB 3RANA 4LY6A 4TL7A 1CRPA 1DARA 4EFNA 3K70C 5C1BA 2ZSDA 1WA5A 5F3WB 2WWFA 1RYFA 3KJEA 1JB1A 1WQ1R 3VHLB 2QP9X 1YKSA 2W2XA 4WZ6A 1GL9B 5EE1A 5FBQB 1EFRA 3I92A 4QBGB 4DEYA 1ZM4A 3BH0A 4HAWA 2C9CA 2NMVA 1G6OA 2VH5R 3QXXA 3TR5A 5B57C 4KBFA 3FDIA 2GRJA 1XCPA 3NXSA 1M7GA 5DNYB 5CYOA 3QPVA 2R6CA 3DOEA 4NYMQ 4RD6A 1HURA 2IUSA 2O8DA 4JYBA 1FNNA 1D2NA 2QE7A 4Q48A 3THYA 1N2CE 4AYWA 3BFXA 1GRQA 2GETA 4LHVA 3TW4A 2NG1A 1UADA 4Y0AA 1G8PA 1S9DA 3RS2A 3V4RA 1XPOA 1NVVR 4NL4H 1TF5A 3I5XA 3TKLA 4TTQA 3K8YA 3PG5A 4E09A 4CZ2A 3GJ6A 4HYYA 5CJ2A 5G53C 4A4DA 1SVWA 4Q7KA 1W7AA 4B34A 2Q3FA 3ZIAD 4F93B 4TLAA 2OM2A 4F4IA 2IK8A 4HEJA 4Z8YA 2Z43A 4RD2A 3T35A 1P5ZB 3DMNA 3EZFA 4MUAA 1GWNA 1LV7A 3ADDA 1QHSA 4HLUA 3QG5A 4US0R 2ZAMA 4LBWA 1ETUA 2BDTA 1Z63A 1P60A 1SVSA 4C2TA 2QI9C 4F92B 4MRSA 1DE0A 521PA 2G3YA 3AVTA 4AG5A 2XNDD 3W5JA 3U61B 2ANBA 5E4FA 5FUWA 4KI0A 2ORVA 3U3MA 4IXMA 2PX0A 1ESNA 1T0JB 1W0JD 2Q9AA 4PPQA 4IEIA 4LV8B 4BFSA 1NSFA 2DY1A 3VNUA 1DOAA 1TNDA 5EE0A 4C0BA 2H7VA 4PO8A 2JEOA 3MJRA 4ZCMA 3C5CA 2ODNA 1E4VA 3HU3A 2ZM5A 1SKYB 2JLZA 1ZW6A 1ZD8A 3NIBA 3IO3A 1WF3A 4PFSA 4TYQA 4X8LA 1IONA 2ZJ5A 3QSYA 5L3QA 3UK6A 3QY0A 4TMZA 4KJZA 1NVUQ 2DBYA 2FDCA 2ZRAA 1K5DA 3AKDA 1DAGA 1NN0A 2WZQA 3MMPA 3WMFA 3AVOA 3GD7A 4TTRA 2CE7A 1MRNA 5J4HA 1N0VC 2ANCA 1ZNYA 3KXLA 4LJ5A 3WXMA 1AZTA 2OAP1 4LJYA 3N2EA 4MDEA 3PUZA 4EDHA 3U3JA 3BAFA 4PR0A 1COWD 1JQLB 3FMPB 3QKRB 1G8HA 2AR7A 4UNQA 5C4GB 3QKTA 4V0ME 1PV4A 4AKEA 2HUPA 4ZDKA 1DS6A 1G18A 4YXWD 1N6LA 4C4PA 1E2KA 4KSBA 1W4CA 2WVJA 2R9VA 5JEDA 4IW3B 4MKFA 3A1UA 4DC9A 4NCKA 4B2IA 1VMAA 3LX5A 4BFTA 1KK0A 3DPUA 1O87A 2EQBA 3KFXA 1EFUA 3FOZA 4KLNA 3DEFA 1D2MA 4QGFA 1NP6A 3RLFA 2ZRMA 5DHAA 4D82A 2ZVPX 2HJGA 2HF9A 3MJHA 5TVKA 3W9YA 721PA 2BM0A 5L8VA 2NO1A 4Q1CA 3JVVA 2AK2A 1YU9A 1XMJA 2E87A 4NE2A 2IXFA 3KFVA 1EWRA 2QMHA 2WM9B 1LY1A 4NYJQ 2A30A 4X8MA 3I4LA 1U0JA 1CRQA 2OCPA 3BD9A 3SQWA 1QHGA 1UAAA 2QM7A 1V5WA 3FWYA 1M6NA 4PC7A 1IY1A 2AXNA 1GKUB 4B3CA 5BN5A 3NH9A 1N0UA 5SZJA 1FMJA 4QJ4A 2Q0HA 1VTKA 1Z0FA 2IYQA 3OIYA 1OH6A 4RVCA 1RRCA 4A0HA 1I2MA 1Z0KA 2YHSA 4DDUA 1OHHA 2D7DA 3G5UA 1ZYUA 5JCZA 4YMUA 5DH9A 5EP4A 1QZXA 4ILEA 2UVQA 2WJYA 3KZ1E 2V1UA 4RCYA 1KMHB 5GJVC 4BFUA 3Q5EA 1WP9A 4DB2A 2C78A 1SZPA 3THXA 1DG1G 4CEHB 2ZYVX 4NYIQ 1WCV1 2D7CA 5E7MA 3W90A 3X2SA 4ZCIA 2OXCA 3FHOA 3I8SA 2GEUA 2QROA 1SXJD 1Z0IA 1KI9A 1OJLA 1QHXA 3L82B 2O0KA 1G64A 2MSDB 3QQ5A 5JI3E 1XPUA 2FN4A 2PT7A 2J5XA 4HAUA 1P9NA 2Q3MA 4IVQA 3AF4A 5FL3A 3EASA 3LXXA 1H8EA 1Q1BA 4DLTA 5BWMA 1A2BA 5JWHA 3T1TA 2OAQ1 1J8MF 1QRAA 2A5YB 4PC2A 3T06B 5FTLA 4HLDA 5A0FA 2ZUDA 3H2YA 3VU9A 3VNVA 2R6GA 4ERNA 3W8NA 3T1OA 3H0KA 1XD2A 3LBHA 4B33A 4Q7MB 1E2PA 3CW2A 2FNAA 3QJYA 2OUKA 3FKSA 2IF0A 2O8CA 1KK1A 2RCNA 2V55B 3CKLA 2VLIA 5DO9A 3CZQA 1QHYA 2B8TA 2WKRA 3T15A 4BQSA 1OW3B 5FTJA 1NKTA 2QAGA 2AKYA 3VKGA 2XITA 1TQ6A 4JVNA 3GCGA 3GJ5A 2DFKB 1AGPA 4ASUD 4UXHA 3EPLA 1Q22A 4KSCA 3ZD6A 4O0MA 1BH2A 2J7PD 2YWFA 4PO1A 2ZYTX 1F2TA 2GEVA 4U7DA 2G88A 3O8DA 1JALA 3N5CA 4D0LB 4YDHB 4BLRA 2FMXA 2WWHA 5CJPA 5IK2D 3RS3A 2OSBA 1KIMA 3QXHA 3ADCA 3R20A 2O8FB 3QBTA 1OH5A 4ZIRB 4DLRA 1E6CA 4HDCA 3B9PA 2FFQA 1OV4A 2BBWA 1Z8FA 4G0NA 1G5PA 2BC9A 1KMQA 2MSEB 3CX8A 4JBXA 4PZLA 5B30A 1W49A 3FTQA 2CL6X 5FPHA 4ZKDA 2GBLA 3WNBA 3W5IA 2W2VA 5CDFA 2ATXA 4N0EA 2OFWA 3QKSA 3ECCA 2HDNB 2TMKA 4QOSA 1S4QA 1GVNB 1X3SA 3D7MA 3SDZA 2O8EB 2ZE7A 1E1RA 5J40A 2FA9A 3U5ZB 1ZM3A 2ZSBA 4DKXA 2E1RA 2REXB 4RY2A 2P0EA 4F38A 2R44A 3MWYW 3BFVA 1MH1A 3IUYA 4OI2A 5CM9C 4BGDA 1E0AA 2AXPA 2C96A 1N6OA 1CXZA 3DM9B 3BBPA 1HEIA 4JT2A 4M22A 3L43A 3PFIA 1TQ4A 3A6PC 2ZE5A 5H68A 4B43A 1PJRA 2J0SA 2IBMA 2FFAA 1UJ2A 3OIWA 5FUXA 3VR1A 2QE7D 3CH5A 2IS2A 2C8VA 3B8HA 1ZCAA 5KSZA 2GAAA 3QG1A 4ACAA 4GDFA 3T5DA 4NCNA 1VCIA 1IBRA 2ZREA 2XSZA 4K81B 5TY0A 3K0AB 3QPWA 1MT0A 3IPXA 1M34E 2HLDA 3J81k 2C04A 4HZUA 2ONKA 2IF2A 4EIWA 2WIBA 3SS8A 3GJXC 4TLEA 2GNOA 1T3SA 5L3RA 1MO3A 4AYTA 2YJTD 4CVNA 1NIPA 1CF4A 2FFBA 3IILA 1YQTA 3QI2A 4KITB 2FU5C 1OB5A 3CR8A 1OH8A 1LB1B 2YINC 3LDAA 4GMDA 4RD1A 4C3ZA 1J90A 3QF7A 3NHBA 1E2JA 1MR3F 3IO5A 1NY5A 4L15A 2BCJQ 3PUYA 4EAQA 4EJSC 1U9IA 1BO6A 5BW8A 5DN6A 1BMFA 1W48A 2VP4A 4WAUA 1KDPA 5CLLA 1G7RA 1G8FA 5SZIA 4IOJA 2IX3A 1P2TA 3TBKA 1DAHA 1EGAA 4PC6A 2ZS8A 1OXVA 4TQUS 3DVLA 3KUCA 2ATVA 3EPHA 2FEOA 2VHUA 3HYRA 3X1ZA 2WAXA 3I5YA 2QQEA 4MGZR 2YC4C 2ZI4A 4PAMA 3X1XA 1BKDR 1RYHA 2FSGA 3A1SA 1RKBA 4OHYA 4YDSA 3SYKA 3CLVA 1NVVQ 5BN4A 3VX4A 3PUVA 2CDNA 4G1UC 1TMKA 3D3QA 3B2EA 5EP3A 1JNYA 3ADKA 1G9XA 2GXSA 4IFEA 4P31A 3PR1A 4MYCA 3CRRA 5LD2C 2B7CA 3P1JA 1A4RA 2G9NA 4Q9HA 1KI4A 4LBZA 4KAXA 1KSFX 3UG6A 5KNCA 1ZM7A 3P27A 1QVRA 3CPEA 3UMRA 5AR1A 3GEEA 3I73A 2W2TA 3UXMA 3U7EB 4JVLA 3ZH9B 1W1WA 4MDFA 2KB0A 3EARA 3ZS9A 2ZRIA 5UKDA 5J4YA 5DSZA 1NBME 4BFVA 1RJ9B 3CRQA 4RFSB 3TH5A 4CIDA 1DADA 2YVUA 5FBWB 2NPFA 1EWQA 5FTMA 3RS0A 2IS1A 1G4AE 2WMOB 2CCJA 2WV9A 2BMEA 4S35A 4IDNA 3GLIE 1ZUHA 1OH7A 2F3TA 2WWIA 4XVQA 3EWAA 5J4VA 5AUOB 5JEEA 1D5CA 2GJKA 3NEJA 1TTTA 4A36A 1G8GA 4PHHA 2GXAA 2XNSA 5E7IA 4DLWA 4FCTA 3OE7A 3ASZA 2XTZA 1G6HA 4PO9A 3CR7A 5A4JA 4LYFA 1UKVY 4IDHA 2W00A 3EZ9A 1IQPA 3MAAC 3B1XA 3ZZTA 3MWLA 4L9SA 2QGNA 2QP4A 4Y0VA 3SBDA 1JAHA 1JJVA 3AV0B 3KJGA 1NF3A 1RFLA 1U0LA 1P73A 2CL7X 2WPDA 2ZI3A 1VIYA 3JZMA 4POAA 1P7CA 3NVAA 5EUMA 1EFHA 4OI1A 1E99A 4BFZA 2P5SA 1N6PA 4KYIB 3SI7A 4DLSA 2JASA 2ZS9A 4EQ6B 5KSOA 4FD2A 1GTVA 1P2UA 3T5GA 2O5VA 2JJ8A 2YWHA 3OFND 1OHHD 5KU1A 3QKRA 1XTQA 2PL3A 5CM8B 4E5UA 3TSWA 3H1TA 3MWJA 1N5KA 2IYRA 2WOOA 3IPYA 3TSZA 4Q4JB 1OFTA 4ZDIA 3FKQA 4A6XA 4B3FX 3CH4B 1P2SA 3SOPA 2BBOA 1JR6A 4A1FA 1KSJA 2KI5A 5JWRA 4AKGA 1I4DD 3GLHE 4IFBA 2C77A 4OQLA 2NGRA 3NKVA 4TSFA 1YRAA 3WBKA 4AD8A 1VDZA 1R0WA 4RZ2A 4HDQB 3GEHA 1J7KA 3PEUA 4BLOA 2D2EA 4LJ4A 4PHFA 4RZXA 3WHLA 2JAQA 1VG1A 1A82A 2QY9A 1MRSA 1H8ED 4HLUC 3SHWA 4Q1EA 4ESVA 3T1VA 2ZIAA 3GP8A 1P75A 4RFVA 1YHNA 1XD2B 4HAZA 4IVRA 4ZKEA 4A0GA 3B78A 1RRGA 4LBVA 3AF2A 1U0HC 3IEUA 1K5GA 5FUVA 4OQMA 1FUKA 2OE2A 4DUGA 3EX7C 1JQJC 3EIQA 4TYWA 3FKSD 2WMNB 3IIMA 4LJ8A 4Q03A 4OQNA 4LC0A 4PANA 4ESHA 1TADA 1ZINA 3ZJYA 2GCNA 1N6KA 2L0XA 2WHXA 1E94E 1GNQA 1DAKA 1DBSA 2PMKA 2QZ4A 2FSIA 3LV8A 3THOA 5K8IA 2J45A 4PAOA 3W3AA 1GIAA 3MGCA 1AQUA 4ZCLA 4DDWA 2JA1A 1KJZA 3MCAA 1X8LA 2AL7A 3GQBA 4CRWB 3GLGB 3Q72A 4V0NA 2I4IA 3ZGXA 2ERYA 4NCHA 1T0HB 2AKAB 4WIAA 3GPLA 1W0KA 1XCGB 2FX3A 2V8OA 4XSGA 1XJ0A 4OJKA 3RDPA 3W6OA 3QXJA 1R2QA 3KTAB 1CBUA 3LBIA 5JJIA 5F9HA 4TLCA 2RB4A 4N0DA 2QEQA 4KCGA 5CIQA 2ZQ5A 4WOPA 1YVDA 4LJAA 3RRZA 5CK4A 1JPJA 1OIXA 1P9RA 1SKQA 1UEIA 3EIEA 3K09A 1G20E 3B1ZA 4DVGA 4UNSA 1XEXB 4W7SA 2QORA 1XFAA 4A2PA 1DG3A 2RHDA 3SJZA 4C0SA 1UKEA 4QHYA 1E1RD 1KO8A 3DKPA 3KKNA 2GTPA 4BASA 2EW1A 4C0AC 4G5RA 2A9KA 5F9FA 3BORA 5KPJA 4ZV4A 3AP3A 4V02A 1MO4A 1ZU5A 1TUIA 4PHTA 1T91A 1IN6A 4HI0E 2ZU6A 1II0A 4TL6A 4C0KA 3ZDQA 1P61B 2WWXA 1E2MA 2ZUBA 4PPGA 4WZAE 1IN8A 1Z28A 2R2AA 1E9DA 1N0WA 3HPQA 2FGJA 2OHFA 3OIUA 4HZUB 4LSGA 5B64A 1S9HA 4M1KA 2ZSFA 3ADBA 1GILA 1H65A 2ZRDA 1F60A 1GL7A 2HLDD 4W5JA 4YMTA 3K9GA 2WJJA 1E2HA 2HJVA 4ZIRA 1RRFA 5L3SB 4US1R 5KPDA 2EYUA 4JS0A 2OILA 2C9OA 2DPXA 4F4CA 1L4YA 3AF0A 1W47A 4TWZA 2V6JA 1NNEA 3GLFE 4A2QA 3U44A 4Q5IA 3LLMA 1CR2A 2LCFA 3LVRE 1ZM2A 3DOFA 3KQHA 4KODA 1JPNA 1Z0AA 4QNMA 3UMSA 3ONWA 2WBLC 2FE4A 4IOMA 1UBEA 4LHYA 1EG7A 3VR4A 2V54A 4DLZA 1C4OA 2RGDA 3AEZA 4UKDA 2Z0MA 3KX2A 2JATA 4HUQB 4PC1A 2O8EA 5KO2A 4MKGA 4D80A 4LOAA 1UBFA 1DAMA 4GPTA 5B2ZA 4A92A 4IOLA 2FV8A 2OT3B 3LO5A 3ICQB 4JIMA 4PQFA 2JLXA 3WRYC 5DN6D 1UF9A 4P33A 3AVUA 1NMYA 2JLSA 1R8SA 1BOFA 1LW7A 2ZR7A 2QT0A 3TLXA 5M04A 2HCJB 2CHGA 3LBNA 2AWOA 1XZPA 5B58C 4RSGA 2C2HA 2D62A 3PVSA 4BE7B 4ZI2A 2CHQA 1G5RA 4DZZA 2ZYWX 4CYMA 2XB2A 2REBA 4DCNA 3IHLA 1EK0A 3A4MA 4JL8A 2QRNA 4KU4A 3K0AA 3D8BA 2CNWA 1D9XA 5E7JA 2ORIA 3CRW1 4Q7LA 2REOA 4Q47A 3C14C 1SVIA 4MYHA 4TYYA 4JLDA 1R5BA 1XXHE 1ELOA 2A5JA 2VSXA 3IHWA 2WWWA 1XZQA 1NN5A 1WE2A 3F0TA 5DYIA 4M1SA 3IIKA 1SKYE 2QTFA 4KYUA 3NBFA 3K9NA 3ZVRA 1PVOA 1OFIA 1YZKA 1A2KC 2BJWA 2QU8A 1CJVC 1FQKA 3L0PA 5KDDA 2JCSA 3NEYA 1KO4A 2GEDA 4Q18A 4UXIA 1XTJA 1YZTA 3LH5A 1Q3TA 3OIVA 1MO6A 1DTSA 3WNDA 4IEEA 1GOTA 4Q9JA 2V6IA 3BK7A 1MOZA 1KI1A 2IYYA 4FN5A 3TIFA 4A0FA 4MGKR 1Z08A 2XAUA 3GJ0A 5HR5A 5CLQA 1NMXA 3TGPA 1XDBA 1HY3A 1ZUNB 4OHZA 5DIFA 1IN4A 1ZVQA 4TL8A 3DMDA 4LHZA 3U3KA 2I1VB 4OKSA 4BFWA 1T9HA 3OE7D 3PIRA 4TMWA 4LPSA 4X8OA 5AJWA 4D6PA 2EYQA 1CU1A 5ANRB 2FJUA 1AJEA 2IWHA 1US8B 3A58B 4DSOA 4JLPA 5EJEA 2GF0A 5AJYA 4R71A 3A8TA 1P6XA 5FOXA 2DWQA 5CK5A 1T3LA 3CRMA 4DJTA 2WPDD 4C0JA 3ZLJA 5IHPA 4QRHA 3O8RA 3NDBB 2OLKA 1V43A 1JXOA 1HTWA 4P4SB 5H8WA 2N46A 1DAFA 4BPBA 3CZPA 2X1VA 3SFZA 2QSZA 3TQCA 1Z0DA 1NIJA 2ZS7A 3AUYA 1OLOA 2DCUA 1HQYE 1PLLA 2W58A 3SU8A 3UPUA 3ETLA 2A78A 1U8AA 3LQQA 2VHQA 1YRBA 4YMVA 1IY2A 1FX0B 5JHGB 1MV5A 1TAGA 4HB2A 3SC3A 1RJ9A 5J5CA 4FIDA 2CBZA 5KSPA 1YE8A 4RFSA 1KJYA 2X8AA 1W5TA 3I72A 4YC7A 4Q4LA 3IQXA 1W5SA 1HT2E 1YR7A 1X86B 2GJ9A 4TSFD 2WOJA 4A15A 2P65A 2GWHA 3L8YA 2H16A 4EKDA 3JVUA 1D9ZA 1F2UA 1KGDA 3DO6A 1II9A 2WKPA 3LXRA 2P6RA 2KE5A 4I4LA 4P32A 2ZXUA 2IYSA 2D2FA 2DFLA 1G4UR 2QPTA 1OFUX 2UZ3A 4JLAA 3R9XA 3WYGA 1R0XA 2ZJOA 3TSOA 1OIWA 2DWPA 3KKOA 3QBVA 2BJVA 3RSOA 1UFQA 2A7QA 4XIGS 3AVXA 1SXJE 4HAYA 2ZJYA 1F6BA 3N2IA 4B35A 4MGIR 1Z22A 5HZKA 4LHXA 3LFUA 1GL6A 5FTKA 1SULA 2J3EA 1ONBA 1WXQA 1ZC4A 2HT6A 2IHBA 2XEXA 3D31A 3QVUA 4EQ6A 2ASEA 2FPKA 4DUGD 1U9IC 3F3YA 1NL3A 2N42A 2F1JA 1JR3D 5EXTA 3Q85A 4OHWA 5EP1A 4BLQA 1EFCA 4BEJA 4D0NA 5TMPA 4U5XA 4MH0R 5CITA 1R10A 5JLJA 2XZLA 1VYUA 4Q4JA 4QJ3A 3TAHA 1ODFA 4LHWA 2AFHE 5FL7A 1UKZA 2OCAA 4JYCA 4QFMA 1E2NA 3B1WA 5DI9A 3AKYA 3KQNA 1XD8A 4D25A 1ZD1A 3UATA 2ZJAA 5KNDA 1W0KD 1GFIA 1O3YA 4PX9A 4HAXA 1GG2A 1KJWA 2FPMA 3TAUA 1IHUA 4B71A 2F55A 5HPYB 1AIPA 2QP3A 2ZJ8A 3CRVA 4XD7A 5BYKA 4LUCA 1U8YA 2AWNA 2ERXA 5DLQC 4BZQA 2YOFA 2IS4A 3Q7QA 3H86A 1G3UA 2KJQA 3V9PA 2YOHA 4R2IA 1F3OA 1GNRA 1LTQA 2WICA 1R0ZA 3GJ4A 3U4QA 5D3QA 3RRNA 4AC9A 3FB4A 4AKIA 2CVHA 2OEPA 2ZR9A 3LX8A 3BE4A 4A0RA 1KSGA 5FR1A 5C2JB 1CR0A 3KJHA 2RMKA 1IAQA 1VCNA 4FW9A 4HUTA 2VP5A 5EP2A 1W4BA 3GJ3A 3L2OB 4FMCB 2BEJA 3GFOA 4G5QA 4NTZA 4P3YA 5FH9A 2W0MA 5FOWA 4XWKA 3B85A 3A4LA 3CONA 4GOXA 4B47A 4NBSA 2QMUA 2ZJ2A 3TUZC 2PEZA 4Q19A 4M1TA 4QNRA 2XXAB 3RC8A 1R8QA 2WAYA 4DDVA 3B1VA 4JLVA 2BBTA 1ZIOA 4Q4HB 3SBEA 1XEWY 3ZS8A 3EAQA 2IYLD 1IXRC 3EA0A 2Y8EA 4MKHA 3GLGA 1WMSA 3QKUA 1XCMA 2ZTSA 1NLFA 3CWQA 3AVYA 2JGNA 1KAGA 3FMOB 4GZLA 2GA8A 1I4TD 2G77B 3UMFA 3U44B 3EC1A 3KTAA 1T6NA 4CW7A 1W4AA 1IY0A 2YWEA 3K0FA 5KDOA 2A5GA 3K0CC 1JJ7A 3IIJA 2KSQA 4DRZA 3IBGA 3QF4A 2RGNA 221PA 2H92A 2NZ8A 1S2MA 1EFRD 3HJNA 1XEXA 4DHEA 2IA5A 1LVGA 4B48A 5JBQA 3QNUA 2HT1A 4B73A 2J0QA 4KBGA 1SVKA 2PMDA 3AP2A 3QPUA 4ON9A 1XBTA 3TVTA 1E9BA 2QTVB 4TTPA 1GUAA 2PLRA 3VR5A 3AUXA 1E0JA 3HR7A 5HCNA 1ZNXA 1OFHA 3VTKA 4DEXA 2P2LA 3AQ4A 1TU4A 5D3MB 2XJ9A 3EC2A 4G5GA 4B32A 4DWJA 1G291 3CB4A 4IVPA 2RGBA 3UWKA 4QG7A 2ZANA 4DLYA 2YOGA 3RWOA 2YKGA 4ZDWA 2FH5B 1X8KA 2Q9BA 2BKUA 1HH4A 1ZM9A 2VL7A 2GCPA 2QENA 2ZSEA 1QHNA 3UWOA 2NTYC 1E3MA 2CNWD 4LPKA 1TL7C 4OL0A 2IEYA 4DSTA 5L3SA 5EE3A 2ECKA 3DL0A 5HCIA 4C0LA 4M9SA 1OKKA 4IKEA 4OBEA 3NWJA 2J0VA 1VPLA 5GVRA 4M1MA 3PITA 3S1AA 2EWVA 1UBCA 3BB4A 1QG4A 1E4YA 1NG9A 4H1VA 1M7BA 5CB6A 3K53A 2CCGA 2BHRA 1VKJA 1VG0B 3LWNA 2RH5A 1TF7A 4OHXA 3AVVA 4C0QC 3QXSA 3RABA 4DBLC 4EPYA 5KYKA 1G41A 2NO0A 4HUQA 1Q57A 1IXSB 2QM8A 1ZIPA 1E79A 2GZAA 4D2IA 1XPRA 1ZNWA 4JJZA 1SXJC 3QENA 3ZVNA 2FG5A 4DCTA 3TVDA 2VA8A 3R9WA 3W34A 5IF9A 1Q20A 5AJVB 4KFSA 3IDQA 1E98A 4MRVA 4B6EA 5DE3A 4PQYA 1GNPA 1PUIA 5IDVA 3CPJB 3L0OA 3SNHA 2OCBA 2F1HA 2G0NA 3Q7PA 1Z07A 2RGAA 1D8TA 1J8YF 1T8UA 4DCSA 2JIZA 2XZPA 1ANKA 4YQFA 2RHMA 2OBNA 4AIIA 5LDDC 4D4MA 2J7KA 4OHVA 2RGEA 3QUSA 2BCGY 4Q4AB 2SHKA 1I4LD 3P20A 1U98A 1S0UA 2BM1A 4DXAA 2V4ZA 3AF1A 2W6JA 4JSTA 5AJZA 3GLFA 4TYPA 2P6UA 4TL9A 2HXYA 2CK3A 4RD0A 3P32A 1HE1C 3MG9A 4TQAA 3AVQA 1G1MA 1GZSA 4D4KA 2XX3A 1C9KA 1VCOA 1KI8A 2O0JA 2ZUCA 1U90A 4MYTA 1YZNA 5TDHA 2J9RA 4ZO4A 4UNNA 3SR0A 1KHTA 2O8BA 2BMFA 3PENA 4RKEA 3GJ7A 2B8WA 4Q9IA 1HA3A 1XD9A 2HYDA 1Z2CA 2RAPA 4EFMA 1KI6B 2XJ4A 1ZBDA 1G3IA 2H18A 2CE2X 5HE8A 2IYXA 1FP7A 2W6IA 2PLFA 4E07A 1UM8A 4BWYA 2QPAA 1XB2A 1OXUA 3NH6A 4QGHA 1F2UB 1N5JA 4JSYA 1UDWA 3C15C 1G7CA 1G3MA 3TK1A 4AG6A 4PSVA 2VBCA 4A8JB 4OK5A 5HKKA 4URVR 1SQ5A 3VKHA 4EPXA 2R6AA 2EFDB 4R9UC 4M0LA 2CLCX 3OHMA 4URWR 4K8OA 1ZMXA 4G5SA 3KQLA 1LF5A 1ZP6A 2H1LA 5FTNA 2IUUA 5H1YA 3H84A 1NN1A 1GKYA 2GILA 4BRUA 1C1YA 4NONA 2VP0A 4V0KA 5EE9A 3PXGA 1US8A 3OZXA 121PA 1N6IA 4KXFB 621PA 4EUNA 1PUJA 4K46A 3LD9A 4RJLA 1CTQA 5FBVB 2W83A 4ACBA 2P67A 2B6HA 4NYJR 1G3RA 4A2WA 2FPLA 2FZLA 4FINA 4I1VA 1CS4C 3WYAA 4B2LA 3ICEA 4P4SA 1X8JA 1P62B 3WMGA 4JLJA 1G8YA 4NDZA 1YR9A 5G41A 1Q1QA 1QDEA 1W36B 4FMCF 1TPZA 2GZHA 4BZPA 1JI0A 4ARZA 4BFXA 3FGNA 3K70B 3KB2A 2CHVA 3M4YA 3REFA 1T5LA 5K8TA 4IRUB 4MKIA 4E03A 3GLIB 2GDJA 3EW9A 3M1IA 1FX0A 4OK6A 5LBIA 1IM2A 4Z51A 1DO0A 5P21A 5FL7D 4Q02A 2BWJA 1JAIA 1HYQA 3P4XA 3B1YA 3RWMB 1X1RA 4B6FA 3RNLA 3GEIA 2A5FA 3U3OA 2X77A 3AP1A 4BLPA 1MABB 3KKMA 1EX7A 1TQDA 2FSHA 3KL4A 1RPZA 1E9FA 1W2HA 3EWSA 4M2LA 5GJCA 2ZI6A 4LX0A 2FWRA 3PUXA 1Q3HA 4JLBA 4GL2A 4PQRA 4DDTA 2YYZA 2ZI5A 2ZYUX 5LPNA 3U4QB 2ZAOA 1KI2A 4GBMA 1K8RA 4FCVA 4LJ6A 3RVBA 4Q1AA 4F4JA 3OEHA 1VCMA 1JECA 5FOVA 5ELXA 4JJKA 1OSNA 3KJIA 5AUQA 2XZOA 5CB8A 1LS1A 4HB3A 5FUYA 4M1YA 1E0SA 4C30A 4V0MA 2NIPA 2C99A 3UIEA 4FXPA 1EESA 5DHFA 3CO5A 1AGRA 4JZKA 2QUZA 1A5TA 1NLYA 2QQ0A 4PSAA 3B13B 5CDFE 3EXAA 3MLEA 1XEFA 4C7OB 4JL5A 1GRNA 2X19A 4O3MA 4PPFA 1ZUIA 2J0UB 1AKYA 3F5FA 4HB4A 1IXZA 1N5IA 1P4SA 3A36A 1XJCA 1XTIA 2AD5A 2O0HA 1Z6XA 2B92A 2BMDA 2OBLA 1Y63A 1E2FA 2QG6A 4NCIA 4LJ9A 5E3HA 2PEYA 2QRZA 1AZSC 3RSLA 4AK9A 4AKHA 4DLXA 2FF7A 5DISB 3AVPA 3C16C 4JLMA 3W6PA 3ZYCA 3RHFA 4M1WA 2GJ8A 4EJSA 2NZJA 4HLQB 1AN0A 2ODWA 2EFHB 4OK3A 3K0FB 2DB3A 2NOAA 2AD1A 1DAIA 3WMEA 1D2EA 3WHKA 2R62A 2X2EA 2N1BA 2WJGA 3K0EA 3SE0A 4TZ6A 6Q21A 5HE9A 4YMWA 1OIVA 1E2DA 3QF4B 4WBSA 3UG7A 4WXRA 2JLYA 3P26A 4V03A 4Q9KA 3O8CA 5E95A 4F7WA 2QT1A 3T34A 2V9PA 1UPTA 3GMTA 3VR2A 3RAPR 1XX6A 1WRBA 5EQTA 2PJZA 3PJRA 1ZD9A 2VIIA 2ZRPA 3SEAA 2FFHA 1GSIA 1OYYA 1DEKA 1G19A 2C03A 3LRPA 5AJXA 4ABYA 4ZI3A 3FHCB 4Q21A 5TB5A 3U7HB 2BIFA 1OXTA 1JEDA 4TMKA 4ITRC 3ZZ0A 1SGWA 3RRMA 2HXSA 1SVOA 3WYFA 2VPPA 1NKSA 2J41A 1B0UA 4WXPA 2W0SA 4X8HA 4QBFA 5FBRB 1OB2A 2QSYA 4MRRA 1II8B 1Q21A 1L4UA 1RZ3A 5JECA 4QXAA 1DAEA 1JXMA 3Q3JB 1L8QA 4HB0A 5FPTA 3QVVA 1XP8A 2IYZA 4AWXA 4DLVA 4Z1MA 2CMKA 2XXAA 3C8UA 1G7TA 1VIAA 3SJAA 3IEVA 2R8RA 2D74A 5FOTA 1W4RA 4A9AA 1YJ5A 5KNBA 2XSZD 3K9LA 3DZDA 4OI4A 4Q4HA 1E0KA 1RC8A 1M74A 2WWYA 4ZPXA 4N3NA 4D0GA 4RZ3A 4OQXA 3BOSA 1S8FA 2C5LA 2G83A 421PA 3T61A 1R5OA 1VYTA 3S1AB 4JLOA 4TLDA 2YV5A 2A3RA 1QBKC 3LQRA 2VF8A 3W6NA 1OKKD 2V1XA 2CCKA 3EZ7A 1G3QA 5F2EA 1ZAKA 4FWIB 3LVQE 1SVMA 2IHYA 2H17A 1CEEA 1HV8A 2QL6A 3K9HA 3A37A 4DLUA 4H9GA 3R7WB 5IRCD 3AM1A 1KAOA 3I8XA 3K0SA 3G82C 5IT5A 1ESMA 2VHCA 4UQOA 1GITA 1MO5A 1BMFD 2F7SA 4DSUA 1A1VA 1NVXQ 3MFYA 2J46A 3QE0A 5JRZA 3PCRB 1LS6A 4PPNA 1E79D 3PEVA 5C46F 5EE5B 3BH6A 1J99A 1NMZA 2EFEB 5FI0B 3CX7A 2J1LA 1E1QA 2KBEA 2Z4RA 1R6BX 1E9CA 3HPRA 4B3BA 5JCPA 5G40A 1SHKA 1XJQA 3LY5A 4CEIB 2WJVA 5D3MA 4B3XA 1EX6A 3KKPA 3I1FA 4IOKA 4GOJA 1GP2A 4BLTA 2GK6A 4FMBB 2JIZD 3AKEA 3B6EA 3ZZUA 2PBRA 4MRNA 3BERA 3CBQA 4S2EA 1NVWQ 2ZI7A 4D81A 1UEJA 3OAAA 3GLFB 2JJ1A 2GVZC 1JBKA 3H4MA 2FGKA 1DO2A 2ZRGA 4GNKA 2W6JD 4FWTA 3MUFA 4IHQA 5BN3A 5JJKA 2CK3D 2JLRA 4LDJA 4Z54A 2O8BB 1XF9A 2X2FA 1Z2AA 2QGZA 2QAGC 4PTLA 4FMDB 1T8TA 2CEAA 3OEEA 2ORWA 4Q7JB 4DB4A 1KO5A 4MQBA 1KI7A 2G6BA 2RGXA 1P72A 1R4AA 2WJIA 5K8UA 3BFKA 5EXPA 4Q01A 2W6ID 1N6NA 2RKOA 4EPRA 2CJWB 2NO6A 3O47A 4TT3A 4WVFA 3HDTA 2E9SA 1E2QA 3NBZC 3KQKA 3WP1B 5HKKD 4JKYA 4L8GA 3PEWA 2XTNA 4MA4A 2PH1A 4BECA 4LCBA 4EFLA 3X1YA 4W9MC 1L7VC 4RD4A 4XTCS 1PLKA 4QHSA 1FQJA 4JMPA 4O25A 1QVAA 1CJKC 2GBLC 2IYVA 3BXZA 4JVSB 1Z83A 5FI1B 4DT1B 5GADl 2F43B 4QC2A 1XXHB 3HP1A 3TQFA 1Q44A 3B5JA 3LAWA 2Z6VA 2ZRFA 3C7KA 3GJ8A 5TV2A 2RGNC 2BEKA 4Q4AA 1VECA 2FOLA 4Q1FA 5AK0A 4HZIA 1BIFA 3SN6A 4YMSA 2VRWA 3X1WA 1Q1EA 2Q6TA 2NO9A 1CJMA 1T5IA 2ZRJA 1FFHA 2VP9A 3KDSE 2OXRA 2IYUA 4JKIA 5JHHB 1Z6TA 4ARZB 3U60B 4D26A 3RS5A 3PEYA 1XWIA 2IW3A 1GRRA 3BRWD 5EUQB 1U2RA 2VO1A 1TUEA 1ZCBA 2JLWA 4QGGA 3MSXA 5GJWC 1NSTA 2F1RA 4GRAA 3DHWC 3FMFA 1KI6A 2GXQA 2VSFA 4A6PA 4TYNA 5KHOC 1R5NA 1OT3A 3I62A 1UDXA 3HR8A 3ZQ6A 1ZU4A 3RRYA 1JR3E 2CL0X 2ZRCA 4NP6A 3TJZA 1L2TA 4W5WA 2ZITA 2KWIA 3TMKA 4JLNA 3U3RA 4A8JA 1DELA 4B74A 2HV8A 2JDIA 3DM5A 1HQCA 5JRJA 1S3GA 1FW6A 4I1OA 4U00A 4D4LA 4OI0A 4LRWA 4RKFA 2ZR0A 4JT4A 5CYPA 5GVSA 1XMVA 1OPXA 3Q9LA 2QMEA 2AX4A 5JJLA 2LWIA 4GMXA 2QMOA 1ZJ6A 3OEHD 2H8KA 1QHHB 1Z0JA 4PXAA 3NC1C 2ZRNA 4M1OA 4PSKA 4URZR 4GZMA 4EPTA 1TU3A 1KDTA 4BLSA 2OG2A 4J0QA 4NU0A 3WP0A 5L3VA 3U7FB 2CXXA 4H1UA 4R7ZA 1Z6YA 4L4UA 2G1JA 2ZEJA 3SJCA 2V3CC 4R2HA 1NBMA 2EVWX 8OHMA 2OLJA 1BS1A 3U2QA 1PZNA 4V0LA 2CVFA 3QEJA 4II7A 4URYR 5AUPB 3OFNA 3NTUA 4CF7A 3E70C 3GLIA 2YZ2A 1OYWA 4JBWA 3RS4A 3M6AA 2WIAA 3EZ6A 3JZAA 3CIOA 3LLUA 4V0OA 4OYHA 4QM6A 1FZQA 2ODBA 2JJ2A 3AGPA 4EJSB 1HE8B 2C95A 4BUJA 3EZ2A 1D6JA 1R7RA 5FBLB 1KO1A 2WSSA 2OESA 5FFMA 1MABA 2LKCA 4LI0A 3A4NA 1VHLA 3SYNA 3E2IA 2VYFA 4GI7A 4QL3A 1SXJB 2BVNA 4LV5B 2NO7A 4D4JA 1BYIA 3B60A 1UKYA 3TNFA 1TQ2A 4XH9B 1Y3AA 2ZPTX 1K6MA 4NKRA 2UKDA 4A82A 2MSCB 1W2GA 2QPOA 3K1JA 3SHFA 3UKDA 4B3GA 5DI3B 1OXSC 3I61A 3FMIA 1RRPA 3A1VA 4BRWA 3CNOA 4XWAA 1RW4A 2I3BA 2Z4SA 2OBMA 4JBYA 4LWZA 5FR2A 1FOEB 1GKIA 4NHOA 2RGCA 1NN3A 1P3JA 1KNXA 4Q9LA 1AQYA 1E2EA 2AK3A 4G5OA 1BYUA 2H57A 1XEWX 2A5DA 2OFXA 5LD2B 1FNMA 3NBYC 2IYWA 2H5EA 4M53A 3GFTA 3GLHA 4F91B 2OFOA 4C7OA 4XJXA 2Q3HA 2OV2A 3CM0A 4XVRA 4WA7A 5SZHB 2F3RA 1M7HA 4TN1A 3BIFA 2J0UA 4GP6A 4Z1MD 3LW7A 4KFTA 4KO8A 2IXGA 4EPVA 2K5UA 3TE6A 4HATA 1YZLA 3I32A 2YC2C 1YZUA 2ZJBA 2OCYC 2ZETA 3KKQA 2QBYB 4CEJA 2VHTA 1LF0A 3ND8A 3CWZA 2CLSA 3M0EA 3ASYA 1AS0A 4BEBA 4Q66C 4B76A 4NCJA 4C0HA 3VX3A 4NPHA 2GCOB 3CX6A 3PV0A 1S1MA 4M9QA 3FE2A 1Q1ZA 3VMFA 5K8LA 2GXUA 3TR0A 5JSZB 4KVGA 1E9AA 2HEIA 2DFTA 2VEDA 5G3ZA 1FP6A 4FMDF 3U6BA 1E9SA 5KUTA 3THWA 4IDOA 2J59A 2G0TA 5DYGA 2VF7A 3SQXA 4RD3A 4MRPA 1Z6GA 1QHIA 1KDRA 1F48A 4CDGA 1FPMA 3Q5DA 2WKQA 4LZZA 3REGA 2DR3A 1M8PA 3QEOA 2F1IA 2AHOA 3NBXX 2DHRA 3EIHA 2EU8A 1M2OB 4LC1A 1II8A 1MKYA 2DWOA 2XOKA 3W3ZB 1E32A 3LA6A 4GT1A 1E1QD 3C4JA 4NYMR 2ZI9A 4FCWA 4PHGA 2HYIC 3BC1A 3EA5A 2O8DB 2D4HA 2KBFA 2GZDA 2ZJZA 3CPHA 2EFCB 4Z8XA 3THYB 1AM4D 3E5HA 1YR8A 2BBSA 1S96A 3KB1A 4WW0A 3IBYA 4C9BA 3F8TA 1PLJA 1TX4B 1KY3A 3OAAD 2JJ1D 4UNPA 2PT5A 4NZYA 5LB4A 1TEXA 1JEEA 1XTSA 4M21A 3V00A 1AK2A 1CP2A 1Z29A 3A1TA 1X6VA 3L0IB 1VYVA 1KOFA 4UNRA 4M9XA 1NJFA 4QM7A 1HUQA 5BXQC 5JS7A 1S1CA 2JLUA 2QNRA 2IUTA 2V7QA 2G1KA 4CGZA 4ZDJA 1H8HA 5JMTA 1LFDB 1IN5A 3GFPA 3BH7A 3NG1A 3OEED 5FOSA 1N6RA 3R7WA 2VQSA 1KK3A 2PJRA 1VG8A 1ZRHA 821PA 2R6DA 5EXXA 3VQTA 1SHZA 2VP6A 4OQFA 1Q12A 1T4GA 5KSYA 3U6KA 4TMVA 2PZGA 1EXMA 1G17A 3CNLA 2MMGA 5SZKB 3AKCA 5BYJA 1E9RA 3AH8A 3QXCA 4LK2A 4TMXA 1KZGB 4LYHA 4TT3D 3SZRA 1GM5A 1KTVA 3EPKA 5J4LA 4URXR 2QTHA 2J87A 2ZVQX 2XB4A 1CULC 4CEIA 4GSYA 2IXEA 2BOVA 4DCVA 3CF2A 5GJBA 2PCJA 1AKEA 1U99A 5KOYA 2P6NA 5TARA 3TW8B 5KTYA 5C18A 3RC3A 1WBBA 4IDQA 4Q00A 3C41J 4GFDA 2NQ2C 3AGQA 3K09C 4MYUA 4HLCA 4TZ0A 2ZRBA 5L3QB 3UANA 1W44A 1E2GA 4FI3C 3FYHA 1G5TA 4PZYA 1G16A 4UJ5A 3B82A 1CJTC 4M9ZA 4OJQA 5JFGA 2ZRHA 3ZIAA 3NC0C 4KFRA 4B3DA 4Q1DA 2IT1A 1IJEA 4LV6A 3FFAA 2C98A 2OZEA 1Z5ZA 1RE0A 1IJFA 3CF6R 1FL9A 1VG9B 2AFIE 2B21A 2CLDX 3KUDA 4M4SA 5FPKA 1CJUC 3SJBA 3ZD7A 1NG1A 4DCUA 5FPSA 3N70A 4JLKA 2Q9CA 2PX3A 2BV3A 4LYAA 4RCZA 2GK7A 4L9WA 3B9QA 2XNDA 3FFBA 4HDOB 4MUBA 3E1SA 1CR4A 1J70A 1E9EA 3AB3A 4N1AA 5TXGA 2CJWA 2PZEA 1W0JA 2JLVA 4URUR 4US2R 2C9YA 3BJIC 1KY2A 3NDPA 4G3XA 3VR3A 3R8FA 2JDID 4I1UA 1U81A 1NY6A 4PAQA 2FEMA 2VTKA 3QOFA 5CIWA 1Z47A 1KI3A 1YZQA 2R65A 1XNJA 3C5HA 5A5GA 2ZRKA 1KK2A 3PUWA 4RZUA 4DT1A 2F43A 1N5LA 1XXHA 5F98A 3KXKA 4CT5A 4M8NE 2DYKA 1ZNZA 4YLGA 5G3YA 1E96A 1Z06A 4DIEA 2GF9A 1IN7A 1CKEA 5EZ6B 2JLQA 2HF8A 3R8CA 1NJGA 1Q0UA 2GHIA 2GKSA 3OESA 2F6RA 2QAJA 3HU2A 3EPJA 4AI6A 2GJAA 4TMTA 2XGJA 2GAOA 1TEVA 1Z6AA 1G21E 3BB1A 1NBMD 1QF9A 2EFGA 2Q21A 1XU4A 2OO7A 3NHAA 2LKDA 4QJ5A 3WNCA 3ZQJA 2GESA 1W36D 4XTRA 4PC3A 1YR6A 1I2DA 5KDLA 1M1YE 1COWA 3WY9A 1XMIA 3LNCA 5AWFC 3TUIC 3K70D 3K0CA 4I81A 1AS3A 1GDDA 2FZ4A 2PZFA 2YNMA 1RVDA 3HYTA 4LGMA 2GVDC 2WWGA 1OF1A 4YXWA 4I99A 4NYIR 4QBHA 4NH0A 3THXB 2JJ2D 2WJHA 2UZIR 5J47A 2FSFA 4MGYR 1XTRA 2WSSD 3RS7A 5DGXA 5BQ5A 3WRXC 1FMLA 5HTKA 1A7JA 1W46A 4KHZA 1XRJA 1KDOA 1ZC3A 2Z5FA 2ZE6A 4XD7D 2DFNA 4AURA 1NLZA 2XTMA 1J2JA 1CLUA 4O2LA 5EXSA 4L16A 3P4YA 3CNNA 3VR6A 2MMCA 2NPIA 5LB2A 3GLGE 2BKEA 1KO7A 1X1SA 1IOZA 1U94A 2A2ZA 2P3SA 3R9IA 1WBDA 1QHHA 1P9WA 3DKVA 3AVWA 1KKLA 1TF2A 1CIPA 3W8RA 3B7GA 3IQWA 3BWDD 1FTNA 4HSEA 3BB3A 4QHTA 3RYTC 3VU9B 1R0YA 3FPAA 2F9LA 4P4TA 3T1QA 3GLHB 2VSOA 3QIAA 2PCLA 1CR1A 4CT4B 1KSHA 5FOUA 2VP2A 1OE0A 4QKQA 2O8CB 4IJMA 1N6HA 3LW8A 4Q1BA 3X1DA 1T3HA 3U7GA 1KNQA 1KZ7B 4B44A 4LBYA 5C4MA 4JVMA 5JI2E 2QAGB 1E2IA 1JR3A 2VHJA 2WSMA 2Z83A 4GP7A 4I1SA 3ZVMA 2O52A 4QBIA 2IEZA 4IDPA 4PZZA 3FVQA 4CEJB 4XOIA 1F5NA 1KKMA 3OF5A 4JL6A 1WB9A 2IS6A 1B23P 2B7BA 4XVUA 1NRJB 2ZROA 4C2UA 1E2LA 5H70A 4R98A 1LNZA 4U02A 1KMHA 1F2TB 1RIFA 2BMJA 5JWOA 2HCBA 3AF3A 3HU1A 4KV9A 4CEHA 3D6TB 3SFVA 3T12A 4O2RA 4TLBA 3A1WA 1Z3IX 3BGWA 1SXJA 4XSHA 4XWOA 2ODEA 4NMMA 3THWB 3I3SR 2EWWA 1U8ZA 4W5HA 3WBJA 4AY2A 1FUUA 2QN6A 2QA5A 1EFTA 4HAVA 4GOKA 3MD0A 4KVAA 1S3SA 2ZSAA 3BS4A 5DI3A 2ONJA 1GAJA 1N3BA 4G01B 4UXJA 1WDTA 1N25A 3V4FA 3IGFA 3G0HA 3QKSB 2D06A 4DIDA 1AS2A 1DVRA 3VHXA 4QGAA 4E22A 2YWGA 4EPWA 1DPFA 2D3WA 1AA9A 3DDCA 2IYTA 3O8BA 4P0TA 2AN9A 4BFYA 2ZU0C 4L5BA 3L8ZA 3SYLA 2R6FA
chains in the Genus database with same CATH superfamily
1ZI6A 2XOKD 3U7JA 1VJDA 4E7SA 3JSEO 4HGYA 2A0XA 1NNI1 4H35A 3W5CA 1NI3A 3TRFA 1ORSC 3AESB 5IK2A 2X5NA 4KHPB 4KXQA 5JSZA 5JBNA 4OU5A 3VFDA 4IXNA 5J1TB 6ABPA 1XMSA 3ST7A 4ZU1X 1XF1A 4EFNA 1SC6A 4P3OA 3K70C 1WA5A 3PQ4A 2W2XA 2J9UA 2V4MA 1J9ZA 4QGSA 2HY7A 1P2DA 2W43A 1ZPDA 2JKZA 1VGVA 3NXSA 1M2JA 2XYVA 4L3VA 3PHJA 5CYOA 4D44A 1Q77A 2V96A 3DE7X 2QX7A 3V4RA 3FJ1A 1RZVA 4G0YA 2DFVA 2OQMA 3L1VA 3UC5A 4R68A 3OI7A 1R0RE 1FP4B 3ADDA 3LZCA 1QHSA 1WU8A 2XMSA 4GP9A 2Q4BA 4B7XA 4AJ9A 3IODA 2F3UA 4O0LA 1SVSA 5CRIA 3ANXA 5F28E 5E4FA 1OWNA 3V4PB 5J2UB 4BV2A 3LI2A 3DOOA 1CYEA 1WB5A 3TW8A 3HU3A 3K8QA 3IO3A 4RMIA 2H1FA 4KJZA 2IZ7A 2QT9A 5EZYF 1OXBB 4PU0A 1ZH4A 5B2FA 3AT1A 3GO4A 4IJ6A 1JQKA 5L6LB 4MDEA 3O4RA 4PS0A 3VJMA 4YXWD 4KMRA 4C4PA 4NCKA 1KK0A 5FX2A 3ETCA 3FOZA 4RVNA 4QQFA 5K0IA 2EBHX 3OUZA 1TVKB 2V3WA 5DHTA 4BKUA 2Y0CA 4YAEA 5CT8A 1YU9A 3L07A 4MS2A 3H1FA 2DI3A 3GZJA 1DCKA 1LY1A 5EKSA 1XHLA 4FT2A 4A4AA 4JA0A 4KE7A 1EYZA 3AEKA 4RVCA 2VLBA 1ZYUA 4AMUA 1GCGA 4JUFA 4MMYB 5EP4A 1T6UA 2WU8A 2C78A 4BX9A 3KYCB 4MSUA 1WCV1 3FWZA 4C04A 2G8NA 2QROA 1EXNA 1K9VF 1RE1A 2MSDB 5KC9A 2PP4A 3MRTA 2Q3MA 3K96A 1XXLA 3PPIA 4O4LF 3BWMA 4WUTA 3MGKA 5AH0A 3KLOA 3VU9A 1UM9B 4OOFA 3ZVKA 1SEVA 3QJYA 2VZ8A 2OORC 3E8SA 3N05A 1NKTA 4C4ZA 5EGYA 1POWA 3C2QA 4HAIA 4ZGGA 3MT8A 1OBFO 5KVQA 1F2TA 4XIJA 2O7QA 1KIMA 1VXOA 2PS1A 1SG0A 3TYXA 4JB8A 1EUDB 4KXNA 2ZB4A 5FPHA 4BGIA 4N0EA 4G1BA 3OZSA 5DPMA 2ZFUA 2ZSBA 2AWCA 4J7YA 2R44A 3V4VB 1CXZA 3D4BA 4JT2A 3OCVA 3L43A 5ECDA 1T9CA 1V5FA 1TQ4A 1Q95A 2G7MC 2W45A 4GDFA 3T5DA 4U7PB 1MT0A 3IVXA 3SICE 4ZQIA 4J0DA 4GMGA 3GEBA 3OQJA 5L3RA 2IBTA 4BJ1A 1JEJA 2PO5A 1NIPA 1YQTA 4KITB 1YU6A 2PS9A 1J90A 2XZDA 3T3EA 3IO5A 3TLYA 5ALYA 3LESA 2R1TA 3EXFB 6AT1A 1TQ8A 1BO6A 1EDZA 2FPWA 2W6NA 4F2PA 3DXXA 2Q2OA 2Q0QA 5FFFA 2G1AA 1YMVA 1L7MA 1O5HA 4JENA 1NVEA 3TTUA 1NVVQ 4LYYA 4W1PA 4IILA 4HKTA 5DCLA 2CZQA 3T4RA 1NYTA 1Y9AA 3WIDA 4Q9HA 1KSFX 3WK8A 5KNCA 4QASA 3UMRA 3GEEA 4D9BA 1WR8A 3N8KA 3QLUC 3ZH9B 3DZCA 1IM8A 4H1TA 1O4VA 1VPEA 3OPVA 1S2DA 4RFSB 4ML3A 4U0KA 1PWHA 1JRAA 4CSAA 1WBJB 1GLGA 3DKIA 3QLJA 2OWDA 3EY9A 3B1XA 3ORQA 4HXYA 3C97A 4POAA 1M6HA 4MVJD 1NNLA 4NTFA 3T5GA 4EO4A 5HQ3B 3LIIA 2XDAA 3LAYA 2C5AA 2ILVA 4DRIB 2IYRA 5A02A 5A62A 4W7HA 5E4TA 1YSCA 2ZTHA 1NQWA 4N5IX 2C4WA 3WBKA 1MB2A 1IHDA 2C2BA 4XIFA 5E4JA 1VE1A 3K1IA 4F3TA 2QY9A 3G0OA 3EUAA 5E0KB 5DVZA 4I55F 4MW3A 4DZTA 1YHNA 1DMSA 1JR4A 1I0LA 5HZMA 1LV8A 3NWEA 2VDRB 5CDHA 4JKVA 1DAKA 4LW8A 3I2FA 5DBHX 3JRWA 2VDMB 1UPAA 4ZCLA 2X0EA 2PMWB 2M64A 1ODLA 4BKMA 1NOJA 4MK4A 3GPLA 1C9DB 3ZNQA 3W6OA 3BTSA 3RPEA 4MKRA 1ECBA 5HRUA 3OEYA 5KTSA 4ABTA 3TI7A 3DKPA 2J4FA 2R8BA 1MZVA 5JANA 4JX9A 2F22A 3HL0A 1YBFA 1ZU5A 4PHTA 2EGHA 2Q1TA 4TL6A 4INJA 2EJCA 4LDNA 5AD1A 1L5NA 1IOLA 4HX2A 2ZSFA 4RWEA 2R8OA 1U0OC 4NMWA 1PWEA 1VRCA 3KR1A 5AW8A 1TLFA 1BOOA 4Q93A 1ST2A 4REQA 4OXYA 2VK8A 5DM70 2WBLC 1I3CA 1I6KA 1TM1E 2JATA 4PC1A 1B3BA 4JIMA 3WRYC 4Q12A 4HNRA 4MJLA 5IDWA 2IXBA 1GZ5A 1BOFA 1LW7A 2D62A 1RYNA 1WCWA 5DWQA 4JL8A 4LYDA 4M99A 2ZT7A 4QPZA 5C8YA 3N8NA 2RIRA 2WFZA 5DBGA 4BC0A 3TMYA 3DE2X 1MC8A 1FSZA 3TZCA 4JI8B 1Y6GA 1IHOA 5DLPA 3HLZA 4U5CE 1ARZA 2OENG 3R2PA 3C8DA 4TL8A 4J0FA 1WATA 3EWIA 2YWJA 4O4HA 3AZQA 3W4IA 1YCFA 3OZDA 2HN9A 1OILA 1VSQA 4BN5A 2IFTA 5CFNA 1THMA 3CZPA 3QELA 3QJ5A 2XWSA 2VHYA 1NIJA 1JV2B 3SNKA 4ANJA 3UPUA 1FS5A 2GA9A 1DHTA 1YRBA 1Z4OA 1QU2A 2X8AA 4G0PA 3THSA 3TN7A 4FFLA 3IP3A 3WIUA 1LI7A 3GIDA 4TRRA 4XJVA 4MVMA 2H16A 4CQNA 1K66A 4I4LA 3OQHA 3DUFA 2ZJOA 3TSOA 1OIWA 4FFMA 3ZXIA 4Z49A 4EJMA 2Q5CA 3I1YA 5FYDA 1QNLA 2ZJYA 3JAWB 1BFDA 4B35A 1HFWA 3C7AA 2FPKA 4ZREA 2BHLA 1Z88A 1RABA 1MMAA 2Z2IA 3ENWA 4JX8A 3QK7A 4K9MA 4BNFA 3CVYA 4S0XA 4QJ3A 4COKA 2IU6A 3R0IA 5FJJA 1G8JA 4EJ2A 3E0XA 1GFIA 1I14A 3LUFA 1NPYA 1JHQA 2A0WA 1RWPA 3C63A 5BW4A 2C0QA 3NTRA 5D3QA 1BR2A 2KPOA 1CR0A 1RJWA 5KEIA 3ITNA 1Q14A 3GEPA 2J33A 3GFOA 4NTZA 5JH7B 5T7BA 1HRKA 1S7CA 2P2ZA 1G42A 5AGFA 4QEKA 4MJXA 1G60A 4II3A 1NUHA 2FKNA 2BAGA 5J2TB 3H6KA 4B4WA 3GRCA 1PDVA 4IBOA 3PDIB 3KTAA 1NBHA 2VUHB 1R3DA 4OTZA 1QLHA 2Y99A 1SUPA 4DRZA 5BWOA 2G5GX 4UATA 2OCIA 1GUBA 3S4YA 4K6CA 4BCDA 4O6VA 2D2XA 3VR5A 3ZD8A 3IUJA 2BE9A 1E0JA 3WG7C 3S68A 5C9ZA 2PXXA 4L9RA 3C3PA 1ODJA 2ZANA 4EFDA 1XI2A 3DV2A 3B9BA 1H2AS 5ALPA 1YNSA 4DSTA 3DL0A 5HCIA 5GVRA 3PITA 2GN0A 4FESA 1NM5A 3QUQA 3GUYA 4S1NA 4DDKA 1QJ4A 2R7SA 4R3NA 3HJBA 4F06A 3KYJB 1NC1A 1FRNA 3BVPA 2OVBA 1UK6A 2Z98A 3KALA 1RXWA 4CJGA 4EGQA 5FLEX 4IIGA 4XASA 5L4LA 1JB9A 2ONYA 2Q2WA 4PQYA 5D91A 1VL1A 5EJ6A 3TLCA 2VF2A 3AR2A 3EGXB 4AIIA 2YZMA 3W4JA 1K9SA 3G9QA 4FJ2A 2BCGY 4TROA 3GP5A 4EW2A 3I6IA 5JCOA 4F71A 1HE1C 3V1YA 4CFSA 2O0JA 3C3AA 1U90A 1YFJA 1ZONA 1DC3A 5HF9A 4W6ZA 3LNTA 3V80A 4GUDA 2XMRA 5IC5A 2A33A 4F0JA 4X7RA 3R3JA 2VBCA 3Q3GE 3VKHA 2EFDB 4NZPA 3CSDA 3H1AA 3VNSA 4ARVA 3OTOB 3KIPA 2I7TA 4KXFB 1L5MA 3LD9A 4FI3F 2CUKA 1MNEA 1X8JA 4GYWA 5CU7A 1K0FA 1YR9A 2VBFA 4H31A 3BHIA 2IYAA 3FGNA 1Z6QA 3ACDA 3RLIA 4PYKA 5FWYB 1RWQA 1DO0A 4FNGA 2QLLA 3RNLA 4X6XA 2CN1A 2FWRA 2QVBA 5FAKA 2GH1A 4WFKA 3UCXA 2P7HA 4FGUA 4PK4A 1G38A 1K27A 1XC7A 1VCMA 4OLJA 3R7LA 3EH1A 3GG2A 4QPPA 1E3QA 4YP1A 2R68A 4O3FA 1JLKA 1JFLA 1Q50A 3D7SA 2ST1A 2QIPA 1LKZA 2NU8A 3HFJA 2HMZA 4H77A 5LOVB 1FJ2A 1VLSA 1JAYA 3C5VA 2F1OA 1RHMA 3LM8A 5DP1A 4BKRA 3E15A 3L01A 1J00A 3K4QA 5HE9A 2RDMA 3KDPA 3UG7A 1Y7TA 4Q9KA 1L5KA 5I7WA 1XX6A 2FFHA 4DQXA 4XX0B 4I3FA 1C7FA 4Z99A 3PKJA 2RONA 3R7DA 2YH2A 3RKSA 4TMKA 3V1TC 2R6ZA 2VPPA 1YJAA 3O21A 2W0SA 2ACWA 2H7YA 1L7CA 4RPKA 2XLDA 1XP8A 4Z1MA 3ML1A 1W4RA 4D43A 3LK7A 5HGJA 1EX9A 1M66A 2DG2A 3EGDB 2CCKA 1YS2X 3PWZA 3O39A 1TJ5A 4BL5A 4RLHA 3NTVA 2N3ZA 3VI3B 2VHCA 5AVVA 2ISCA 3INRA 2ARKA 3TIVA 3B1JA 2NUAB 5KYYA 4BN0A 4KK3A 1XCBA 2C9BA 3VXKA 5ED4A 4KYTA 3ZY3A 1NMZA 4KB5A 1W4ZA 2J09A 2KBEA 1BX1A 4L4XA 1XJQA 3MFQA 2WJVA 2OFFA 1AUVA 2EPLX 3CBQA 3QWHA 1JBKA 4G9GA 2OOKA 4ZAYA 1E1MA 4ALMA 4FWTA 4J29A 5HYVA 4CETA 2D1YA 4XWYA 4MQBA 3QYAA 4MS4B 2I66A 4GYJA 2RK3A 4LDRA 1GQ2A 3SX2A 1A7KA 2CUTA 2Z15A 3QU5A 5I4IA 3JD0A 5AOVA 3K0BA 1GN9A 1BDJA 5T3TA 5KYUB 1HSOA 3HDTA 3LT1A 1B42A 3X1YA 3CG0A 1CJKC 3BXZA 2WUFA 4EO7A 2I9KA 1XXHB 3LHFA 4E5MA 3SMVA 2D1RA 5TV2A 2Z58A 3G9XA 4Q82A 4W7IA 3LQ4A 4ND8A 3MWEA 2VXBA 4JI0B 4IF6A 2XKBA 2JS7A 2EERA 2C92A 4MQ9F 3DVAA 4NJEA 5DK6A 2QI9F 5KHOC 3K0KA 4RHEA 3ZHRA 3RRYA 4YBRA 4ND2A 4OL9A 1XRLA 4OSPA 4DY6A 5A6JA 4B74A 1DELA 2WF8A 3U1VA 5HW0A 5KTTA 5IJZA 5JAHA 1RZUA 4ZJPA 1H6CA 4M1OA 2FPIB 3ZQYA 1DWPA 1U5AA 2ZEJA 9MHTA 4H7FA 3F8SA 3ZKAA 5AUPB 3ZWPA 4IRMA 3JZAA 2AMFA 2ZJFA 2COKA 1XZ8A 5BV8A 1KO1A 3CZ6A 1J0EA 2DETA 1XPJA 4EWLA 4MVJG 3OJXA 1QDUA 1NXVA 2GBPA 1SQ0A 4BUCA 1TQ2A 1B2RA 4CN9A 2D8AA 3VDNB 3LGAA 2UKDA 3KP1A 5TQ0A 3CNOA 1VJ5A 3UMKA 4AJKA 3R4VA 4ILKA 1FNMA 2AFHB 2H5EA 3GFTA 1WAMA 3G2HA 2SKCA 3WGIA 1PNVA 1YZLA 1Y6FA 4S1VA 2ZD9A 1TD9A 4MB2A 4BEBA 4Q66C 2B30A 2JIPA 4F9TA 1XN1A 3OU6A 4HC4A 2MINA 4KVGA 4WK2B 4K7JA 2QW8A 3ESZA 4ZVKA 2VF7A 3D7RA 4OXXA 4ER6A 5CVTA 4CU5A 3PU6A 1XZFA 5I7AA 1II8A 4KX3A 3LA6A 1E1QD 4Y1EA 1Z2NX 3S2YA 5JLAA 3L34A 2DLCX 3UJ7A 4NY1A 4UUBA 3GZNA 1YZVA 3OAAD 4BB5A 1H23A 1N2EA 4LNUB 1T26A 5LB4A 3GFSA 4DXWA 4R8SA 3TNDA 4NBKA 4DUPA 2OO5C 5BXQC 5KIAA 1E3WB 1TR2A 3HNIA 5LA6F 4ZQBA 1FJXA 3VGPA 2HA2A 1U3DA 4CIBA 3R6WA 3U3XA 5KYXB 4MI1A 5B3AA 4OAQA 3AH8A 4LK2A 1UBHS 1KZGB 3RH3A 4EUKA 4GQIA 2H4HA 1KTVA 4RTLA 1CULC 1V7QA 1L7AA 1VL6A 5F9MA 3MS4A 4R1TA 2Z8XA 4C3VA 1U3WA 3TFWA 1CUAA 3MXOA 1Y82A 2P91A 3SXKA 4LJRA 4M9ZA 5FPQA 4AZWA 4DL9A 1V1JA 1ESDA 2IXOA 4AXBA 3SKXA 4PFQA 5FPSA 1YAUO 1E1NA 2XYPA 5JATA 3V6LA 3HP4A 4B7CA 3FCOA 1E9EA 6GPBA 5CEEA 4JYAB 2JLVA 1JF8A 1U1CA 3BJIC 1KY2A 3O93A 2V7EA 4UDNA 1HETA 1WCXA 4BEMJ 3I76A 2R65A 2ZBGA 4QVGA 2MHRA 4DLAA 2FVYA 4TMTA 1DXHA 5E1OA 2EFGA 4MZXA 3WNCA 1I2DA 2H0AA 1S2LA 2GD6A 1UAGA 2DUMA 1OLSB 1XTRA 3I2YX 3WRWA 3H2VA 3GT0A 4XPYA 3ZQVA 3V9AA 3IA2A 1RDFA 4NFLA 1Z7WA 3ZWOA 1CLUA 3C8HA 3OM8A 2FY8A 5LB2A 3GLGE 2BKEA 2E21A 2FCAA 3ZE8A 4YS6A 4HFJA 3T1HB 3PDJA 1SPXA 2HU8A 5AESA 5LQRA 4HP8A 4DM4A 1SXHA 5DMHA 1R15A 3ISTA 3WKEA 5JRAA 3ZBTA 5BORA 1QTIA 2WA1A 2ZROA 4DR3B 4R98A 4U02A 3HU5A 1SMYF 3D54D 4BP1A 1SXJA 3SXPA 3IQTA 3V2HA 3TEFA 4WX2B 1FUUA 1Z7EA 4KEAA 4G01B 4FFPA 1D2GA 3D6HA 4OX9B 4AECA 1SCIA 4G0MA 3HY6A 5FPYA 3UB3A 5C4IA 4RIGA 2RGGA 2XUHA 4KOAA 5JNRA 3D02A 3T7SA 1D4FA 1GPH1 1VOTA 1FK8A 4WK0B 4BZXA 2Q8QA 2WR8A 2ZRLA 2HA0A 1DPGA 3E22B 4WBXC 4PG4A 1QP7A 3LCRA 1LS4A 4E46A 1LW6E 4OIQF 1KQ3A 4NG5A 1RI5A 3R0ZA 1H8HD 3JASA 4P4UA 1Y6QA 3UENA 4HNGA 3TL6A 1WPGA 4X60A 3BQMB 4UBOA 4YRAA 1PNTA 3VHLB 2C00A 2IHNA 1EFDN 4DA4A 5FZTA 2IUSA 1EAMA 2PPLA 5B1HA 1L7RA 3RS2A 2YHIB 4TMFA 3TKLA 1K2VN 4J0EA 4CZ2A 4CTMA 1UJ5A 3OT1A 2PPVA 5HF6A 3AFHA 1Z12A 3ROTA 1Q1AA 1BDMA 3ELUA 2VJNA 4EG7A 2AS0A 2G3YA 4AG5A 4O4JB 3ITEA 3U3MA 4C29A 1ESNA 5DM60 5DM2A 1R12A 1PFWA 1MIOA 5A6VA 2ASVA 5HFNA 3U4CA 5IP5A 4BPMA 5H3LA 1Z7GA 1ZD8A 3NP7A 1EE2A 3UK6A 4KQ6A 4JLUA 4TMZA 3FZNA 3ZW8A 4NC3A 2D54A 4TTRA 1N0VC 2YFQA 1ZNYA 4LDAA 4JR0A 3LEOA 5EPOA 3PDMP 1VSTA 2GLXA 4TV8F 2W4BA 3O3NB 1KE2A 1N92A 1N6LA 4A6DA 2PQMA 4LDKA 2CNBA 4ZCQA 1G98A 4Y1RA 7GPBA 3DPUA 1IMOA 4G1VA 1E8NA 3SXUB 2ZRMA 5DHAA 2O57A 3LTEA 3AOEA 4RULA 1D07A 3HB5X 4HH4A 2PA0A 4IVNA 5SICE 4WNIA 4GPIB 5DYNA 4PC7A 4B3CA 3SX0A 4X65B 4UVGA 5I01A 2AYZA 4BLUA 2XMDA 5K6RA 4BFUA 5GJVC 1I2ZA 2J32A 4UEOA 2JPDA 3FHOA 1WCIA 2FN4A 1LK7A 1P7PA 4JUAA 5CA1A 5AXBA 1JH9A 2Y1XA 4LSZA 5A0FA 1EE9A 1UBNA 5K8CA 3RTGA 3H0KA 4H15A 2WFMA 2X86A 2R7UA 5H5JA 1LBIA 1DV2A 3HCRA 4CUZA 5EFZA 4ASUD 2WU0A 3PDHA 4DV4B 2JGEA 2QLTA 2VNSA 1GPJA 4U3JA 1AN9A 1E6CA 1IPHA 4G63A 2O2EA 3ZGZA 4MHSA 3ZXSA 3WNBA 3O38A 2HDNB 2EZ8A 4PPYA 4QOSA 2Y0EA 1GVNB 4MQ5A 1QC5B 4M89A 1ZHWA 1YTLA 3DHYA 2P9CA 3C7JA 1PJRA 4INZA 2X0NA 3VHRA 5C7YA 4CDYA 4KUGA 3P5SA 1C4KA 1VCIA 3T7TA 1P0MA 2QV7A 1N77A 5TY0A 2C04A 2PH5A 1EFKA 2RG1A 1YOVB 3QPAA 4HXEB 2XD9A 3M6FA 4CVNA 1PL6A 3IILA 1EB9A 3BCSA 1EA8A 2IUFA 5EVJA 1BRMA 4LVOA 3EVGA 1D6NA 1G8FA 4LJSA 5A05A 3KFLA 1USUA 3KJXA 4EHIA 5E1MA 2B0JA 3MTDA 1U11A 3BE6A 2I54A 2IP2A 2RH9B 3K6KA 1WZNA 3JQ8A 3NAMA 2Q1SA 5EJFA 2FSVC 4G1UC 2W2KB 4BVKA 4B4VA 2C3PA 1TUBA 1PS8A 1NXXA 2G9NA 1KI4A 2B25A 1V3UA 3L7LA 2JFYA 1QYWA 1TYEB 4MQFA 5J4YA 3UHPA 4KZPA 1IEQA 2OCDA 4YCMA 2CFSA 5ALZA 1U7TA 1E7RA 1D5CA 1ULBA 3OZVA 3C3EA 2GRUA 5DEOA 3NW9A 5K99A 3MAAC 3MWLA 3STUA 1ICIA 1RAAA 3JZMA 3K33A 4OI1A 1E99A 1Z13A 5IT4A 3ISVA 4EQ6B 2ZXFA 3AM4A 4YL1A 4WADA 5JE8A 3EIWA 1HLDA 5IYZB 3M2PA 3MWJA 4TZTA 1F17A 3JQGB 4DV0B 3HBNA 1WXEA 1I3KA 1P39A 5IAEA 4PRYA 3A4VA 3UK7A 3UNXA 1PVDA 1YRAA 2IIVA 4HS4A 3P8ZA 1U9YA 3JX9A 4IVRA 2A3NA 2HD4A 3IEUA 1K5GA 4HVTA 3GD5A 1YT5A 3DAPA 1NVFA 1R18A 3KQOA 3R75A 2GCNA 2UUOA 1ZYRF 5AW7A 4BDSA 2PMKA 3AHDA 4JRZA 1AQUA 2G9ZA 2FLVA 2Y1DA 1W0KA 4R6WA 2EZTA 4GOND 1ZHTA 3U3FA 3Q3VA 2QSUA 1P7VA 5ALSA 4M87A 5E9AA 1ZLXA 4D79A 1YVDA 1V39A 3ABOB 4AJ2A 1OXKB 3K09A 3DCIA 5CVUA 3ZHZA 1TJPB 4KX5A 4CCAA 4ER0A 1E1RD 1KO8A 4PYQA 2EW1A 4OQYA 5F9FA 5D87A 1HT0A 3UTCA 1K92A 2CDCA 3C7CB 1O6CA 3WG9A 3OA0A 4OLAA 3FVRA 4PPGA 1GGQA 5JZBA 2WU4A 2PO7A 2XDQA 2HLDD 1I6MA 2PTHA 1GZ6A 2LVBA 4TV9B 2GZ3A 4BTLA 3RRXA 4ER3A 1Z8DA 1DG9A 3S2GA 1RYDA 4HLNA 4FR2A 4WGGA 4JP8A 1G55A 4F12A 1R8SA 3PXXA 1IJKA 3L40A 4D8TA 4H4CA 4EEZA 1FXWF 3D8BA 4G4SO 3HMKA 3MELA 1MDFA 1BVUA 1AQLA 4J0KA 3UUGA 4F5EA 1LPPA 4A73A 3IHWA 2BFWA 1CS0A 3IIKA 1ZAYA 4INOA 1VB3A 3DO5A 3NBFA 1QIJA 2X5JO 3IPMO 3MFNA 7ADHA 1TCAA 1XNQB 4P08A 1TZKA 1MO6A 2E6UX 3WNDA 3HB9A 2V6IA 4UW9A 3INGA 3GOHA 3TIFA 2R1UA 1F38A 4JDPA 3N0VA 5AO9A 1I7LA 3Q88A 1OVGA 2PFGA 3CEAA 3HCOA 5EJEA 5B58T 2H48A 3HKEA 1JXOA 4MARA 1LU9A 1HQYE 1CYDA 2HWWA 3BMQB 3FOFC 4RXMA 3IV7A 1SD2A 3I72A 3WL4A 1QGAA 3LX6A 1N2ZA 4Q4LA 5I9TA 1MPXA 3U62A 1F2UA 3PEEA 3KVOA 3K66A 3GGSA 4UFPA 5DOVA 5HP4A 5KX5B 3L7BA 5E33A 3TX6A 5ALGA 2O1XA 2R86A 4U9IS 4K9OA 1D3AA 2XEXA 3VM6A 4ZVOA 5ICGA 3HYCA 3Q85A 3U9LA 4IDFA 1Q0TA 4CDNA 5LFAA 4DG5A 2ZYGA 2H2FA 1V96A 1JHRA 1IATA 2Q3DA 4R9SA 3AEUA 5HUQA 3T3GA 4OFZA 2YLIA 3I58A 4W8GA 4P93A 1AIPA 3KMIA 2NLOA 4BTVA 1KFCB 4KIFA 4LUCA 4BZQA 4AKIA 2QTWB 2ZR9A 1A8SA 4JI1B 4QYIB 1N3IA 3TQSA 3JRNA 2GDCA 2VP5A 2JZOA 3B85A 2ZJ2A 6YASA 1QAMA 1WTAA 3SSNA 2YN4A 2ZXPA 4Y2UA 5ICSA 1LX7A 4Q4HB 2X14A 5HF8A 2Y3GA 1PEAA 5TQ2B 3AKZA 1UOEA 2C1ZA 3UMFA 5CDSA 4FDMA 2VAMA 4O5AA 3RF3A 1IY0A 3BWYA 1TIBA 1VPVA 3CTMA 1DCFA 3LSTA 2FPGB 1LVGA 2J0QA 5BVHB 5EXDA 1U80A 2NYAA 4OFWA 1OQAA 3TVTA 2IH4A 1DSSG 3SM3A 2FP4B 1KEKA 1Z26A 2FSPA 1PT8A 1U31A 1TU4A 3ZDCA 5BQXA 3OCXA 3ZKWA 3M3DA 3LE8A 5IJ0A 3DTVD 3W6UA 1X8KA 2P79A 4DRXB 2BKUA 3FDXA 1MGPA 4NNPA 4AUNA 3W2WA 1U2QA 5ALDA 3CPSA 5CB6A 1VTMP 1UDBA 4YUZA 1M75A 3PI7A 3GRAA 3RVRA 1HQKA 5MFZA 3TZKA 2X5OA 2YZ7A 2PUDA 4EA6A 4UBIA 4WDRA 1ODSA 5U9CA 2OZLA 2ZIXB 3WGHA 3HH8A 4OHOA 2AQ8A 4BVFA 1Q0FA 2D7JA 1QG0A 1Z5PA 3A1DA 4X1IA 2AR9A 3TW0A 2O3TA 1GVHA 2Y6VA 3P0FA 2VQFB 1LVHA 1KI8A 1UBTS 3TJRA 2AOXA 2J9RA 3SR0A 3BJRA 3PTAA 3S99A 4YAUA 1THTA 2ZWOA 1H2ZA 3AJMA 1UBJS 1X80A 4RXTA 4BMNA 3DCJA 4K8OA 1MVOA 4EF4A 2R84A 2HFIA 1GKYA 5CP8A 4NAVA 3B20A 3H99A 2QNIA 2B4QA 5HJ5A 3UBMA 1RAHA 4A2WA 1I2BA 1WLYA 3GRKA 5T3UA 5G41A 2AI3A 2G1PA 3OC6A 4ROSA 3K70B 5IARA 4YUXA 2AN4A 3FI9A 3NHWA 1USVA 1VHWA 1P0PA 1NXSA 3IMGA 4DBZA 5ESWA 4XARA 1Z0UA 2X13A 3NKLA 4CLRA 1TTQB 1VKRA 1BE1A 1WXGA 1LK5A 3C3CA 2QXUA 3D1JA 1CLEA 3PDCA 2MHCA 4IEFB 5AXCA 3QVLA 5K3OA 5JYEA 2JLAA 3ZHQA 5C52B 5F21A 2WVAA 4U7TB 4U8GA 3X1MA 1XTIA 5EERA 1V4BA 5E3HA 3UY4A 3P45A 4J2HA 4HLQB 2ODWA 3K0FB 1KH3A 4TZ6A 4IS3A 4KBYA 4U7WA 4RUKA 5E2AA 2H9AA 1DEKA 2X1LA 2Q49A 2VJKA 5AJXA 2WIFA 3U7HB 1CVLA 1TEZA 1C0EA 4HWPA 1O5OA 4GBED 1DAEA 4L3OA 2F17A 3E7DA 4GR9A 4FGZA 3ZTYA 2FRXA 4ME6A 2XSZD 4OI4A 2WWYA 3UAGA 2A7XA 5K8JB 3B7WA 1PR1A 4PZ9A 3A37A 4DLUA 1E1CA 2QJTA 3K5HA 3AM1A 2NNWB 4Z9JA 4AO6A 2V59A 3DR5A 2ZZNA 3F7OA 3OQPA 1JIXA 2W6ZA 3HPRA 4B3BA 5JROA 5FKJA 3UJAA 2DH6A 1QOQB 4S2EA 1ZJYA 3GLFB 2GLUA 4G9EA 4JUBA 1HLFA 1UK8A 1Z45A 2O8BB 1JQ5A 5IM5A 3QMWA 3ZU5A 3OEEA 2R47A 5HEKA 3LUHA 3V2IA 1M1ZA 1G63A 3LDFA 1NW6A 3T9BA 3GX1A 2QN9A 4N54A 2ZBQA 4DYDA 3PEWA 4WJLA 3J7AC 2O5RA 2GX6A 5ITWA 2QF7A 3HP1A 1TGVA 2Q3CA 1YC5A 2I6SA 4N3BA 4Q4AA 1FP1D 3ENZA 3A2LA 5K4GA 4ZZ0A 4D9CA 1JLSA 2VPWA 4RTSA 4BWFB 2J85A 2HUJA 2GPNA 1FFHA 3CMCO 3U60B 2AKEA 4M0MA 1ESCA 5T1DB 3NIGB 4GSKA 1SD1A 2H2AA 3FMFA 3EGIA 4KN8A 4IIXA 2PSHA 2FWMX 5LQDA 5EIWA 1PR9A 3A4IA 1ODKA 5IDQA 2H4ZA 1DX9A 4Z4GA 2VXCA 3IUPA 1Y4DE 3A9WA 3EFOB 5EIBC 3GLTA 1MB4A 3KR2A 3ECSA 2B4KA 1GAQA 4PSKA 3GFFA 2QN7A 3WP0A 2XL6A 4OGWA 2VC9A 4Y2VA 2OLJA 2BGLA 1BSVA 3AW9A 1NFOA 1UWCA 2CVOA 2I76A 2NVOA 1OYWA 3RS4A 3DA8A 3CIOA 3F47A 1VQ1A 3AGPA 4R7GA 4G4GA 4XPXA 2D0IA 4FYVA 2LKCA 2IBFA 3A4NA 4QL3A 3JQPA 2VWPA 1EQ2A 1Z4LA 1ZGZA 4H7EA 3JYPA 2JIQA 2VUUA 1J0XO 3SHFA 2O2DA 3NMUF 4RGYA 5CLGA 1NN3A 1XE3A 1E6WA 3GWZA 1BYUA 1XEWX 1VA4A 4LN1A 1CNMA 4F21A 2X7XA 3UGJA 2ZRQA 2CZGA 5EWMA 3I12A 2BR4A 4CLOA 5KJ1A 4HDRA 5DTRA 3ASYA 1STOA 4IB4A 3PV0A 4M9QA 3E27A 3RYCA 1V9CA 4LXGA 2XM4A 1ECFA 1U2SA 4P2BA 2Z3VA 2Y0PA 3VR6H 3RJTA 2XVAA 1C29B 4HVCA 2V7XA 4N4AA 3NBXX 3H8WA 2P69A 5D8DA 2DHRA 3G50A 1BXKA 1NQXA 3UJDA 3H42B 1IAVA 4NYMR 3ICCA 3WTCA 2CV1A 4B1FA 2O8DB 1CQXA 1EUYA 1IUKA 1NR7A 3DLCA 1S96A 3FR8A 3QKWA 4JA2A 1X9HA 3F98A 1U3TA 3ZZNA 3I53A 1RYYA 4M9XA 3LT4A 4YGXB 1S1CA 2JLUA 2I4MA 3SC4A 3SEFA 4CIHA 1ZSVA 2XV1A 3IMCA 4CKYA 5FOSA 5L0CA 2NV2B 821PA 1QPUA 2EIJC 1G17A 2GFQA 2HC9A 1GM5A 2FVXA 4BGUA 1C9EA 5TARA 4QARA 1B68A 5LP6A 4NS4A 2Q5OA 4KLCA 1G5TA 1TXGA 1ZCFA 3DC7A 3TS1A 5CX1A 3UAZA 3OFVA 4V0RA 3KUDA 5EUBA 3FX2A 4RHYA 7YASA 1UBLS 1RWVA 4CG3A 3PC3A 5CTJA 5HQJA 4MUBA 1ZRMA 1FS4A 3LQ1A 4N1AA 4QGBA 4ZO9A 1JIIA 5COGA 3EOAI 1DXYA 4IKPA 2CYBA 2QMYA 2H31A 1NY6A 1SIWA 1Z47A 1JDZA 3NI2A 5A5GA 2ZRKA 2BFDB 4O4IF 3R24A 1E96A 3JPYA 1GR0A 3FBWA 2JB9A 1MCZA 4ZLCA 1VL2A 1NJGA 5JIBA 1ZOLA 4EUSA 4DQUA 3K4PA 1XU4A 1W36D 2H1WA 1U8XX 3UCEA 4PAWA 4JJGA 4DSZA 1GRCA 3ANMA 2R1ZA 2X0IA 2YBEA 2OU6A 3HEMA 4AZ0A 4O6MA 3NWOA 2P78A 2HO5A 4EYQA 2XTMA 3L9XA 4DBRA 3JTLO 3W2VA 2C3UA 4MR7A 4CPDA 4D9NA 3FJOA 3O7WA 4G07A 1QKKA 2V0NA 3BB3A 4U9HS 3NO4A 4EH1A 2BFAA 3NETA 4RF4A 5FOUA 1EWYA 4Q1BA 3EEFA 4LBYA 3PA8A 5H8WA 3ZVMA 4OJYA 4PLGA 4CM8A 2XMBA 4JN6B 3FIUA 3O92A 2HH9A 3M8KA 2HSEA 4TLBA 5JY6A 3PQ2A 3AG2C 1XCLA 5LUBA 4S12A 3POVA 1PEDA 4C07A 1YZ3A 1W75A 4EB6A 1XZHA 1DVRA 5LU9A 2BTOA 5CIYA 3K5PA 1KYIA 3PQCA 2Y66A 5J1SB 4YRNA 2HCFA 1BWPA 1FJGB 1ISFA 3JWGA 4OGFA 3CLTD 3LVFO 1YI1A 4OIRF 4L5IA 4YLEA 5DCWA 4TRNA 5EZ5A 3V5NA 3N59A 5BQHA 1CRPA 5AW3A 3KSDO 5ALJA 2XGSA 1OA1A 1GU7A 1M7GA 4NAUA 1HURA 5BMVF 4UC0A 2Q4DA 4YUVA 2O48X 1UADA 1XPOA 5TS3A 4HYYA 2AI2A 4F93B 1PYGA 4NATA 1M8FA 4YDRA 3AHIA 1ETUA 1ULSA 2ON6A 4JOSA 1DFGA 4F92B 1Q0KA 1IUNA 2V03A 5H3HA 1IG3A 1JE1A 3WK7A 4GRDA 3WICA 2JFBA 3S84A 2X9QA 4KC9A 3TQIA 1BXGA 3LCJA 2J3QA 3C5CA 1XTUA 4JU9A 3D6NB 3QSYA 2QUBA 2FDCA 1VE9A 1K5DA 2WZQA 5J4HA 2ANCA 2OV6A 3J80A 3EVEA 3JQ7B 3AILA 4AZ3A 2B2XA 4DA0A 3K92A 3DAOA 5B1YA 2M1ZA 3K8ZA 3H7AA 3RYLA 2P9HA 1ZOIA 1V4NA 2Q6IA 3AEQA 4FZJA 3I9OA 2VA9A 3GA7A 3LC7O 4D92A 2HJGA 2KS6A 721PA 1ORJA 3JVVA 2VS1A 3NV9A 4C6RA 2Q4EA 5F7JA 4C6TA 4DREA 1YCDA 4KXMA 1T6YA 1CRQA 2OCPA 5D51S 2R03A 2V74B 2IYQA 4C08A 3U9JA 3I2KA 2NAPA 1QZXA 3S5JA 5KNCH 1ILWA 2Y1EA 3Q5EA 1NRWA 2SNIE 2H2DA 5JI3E 1XPUA 4C87A 1ZZPA 3P0EA 1SC4A 5BWMA 4XUDA 2OAQ1 2I2CA 2XF2A 1RRKA 3E0QA 4R2LA 3T1OA 5JPIA 5KTKA 2P4EA 1OU4A 5JASA 4ERXA 1TQ6A 4YWQA 3BXGA 4UXHA 2ZYAA 2RI0A 3GJSA 2FPPA 4U63A 3N5CA 4PR3A 5IULC 3RS3A 3F6YA 4MUFA 2R5FA 3VVLA 4FLFA 1FFEA 2MSEB 5IKXA 5TT0A 3CTPA 1U8TA 2E2WA 1R6TA 3H19A 4P0PB 5CDFA 2I3AA 1FFYA 3DP7A 2ZSJA 5JUWA 3U5ZB 5G0TA 3LLKA 4CM7A 5J2UF 3GMIA 3W5BA 1KJIA 1OFUA 1JDVA 5EUCA 3UR3C 1FSPA 4XQGA 2DPGA 3H9BA 3KRTA 3HO8A 4QX6A 2HMQA 1LLCA 4AYTA 4WRRA 2YJTD 1FIUA 2H54A 3JQBA 4HPWA 5C7IO 1OH8A 1LB1B 1K98A 2R6R1 1XVUA 1E2JA 4CG1A 2HZBA 4I4TA