2PX3A

Crystal structure of flhf complexed with gtp/mg(2+)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
258
structure length
256
Chain Sequence
PEPLRKAEKLLQETGIKESTKTNTLKKLLRFSVEAGGLTEENVVGKLQEILCDMLPSADKWQEPIHSKYIVLFGSTGAGKTTTLAKLAAISMLEKHKKIAFITTDTYAAVEQLKTYAELLQAPLEVCYTKEEFQQAKELFSEYDHVFVDTAGRNFKDPQYIDELKETIPFESSIQSFLVLSATAKYEDMKHIVKRFSSVPVNQYIFTKIDETTSLGSVFNILAESKIGVGFMTNGQNVPEDIQTVSPLGFVRMLCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the third signal-recognition particle GTPase FlhF reveals a homodimer with bound GTP.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Biosynthetic protein
molecule keywords Flagellar biosynthesis protein flhF
total genus 72
structure length 256
sequence length 258
ec nomenclature
pdb deposition date 2007-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1380 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2px3A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2px3A02
4DLTA 4HZUA 2FGJA 3K8YA 1OXUA 1R4AA 1GRNA 2JLVA 1RJ9B 4OI4A 1A82A 4GNKA 4NCKA 5BQ5A 2VHTA 3FYHA 2FG5A 1A7JA 5FPTA 3QENA 4OK3A 4JBYA 2IYUA 5DGXA 3CR7A 3EAQA 3QKSB 2UKDA 2WBLC 2WMOB 3MWLA 2IS4A 3KB2A 1WBBA 4LJ7A 4EPRA 2GILA 4MRRA 1G64A 1KMHB 3B1XA 2UZ3A 1XDBA 4LJ8A 3K9HA 2WWHA 4QBFA 3B5JA 4L8GA 2HF8A 2RGDA 3C41J 2F6RA 2AXPA 1QVRA 4WBSA 1NRJB 4FWTA 3S1AB 2HYIC 621PA 1Z06A 1GILA 4YMUA 3QSYA 1AA9A 3EC1A 5EP2A 2GJKA 4ZDWA 3OE7A 3BORA 1WF3A 5HZHA 1XMSA 1U81A 1ANKA 5FTLA 5J4HA 4WW0A 3MLEA 4MKFA 2DB3A 2IYYA 1XTSA 3NEJA 3NHAA 4WZAE 1ZM7A 2IA5A 3B2EA 4HB2A 4YC7A 4HDCA 1OXVA 5CDFA 2ZRMA 2OHFA 2JLZA 3VU9B 3C15C 1HT1E 3P4YA 2KB0A 3RC3A 3EPHA 4MGYR 1UEJA 1H8EA 3RS4A 2QA5A 2WWFA 3TJZA 3M0EA 1YU9A 3L82B 4UJ3A 5FBLB 1W7AA 4RKFA 2BBOA 2PBRA 2ZJYA 4FMCB 2GF0A 4MGIR 1TF7A 3IKJA 3QPUA 4JIMA 1Z0DA 2ZIAA 5K8IA 4EQ6B 1YQTA 4PTLA 4ARZA 3D3QA 8OHMA 2GCOB 3IBGA 3GJ3A 3L43A 3RDPA 1E9FA 4RZUA 4B3GA 4Q47A 3TSOA 5KUTA 3B78A 3D31A 1N6NA 1P60A 3VAAA 3OHMA 3QF4B 5KNCA 1YZTA 1K8RA 2CE2X 2OT3B 1P6XA 2B8WA 4F38A 5EZ6B 3U2QA 4JL6A 2IYWA 5CITA 3DDCA 1FX0A 4DT1A 1CKEA 1IJEA 1OW3B 4M8NE 1IXSB 4DJTA 2O8FA 2D62A 3ASYA 2OZEA 1TQ6A 1E0AA 4TLDA 4PPQA 2JLXA 4M1WA 3QNUA 1UDWA 1SZPA 1WB9A 2EU8A 3RS5A 2WVJA 1OIVA 4XIGS 1D2NA 4BRUA 2FFBA 4PC1A 1Y3AA 3CIOA 3FKQA 1VHTA 1Z47A 3I73A 4DLZA 2PMDA 5HTKA 4G01B 2Y8EA 2GEDA 2YC2C 3HP1A 4KBGA 4ACAA 4V0MA 4QHSA 5D3MA 1KI4A 1QF9A 1TQ4A 3BH0A 3UANA 1QZXA 1TADA 3KTAB 2CHVA 4I81A 2N1BA 1V5WA 2FPLA 3KUCA 4K81B 1VIAA 3TMKA 5H68A 3LXXA 4W5HA 3K9NA 4KFSA 1KDOA 1KSHA 1COWA 2V8OA 4OK5A 3UK6A 5A4JA 1AK2A 4QG7A 4URVR 3QKRA 3AKEA 3SQXA 1NBME 1W4RA 4DLWA 1E2MA 4B73A 3GLIA 4A2QA 4ZCLA 3RABA 3P27A 1IOZA 3VHLB 3AVWA 2R65A 5FL7D 3SJZA 4CEJA 2BMJA 4M9SA 4PXAA 4MKIA 1Z8FA 4D4LA 2C03A 5AJVB 4JBWA 1EWQA 1QG4A 2PT7A 4I1UA 3M1IA 1KSJA 4C4PA 2JGNA 4RCZA 1IXZA 4MYTA 1XTIA 5KOYA 1AZSC 1EFTA 4L4UA 5SZHB 4LHYA 1S8FA 3EZ6A 4DVGA 4V0LA 2FFQA 3LBIA 3I61A 1BIFA 4DSNA 2IS1A 1CR1A 1P61B 2FEMA 3JZAA 3VX4A 1VKJA 4RZXA 2ZRLA 3LV8A 3RVBA 3TUIC 1GVNB 1IN7A 4H9GA 2ZJZA 5JRZA 1E2FA 3W8NA 3OIWA 3VNUA 4Z8XA 5E95A 2V54A 4KI0A 1N5KA 5KHOC 3AVOA 1Q44A 2ZS7A 2CCKA 3FHCB 4FW9A 1EFHA 1J8MF 5TARA 1A1VA 3IO5A 2YV5A 3WMGA 3UWKA 2X2EA 4WVFA 1JQLB 3C8UA 4LBYA 1T4GA 3WNCA 2O8BA 4P32A 3WHLA 1VYVA 4LJ4A 2A78A 1YZLA 4RD2A 2BBTA 4MYUA 1TX4B 4D6PA 2ODWA 4M1TA 1UFQA 1E2GA 4ZO4A 3UMSA 3GLIB 1L8QA 4IVQA 4KODA 4OQXA 1FNNA 1H65A 1K6MA 5DI9A 1E9DA 2FMXA 1CTQA 4LI0A 5FTNA 1MOZA 4B43A 3O8BA 1Z07A 3T5DA 4M9ZA 1F2UB 2GXAA 4QNRA 1XD2B 3L0IB 2QSYA 5JECA 3QVVA 1HA3A 3VNVA 4JLNA 5HCNA 2AWOA 3AUXA 4IXNA 3TNFA 1T3LA 2AX4A 2REBA 4XTCS 5DI3B 1YKSA 4HUQB 3S1AA 4X8MA 5JEDA 3TGPA 2MMCA 3I4LA 2FSFA 4TZ0A 2IYQA 2YZ2A 2ZI6A 4OI2A 4JLAA 2PEYA 4PAOA 2QQEA 4DDTA 2IUSA 2VQSA 3SR0A 5EUQB 2LKDA 1ZMXA 3LX8A 1TMKA 1H8ED 1D8TA 2DYKA 2QAJA 4FCVA 5FBVB 3KDSE 4B2PA 3VMFA 2O8DB 1XJQA 4A0HA 3D8BA 3ZD7A 2FE4A 2QTHA 4N0DA 3QBTA 1E32A 1JALA 1CJKC 1SXJC 4L5BA 3RHFA 2VHCA 2ZSFA 2IXFA 4YONB 1S3GA 1R0ZA 2QMOA 4DLXA 3DKVA 1SXJA 4Q7LA 2J0SA 2BEJA 1II9A 1N6IA 2QBYA 2IT1A 1IHUA 1K5DA 1NJFA 3NBYC 3PXGA 3NIBA 1MO3A 2IEYA 2RCNA 3EZ9A 4P31A 4BFXA 2JIZD 4KV9A 4S35A 2PL3A 4EPWA 4X8LA 1PLKA 1US8B 1W44A 1MO6A 1J99A 1R0YA 3VTKA 3BRWD 3GMTA 4OL0A 1KTVA 3KQNA 4O2LA 4ZIRB 2DY1A 2W58A 2H7VA 1JEEA 2GRJA 1YR7A 2J7KA 4R9UC 3ZVNA 2WKQA 2ODEA 3GJXC 4PQRA 4EFMA 3TLXA 4Q48A 4DKXA 4AG6A 1DAKA 1T5IA 2VA8A 5F3WB 4OQLA 3DM9B 4PC7A 4Q4HA 5LB2A 1P75A 5JMTA 4GDFA 1SVLA 1XEXA 1P2UA 2W2TA 4DRZA 5FPHA 3WYAA 4UNRA 3QG1A 1KJWA 3CX7A 5B57C 3R20A 3QE0A 2DFLA 5TB5A 1KO4A 2W6JD 5J4KA 2Q9CA 3PEWA 1YE8A 2ZU0C 3G5UA 1XD2A 4IHQA 5J4VA 1E69A 4F4CA 1G3IA 1KY2A 3CPEA 2HXYA 3E5HA 1JJ7A 3VR3A 2JAQA 1JEDA 2NZJA 1HYQA 1MR3F 3B7GA 3WMFA 4CDGA 4RD4A 5JSZA 1P9WA 1QHYA 2NZ8A 1DAMA 4LK2A 3THYB 3BB4A 3SDZA 2F55A 2HF9A 4QKQA 1MO5A 5EE3A 1IN5A 1BS1A 2GXUA 1X6VA 1SXJB 2GZDA 2MSCB 4URWR 1P3JA 4XVUA 2DFKB 3GLFE 2PZFA 3BB1A 4KBFA 3R7WA 2QGNA 4OYHA 2C99A 4EKDA 2YHSA 1I2MA 3OIVA 2YYZA 4MUBA 3JVUA 4NPHA 2X8AA 3CX6A 1J70A 1E2QA 1HQCA 4F4IA 1UBGA 1ZNXA 3I5XA 3K1JA 3AVQA 1PZNA 3T35A 4YLGA 1MV5A 4TSFD 1E2LA 4WAUA 2ZRHA 2B92A 2BMFA 3Q72A 3SS8A 1TQ2A 5AJZA 3W6NA 1D9ZA 2ZJBA 4PFSA 3ZH9B 3SBDA 1KJYA 1Z0JA 4CEIB 5LBIA 3A1SA 2P2LA 2GCNA 5G40A 3GLHB 3C5CA 2BCJQ 3PVSA 1D5CA 1M7HA 5EE1A 5K8UA 2J87A 3KFXA 5JHGB 1UM8A 1ZM9A 1RYFA 2R6DA 1LNZA 3MFYA 4LYJA 4EFNA 1UPTA 4Q7KA 2WHXA 2FV8A 2QPOA 2XEXA 4B47A 2GA8A 2VP2A 4HEJA 4C9BA 5DHAA 3F3YA 3U3KA 3NKVA 3BERA 1RE0A 2PMKA 3QY0A 4JLDA 4LJAA 1E98A 4BLQA 1G8FA 2FU5C 4QGGA 1IJFA 2GVZC 2C5LA 2BJWA 1FUKA 5FUXA 1E9BA 2ZSEA 4XWOA 1SHZA 4IJMA 1DVRA 4XVQA 1NI3A 1U99A 3NBXX 2ZS8A 4ZI2A 1FZQA 1X3SA 2W83A 5CK5A 4AIIA 3NC1C 1IY0A 1UADA 2WSMA 4ASUA 2DWQA 5G3ZA 3L0SA 2G1JA 3CRRA 1CLUA 1PLJA 1AGRA 3CM0A 4EPYA 2AKYA 5FUYA 3GFTA 3LD9A 1RW4A 1NY5A 2XNDA 4QL3A 2ZPTX 4PC3A 3T06B 3FMFA 2ZUCA 3R8CA 1OFUX 2J5XA 2NO0A 4DLUA 1PUIA 1Z2AA 2IF2A 3MRSA 3SJCA 3MWKA 2QAGC 3C4JA 5J5CA 4XH9B 4A82A 2VF7A 1XPUA 2I1QA 3THWB 1N0VC 4DCSA 5GJBA 1U8AA 5DISB 3NDPA 1RFLA 2RGNC 3B1VA 4PC6A 4QGFA 1YJ5A 2CCGA 3HPQA 2BCGY 1E96A 2V1XA 3BFVA 3DMNA 3GJ6A 4H1VA 5AJYA 1U98A 4OI1A 3GJ7A 3X1ZA 1G7SA 3AVYA 3LW8A 1TF2A 4AKIA 4UXHA 4LPSA 1GIAA 2WKRA 2BHRA 2B7BA 2ORVA 4LGMA 4DCUA 1BO6A 3AB3A 4D4JA 2GKSA 1Z0KA 3N5CA 2Q6TA 3UMRA 2QE7A 4AYTA 2XX3A 5L3QB 4UXJA 4LDJA 2R6AA 1XWIA 2IUTA 1Q1BA 3VKWA 3ZVLA 3AVVA 3QJYA 4KLNA 1YHNA 3A4NA 1G3MA 2B8TA 5F2EA 4BUJA 2RGGA 3IILA 4MITA 2YWHA 5GJWC 3IPYA 3X1YA 4ASUD 4M9QA 2OXRA 2PLFA 2E1RA 1Z2CA 3AF1A 3NH6A 4Z8YA 3KKNA 4RY2A 1FP6A 3IQXA 5TY0A 5HCIA 4F7WA 4QM7A 2WWGA 1KI6B 2XNDD 2ZI7A 2ZSDA 3AKDA 3CZQA 3N2EA 2IS6A 2OCAA 3A1TA 3OESA 2F7SA 1N0UA 3BXZA 1GL6A 3BC1A 4DLSA 3UKDA 3SBEA 4TYPA 3M6AA 2DBYA 3ZS8A 3W3AA 1SVWA 2WPDD 4Q03A 1EK0A 1T0HB 2WJHA 3Q8XB 1RKBA 3W6PA 4JVSB 4II7A 4TQ9A 4V0NA 1G6HA 4MKGA 1II8A 1CR2A 1XCGB 2OBMA 5DIFA 4DXAA 1COWD 1NVUQ 4GRAA 2HJGA 3RC8A 4I99A 2X77A 3MJHA 4FIDA 5FR2A 4A1FA 1CS4C 1JJVA 3IIKA 2QPAA 2L0XA 5HZKA 2F1JA 4FWIB 2OESA 2OCPA 4Q4AA 2ONJA 4JLBA 1Z29A 1BMFA 4TLAA 3ONWA 2ZI3A 4GP6A 4TT3A 2WWYA 3I1FA 4I1OA 2JIZA 4DEXA 2VHJA 3B9QA 2D2EA 3K0SA 2KI5A 1H8HD 5K8TA 4IEEA 1N6KA 3B8HA 3Q3JB 2CNWD 1TL7C 1IY1A 1Q3HA 2P67A 4TN1A 4AD8A 2RGBA 1E9SA 2AKAB 3K0AA 4D4KA 1NN0A 1OT3A 2G88A 1NN5A 1GG2A 4ILEA 1NN3A 1US8A 3AP3A 1E0SA 1EFUA 1T6NA 4RD6A 2ZYUX 1PJRA 2GEUA 1W0KA 4D81A 5BN3A 3WNBA 3B13B 4RD3A 1VPLA 5HKKA 1GUAA 3U6BA 3IUYA 1HH4A 5TXGA 5B30A 3RANA 2O52A 3RS3A 2B7CA 4US2R 3TUZC 3MAAC 4A2WA 2VP0A 1Z6GA 3HYRA 1HY3A 3ZJYA 4ACBA 5CYPA 2GF9A 2EFCB 1CBUA 2WOJA 1MABB 1E2IA 2XZPA 3KTAA 4LC1A 1M6NA 4B3XA 5DLQC 1W36B 3VFDA 1TTTA 4HZUB 5C18A 1ESMA 2ZI5A 1E99A 2ZE8A 4FCWA 4C2TA 4YMWA 2IEZA 2OBNA 2CL0X 5FUVA 1MT0A 1OHHD 2EFGA 3AVXA 2GXSA 2QAGA 4NHOA 1HEIA 2C2HA 3FMIA 1II8B 4JVLA 5GVRA 4JLKA 5CIWA 5AUNB 1YZKA 2CNWA 3EPJA 3BFKA 1UEIA 4PO8A 4PZYA 5KPJA 4GL2A 1NMYA 3RS7A 2PZEA 4QOSA 4U7DA 2YWFA 3KL4A 1ZYUA 2TMKA 3SI7A 1AZTA 1M2OB 2XJ4A 4IEIA 2A3RA 1KI8A 1NVVQ 4NE2A 2QI9C 4Z51A 1P5ZB 2AD1A 3NHBA 2VHQA 3W5JA 4QBHA 2F3TA 3QEJA 2ORIA 1KIMA 1EX6A 4QHTA 4C0JA 1JPNA 1VG9B 2DWPA 2X19A 1X8LA 2VP4A 2ATVA 1OF1A 3HDTA 4FMBB 4G5GA 1GDDA 1XPOA 2J0QA 4OQMA 3WYGA 2Q3MA 1DG1G 1R0WA 4XD7A 1FMLA 2FGKA 1XMJA 1XZPA 2MSEB 2HLDA 2OV2A 3LNCA 1RRCA 3QPVA 1OE0A 3B1WA 4Y0VA 4A36A 2XXAA 2QM8A 4UXIA 1UBCA 4FINA 4NYJR 1KSFX 4TLBA 2VP6A 3CBQA 4ZV4A 1GZSA 3OIUA 3ADDA 1U2RA 2WIBA 2WJGA 2GJSA 2ZRNA 5JFGA 2RB4A 3KJGA 2H16A 2K5UA 3GJ4A 3MD0A 4OHWA 2V55B 2OFWA 3KKPA 4LJ9A 1OXTA 4X8OA 2I3BA 4P0TA 3ZVRA 1G20E 3U7FB 1LY1A 4WA7A 1Z08A 2QP3A 4Q21A 5JCPA 1ZD1A 2A5FA 2HT1A 2KJQA 1RZ3A 5KTYA 2XSZD 3QBVA 1EG7A 1S3SA 1XNJA 2ZROA 1Z3IX 2VBCA 3NBFA 3W34A 5EP4A 4A6PA 1RPZA 2Q21A 1NLZA 4L9SA 4LHZA 3O8DA 2W2XA 3P32A 1Q12A 1W0JA 3B1YA 3FDIA 2PJZA 1S2MA 4EIWA 5D3MB 5A0FA 1XBTA 4NCNA 2A5DA 4AYXA 1LF5A 5EP3A 221PA 1AS2A 1KK3A 3CUEF 1W5SA 4OKSA 5AUQA 3FB4A 2HJVA 4D0GA 5CDFE 3GJ0A 3QF7A 4M1KA 1KO7A 5KDLA 2GEVA 5FH9A 1OFTA 3AH8A 2Z6VA 3REGA 1R2QA 2C8VA 3NXSA 2FA9A 1RRFA 3KKMA 3THOA 1FQKA 2BIFA 5EP1A 3JZMA 3WY9A 4EFLA 3AP1A 4F92B 3SC3A 1E2JA 5CYOA 4YDSA 4E09A 4LYAA 2IXEA 2ANCA 1KI3A 2Q0HA 3EZ7A 3T1QA 2ZJ5A 4D80A 4OBEA 1LVGA 5AK0A 4B35A 4ZIRA 3H84A 2J7PA 2QEQA 1XD9A 2IX3A 2DWOA 4AWXA 2ZTSA 2GK6A 4BASA 1G7TA 3A8TA 1HV8A 4URXR 5M04A 2R8RA 2GAAA 4BZXA 4EQ6A 3W6OA 1JR3E 2PLRA 1IONA 4JLMA 1EX7A 3WP0A 1VDZA 2ZREA 4OI0A 4B34A 4Q9LA 2XTNA 2ZRGA 4KFTA 4TL9A 4ZPXA 1ZNWA 1U0LA 1FW6A 3NBZC 4J0QA 4CF7A 3U4QA 3RAPR 3UG7A 5DHFA 1X8KA 2P0EA 4MYHA 4ZKEA 4EPTA 1OB5A 3PEYA 3BFXA 4GFDA 4LJYA 1SGWA 1XP8A 1G4AE 2F9MA 3BOSA 5IK2D 1YZQA 4Q18A 1A5TA 3QQ5A 3V4FA 1G3UA 1S1MA 2ZJ8A 5JJKA 4OQFA 1OV4A 2ZRDA 5FPKA 2GWHA 3DPUA 5CJPA 4PAMA 1OXXK 4DHEA 5TV2A 1CR4A 3PUWA 1Q20A 4NYIQ 2UZIR 4RZ2A 4GI7A 1KZ7B 2AFHE 4R7ZA 3GLGE 3VKGA 4TTRA 4M9XA 2AFIE 1W1WA 4HLQB 3UATA 2YWEA 1WP9A 1KKLA 4G0NA 3KQUA 1QHXA 2OAQ1 2VSOA 1W5TA 3FMOB 3N70A 4NH0A 3X2SA 1PV4A 3GFPA 4JT2A 2F3RA 3OF5A 3RS0A 1YVDA 4HLDA 2ANBA 3AQ4A 2OO7A 4A0RA 3AF3A 5DSZA 4P3YA 2IC5A 1ZCAA 1ZUNB 2IYXA 1OKKA 2ZI9A 1ZVQA 1T8UA 1CJMA 5A5GA 2JJ1A 3MMPA 3U44A 1P72A 3ZZUA 4TWZA 3RWMB 3CNLA 1U0HC 4BZPA 4QGHA 3PJRA 1Z6YA 2HDNB 2ZSAA 5C46F 1NLYA 5EQTA 1CF4A 1S9HA 1OSNA 2NMVA 1QRAA 3L0OA 3SYLA 4Q7MB 3GD7A 3BD9A 3PV0A 3KQHA 1P73A 1OIXA 4FN5A 4HAYA 4TYWA 2GBLA 4AI6A 4K46A 2C96A 4MYCA 1GL9B 5AWFC 2HEIA 1IN6A 2W2VA 2FZLA 1SXJE 1FL9A 3WNDA 3GLFB 3ND8A 2GBLC 4LRWA 1KO1A 1ZCBA 1YZUA 4A0FA 2BWJA 4AKGA 1FOEB 2NTYC 1XF9A 3VR6A 4PHGA 3C7KA 2YNMA 2C95A 5IDVA 4HB3A 3HR7A 3H0KA 1ZC4A 5FR1A 2QSZA 3RRYA 1NSTA 2D74A 3EW9A 4A2PA 1ZC3A 5DYGA 5JLJA 4M53A 4CEJB 4DCVA 1QBKC 5FI1B 2CMKA 3VU9A 1DO2A 4CW7A 2RH5A 5GJVC 4DWJA 1W4CA 3ND9A 4B6FA 2O8EA 3ZQJA 4US1R 3V9PA 3GLHE 3K0CA 1HUQA 2VSXA 3CZPA 4FMDB 4Q9JA 1J90A 1LV7A 3E70C 1GAJA 4RKEA 2GCPA 2IYTA 2R62A 3A1WA 1LS6A 2YC4C 1XXHE 1OJLA 3EIQA 5FOWA 5FBWB 1OIWA 3LAWA 1C9KA 2A30A 3LO5A 2ERXA 2XB4A 1FNMA 5KSOA 2V9PA 1CEEA 4HATA 3H86A 1P9RA 5FPSA 5BW8A 4URUR 2EQBA 5FPYA 4G5QA 1E6CA 4JSTA 4XSGA 1KI6A 4Y0AA 3E1SA 1W4AA 1B23P 3GLGB 5C1BA 3SQWA 3TSZA 1AN0A 3PUXA 2ORWA 1JPJA 3K0AB 4V0OA 4BFTA 2RGAA 2XITA 3K70C 1MKYA 2QL6A 2AR7A 3U44B 5L8VA 2CHQA 4GT1A 3NEYA 4XD7D 4UNPA 3GEIA 3IGFA 1OYWA 5BXQC 2VP5A 4A15A 4L16A 3CNOA 2HLDD 3ETLA 2ZJOA 4LV5B 5FFMA 1XCMA 1UF9A 5EE0A 2YWGA 3SN6A 4Q4HB 4CEIA 3NWJA 4ESVA 4PPNA 4P4UA 1GTVA 1Z6XA 5J40A 3RRZA 3U61B 1XEFA 1W2GA 1RC8A 3WP1B 2ZRFA 4ZDJA 1GKIA 5K8LA 4OHYA 1NG1A 1ESNA 1YRBA 2OE2A 5EJEA 3LY5A 3BH7A 5FOTA 1ZD9A 1W2HA 4PSVA 3THXA 2JLWA 4KU4A 3ASZA 4XTRA 3I72A 5CK4A 4BLPA 1U8YA 3NTUA 4C0KA 1SKQA 5EXTA 3CPJB 4CT4B 4DT1B 3LWNA 3EPKA 4RFSA 3T1VA 1VCMA 2R6GA 4NYMQ 3AKCA 3F5FA 4RD1A 4B3CA 4WOPA 1I4LD 2CK3D 2ZETA 4C3ZA 2AD5A 2V7QD 3FTQA 3THWA 4ITRC 4JZKA 2PCLA 1WRBA 2PH1A 2OFXA 5KSYA 4ON9A 4M22A 1T0JB 2JDIA 5JWHA 1NSFA 2ZI4A 4LX0A 2B21A 2ZYWX 3U3MA 2GAOA 1X1RA 3SJBA 1XPRA 2QAGB 4JL8A 1SVMA 2HV8A 1VCOA 2QM7A 2HYDA 1VG1A 2ZRIA 3A36A 3CRVA 4HB4A 4C30A 3TH5A 4TZ6A 2QZ4A 5JJLA 3AVUA 3WMEA 3I5YA 1CJVC 1P9NA 2QROA 1R5NA 1DADA 3E2IA 1E1QD 2G6BA 3EA0A 2Z0MA 4DC9A 1QVAA 4MGKR 4DEYA 4EUNA 2QNRA 1QHHA 4DSUA 4TYYA 4NCHA 3FWYA 5JWRA 4IVPA 2QBYB 4DDVA 4IFBA 4BWYA 5L3VA 3K70B 2F1IA 3QXHA 2WJIA 3EZ2A 3BWDD 4R71A 2D06A 3BK7A 1FFHA 2C9YA 3OAAD 1N6PA 3MCAA 4HDQB 3O47A 1TEXA 2RGEA 4Q01A 3W5IA 3HU3A 4GOXA 3W90A 1UKYA 4NYIR 1Y63A 3EWSA 4LBWA 2YOGA 5JHHB 3L8YA 4NYMR 1G16A 4I1SA 1N5JA 4QJ4A 2KBFA 4TMVA 3W3ZB 3WBJA 1E9EA 3BBPA 2ZEJA 2Z4RA 2FF7A 3FPAA 3N2IA 3U7GA 4NZYA 4QBGB 3LBNA 2KBEA 5UKDA 5E3HA 3QKUA 4C0SA 5JRJA 3CRQA 4HB0A 2A2ZA 3TK1A 1L4YA 4B75A 2CDNA 4PPGA 4Q1AA 2ZR9A 3X1WA 2D7DA 3B6EA 2FN4A 2OM2A 4PSAA 4C0LA 2ZQ5A 1NVVR 2G9NA 5CB8A 2ZUDA 4TYQA 3VX3A 4A8JA 4AURA 5IRCD 2RAPA 1XZQA 2Z4SA 4JKYA 2ZJ2A 4LBZA 4QJ5A 5DI3A 1G8PA 4UNSA 3AVTA 3B1ZA 3GLGA 1F60A 1FQJA 1FMJA 1KMQA 5TDHA 5E7IA 4PR0A 1TPZA 1DAFA 3C14C 4CEHB 1IXRC 2JJ8A 2PX3A 1MH1A 1BKDR 2EYUA 3HJNA 1SQ5A 2CLDX 1F2TB 4G5RA 4B76A 3BH6A 1KZGB 1BOFA 2D4HA 3ADCA 4TMWA 4TLCA 4ARZB 3QKTA 1YR8A 4M1MA 4YXWA 2QRZA 4FD2A 4HAWA 4UJ5A 1T91A 1ZINA 2ERYA 4URZR 2CVHA 2OILA 2CBZA 1ZM4A 2XOKD 521PA 3X1XA 3T1TA 3IQWA 4DSTA 3HWSA 2Q9BA 3K09C 2H18A 2V4ZA 4GMDA 1QHSA 1OLOA 1DAEA 1PUJA 1F6BA 2QTVB 2C9OA 4N1AA 4TMTA 2WTUA 1KK0A 2IYZA 4PAQA 1DAGA 1NBMA 1G5PA 1W48A 3IPXA 3VR4A 5FOUA 1J7KA 3MWJA 1NF3A 3Q7QA 1G3QA 5BN5A 1KOFA 1ZD8A 4HAVA 1IN4A 4KCGA 4V0KA 3K09A 1NMXA 1JR3A 1G41A 4B2LA 2VLIA 2HT6A 1N2CE 3LVRE 2QGZA 1SKYB 1G9XA 3FHTA 1DO0A 3DZDA 4W5WA 1JAHA 2CXXA 5P21A 4GSYA 3KB1A 3BAFA 1UKVY 3GEHA 4CGZA 1G19A 3GFOA 1U9IA 4TYNA 2YINC 3O8CA 4TLEA 3GLFA 3CH5A 2P65A 5E7JA 1BYUA 2RGCA 1WBDA 4NP6A 4UNNA 2OXCA 4Q1EA 3WHKA 1T8TA 1XTJA 2JA1A 3U7EB 1P2TA 4LHVA 3LRPA 4US0R 2ZITA 5EXSA 4RSGA 2OFOA 1JI0A 3PIRA 2RGXA 3TVTA 4HZIA 2FSIA 1N5IA 2W6ID 1GOTA 2CJWA 4W5JA 4A8JC 1XB2A 4TT3D 2JLSA 4C0HA 4U00A 1EESA 1VMAA 4JKIA 4B48A 2BDTA 2WSSD 2YOHA 4NTZA 3CW2A 5KSPA 3LVQE 1FUUA 5JS8A 2GVDC 2OEPA 4LHWA 2A5GA 1W36C 4A9AA 2CE7A 3W9YA 1SVOA 4M1OA 3EIHA 1S9DA 3OE7D 3DM5A 5AUPB 4FMCF 5HPYB 1E3MA 1XXHB 3DL0A 3RRNA 3SJAA 2HCJB 1ZW6A 2MMGA 4U5XA 5L3SA 4C0QC 2WOOA 1E4VA 1GNQA 2GETA 3V4RA 3OEHA 1GITA 1Q1QA 1CR0A 1CIPA 2G3YA 4Q9KA 3GJ5A 2C77A 2BKEA 3OEEA 1DBSA 3REFA 3NG1A 2QT1A 4BLRA 2XJ9A 3IIJA 5SZJA 2ZS9A 2NQ2C 3ECCA 3LFUA 4LJ6A 2BOVA 2FNAA 2WJJA 1KYIA 1GFIA 2WWWA 2Z43A 1JR6A 1UJ2A 2H92A 2ZRAA 4IDQA 5EE9A 1DELA 2QMEA 4LUCA 3RSLA 4FI3C 4BE7B 1ZUHA 3SNHA 2O0KA 1IY2A 3CF2A 5FBQB 2QN6A 5FL7A 2H17A 3F0TA 2GESA 5CJ2A 5DN6A 2QTFA 1A2KC 4F4JA 4LOAA 2N46A 1BMFD 2BVNA 5CIQA 3D6TB 4ZI3A 1U0JA 4CYMA 1NBMD 2FOLA 1VCNA 1RRPA 5J4LA 3TIFA 4A8JB 1E94E 1XFAA 2CEAA 1XTKA 4BFVA 3SYKA 4M4SA 4PHFA 4NCIA 3FKSA 1NL3A 5J4YA 2H1LA 3TR0A 1Z28A 1WMSA 1G7RA 1SKYE 2G83A 4P33A 2P5TB 4D4MA 3PCRB 4RFVA 3UWOA 1XXHA 1JB1A 3IDQA 1G5TA 2EFEB 2ATXA 5FL3A 2FJUA 3TKLA 5JBQA 5F9FA 4UQOA 1R5OA 2OBLA 5H1YA 2OUKA 5DO9A 5C4GB 4HSEA 2RHMA 1ZU5A 3RYTC 4QRHA 3U3OA 2ASEA 2BBSA 2AWNA 2JASA 2GJ8A 2VYFA 2IWRA 3WRXC 1N6RA 1GP2A 1AS0A 1U90A 5EXXA 4KITB 3IHLA 2IYRA 2ZAMA 1DAIA 5FTKA 4F93B 1Q3TA 1D2EA 1YZNA 3OZXA 3T61A 2XZOA 1UAAA 2D2FA 2WJYA 3PR1A 3CF0A 1Z0AA 5IHPA 1LTQA 4G5SA 3B85A 1KAOA 2NIPA 2IYLD 2PCJA 2ZVQX 421PA 4Q7JB 4AG5A 3DVLA 4DIEA 4D82A 2GCOA 4BLSA 2WJVA 5BYKA 4CEHA 3CNNA 4IRUB 2GXQA 1FTNA 2NGRA 3OAAA 3ICEA 1VCIA 4ZCMA 4JT4A 4M1SA 4JMPA 4Q19A 3CONA 3BB3A 3GP8A 2X1VA 4DB2A 1DG3A 1TF5A 2IWHA 1Z5ZA 3K0FA 3QXSA 3M4YA 4JSYA 4DDWA 2J3EA 2JLUA 1OPXA 3ZS9A 2CHGA 2FFHA 1GKYA 4OQNA 2GJ9A 1IBRA 2XAUA 1VYUA 2FFAA 3EIEA 5JCZA 5AR1A 1KJZA 4C0AC 4B3DA 1Z83A 3DOEA 3D7MA 1QHHB 4KFRA 5KNDA 5LPNA 2R6FA 4MRVA 4EDHA 5FBRB 3KKQA 2C98A 3IIMA 1GM5A 1IM2A 1YZGA 4ZDKA 2NO9A 2GTPA 3LBHA 3CR8A 6Q21A 4RCYA 1AQUA 1KAGA 1CJUC 4Q02A 4JBXA 1L4UA 2Z83A 2ZRCA 1VG8A 1M7BA 1QG2A 3VQTA 4IOJA 4K8OA 3U3JA 5TMPA 3ZYCA 3ZZ0A 1WDTA 1NIJA 2EWVA 5LDDC 1DARA 2BV3A 3CKLA 4CT5A 2H8KA 1YRAA 4HDOB 3CX8A 4Z1MA 4Q4AB 3QPWA 2P3SA 4NU0A 1HQYE 4JLPA 2CVFA 4ESHA 2J59A 4HI0E 5FOVA 4ZDIA 5E7MA 4HUQA 2JLYA 3VKHA 3LLUA 4DSOA 5BWMA 1R8SA 1N6HA 3CRMA 2VIIA 5CM8B 3RWOA 3I92A 1XMVA 1XTRA 5F9HA 1II0A 2FSGA 3AF2A 4YMTA 2AN9A 5HKKD 1O87A 3IO3A 3PUZA 5EUMA 3R7WB 2CLCX 4BRWA 3WBKA 4DLVA 1RYHA 2RMKA 2QRNA 3C5HA 1Q1ZA 4N0EA 1T9HA 4TL7A 1AQYA 2XNSA 1CJTC 5SZKB 2GZHA 2YJTD 1Z6AA 3UMFA 4C7OB 3F8TA 3LLMA 5BYJA 3P1JA 1E9AA 2J41A 4R98A 2IF0A 4LSGA 1EFCA 1G21E 1NG9A 1KO5A 1NJGA 4PO9A 2VO1A 1EFRA 1ONBA 1OH6A 1J2JA 2DFNA 1NVWQ 3AV0B 2BMDA 4KJZA 2QT0A 3K9LA 4MA4A 4QFMA 1W47A 2O5VA 3AF4A 1E0JA 1RRGA 2R9VA 4C0BA 4DBLC 3EASA 1J8YF 2PZGA 1VG0B 3JVVA 4CZ2A 1G6OA 4I1VA 2NO7A 4AC9A 4JVMA 2ZVPX 4E03A 4CRWB 3OFNA 4CIDA 2B6HA 5JEEA 1SXJD 4IXMA 2ZE6A 1SULA 3ZQ6A 1ZAKA 4Z1MD 4LCBA 5FI0B 2JLQA 1VYTA 2VTKA 1YR6A 2BM0A 4I4LA 2OCYC 4NMMA 1XMIA 1AKEA 2F43A 2WWXA 4GOKA 2QMHA 4MDFA 4DUGA 1JR3D 2FX3A 4BGDA 3GLHA 3TVDA 1XEXB 3PQCA 3VR5A 1T5LA 2KSQA 1W4BA 2JJ2A 3DMDA 3EZFA 3VR1A 2A5JA 4KXFB 3TQFA 2E87A 2O8EB 5KO2A 2J46A 3UIEA 4R2HA 1SVSA 1Q57A 3R8FA 1UKEA 1JXMA 3KX2A 4ERNA 3DKPA 2CK3A 1XX6A 3WYFA 3ZIAD 3L2OB 3LQQA 1I4TD 2OLKA 4GZMA 1KO8A 1ETUA 5DE3A 2ZRJA 2GNOA 3QVUA 1XCPA 1ELOA 1KI7A 4YMVA 3MWYW 5IT5A 1S96A 1CRQA 3H4MA 2REOA 4UKDA 5FTMA 4OHZA 1E2NA 2WPDA 3QUSA 3FFBA 1E79A 2AXNA 5DNYB 1U94A 3I32A 3LH5A 1R5BA 1JXOA 2J0VA 2GK7A 4MH0R 4RZ3A 2P6UA 1VTKA 1KMHA 1YR9A 1SVIA 1EWRA 4HUTA 1LB1B 1ZM3A 3ZD6A 3TW8B 1XRJA 4LPKA 2F9LA 2RHDA 1W49A 5JI2E 2ZYVX 3KXLA 2ZSBA 3U3RA 1HTWA 1K5GA 3QKRB 2V3CC 2P6RA 1X1SA 3A1UA 1AGPA 2JJ1D 4ZKDA 3EPLA 4TMKA 5GJCA 4F91B 4FCTA 1TUEA 3T5GA 3OEHD 5IF9A 3LQRA 1JBKA 4TMZA 3ADKA 3HPRA 1H8HA 3KXKA 3HYTA 3T1OA 1GSIA 3CLVA 4MDEA 3P20A 2WV9A 1KGDA 1NMZA 2C04A 4O3MA 2J45A 3NH9A 1KK2A 4S2EA 2W6JA 2J1LA 1KDPA 4U02A 1CRPA 2ZM5A 5J47A 4GBMA 1KKMA 2WAYA 4MGZR 1G3RA 1GWNA 2H57A 3A4LA 4IDNA 3K70D 3DO6A 4PHHA 3HU2A 3FVQA 3FOZA 4A92A 2QY9A 3VHXA 1E9CA 2F1HA 3KUDA 5JWOA 5GADl 2JATA 4EPXA 4KVGA 2D3WA 1F2TA 5DYIA 5HE8A 3ZVMA 1NNEA 4OHVA 3AVPA 4P4SB 2IUUA 4QJ3A 2OAP1 1G4UR 5FOXA 2GZAA 4XWAA 4AK9A 3U5ZB 2NG1A 4BLOA 4Q9HA 2O0HA 2QP4A 4UNQA 4AKHA 1U8ZA 2P5SA 3QEOA 2RGNA 3EXAA 3RS2A 2ZANA 3B9PA 3I3SR 3SE0A 4B44A 3J81k 3FKSD 1MRNA 4DUGD 2NOAA 2LKCA 4RFSB 5KDOA 4KSCA 1R8QA 3AEZA 2O8BB 1E2KA 2D7CA 1XD8A 2CL6X 4Q1DA 3H1TA 2QU8A 121PA 1R6BX 5FTJA 1S4QA 1P2VA 3KXIA 3CB4A 2HUPA 4NL4H 4DZZA 2O8FB 3TW4A 2WZQA 3CH4B 4X8HA 4PQFA 2BKUA 2H5EA 4YXWD 4AY2A 3TAHA 2FPKA 5KU1A 3VR2A 1Z0FA 2EW1A 5C4MA 3U7HB 1DOAA 1BYIA 1U9IC 4BFSA 2R2AA 5CLQA 3T12A 2V6IA 3UPUA 4KHZA 2V6JA 1KI9A 4V02A 2FZ4A 2I1VB 1Z6TA 4M0LA 3K0FB 4LYFA 4JJKA 1I2DA 5ANRB 4LY6A 1EFRD 4GP7A 4QBIA 1XTQA 4HLCA 4A6XA 4RD0A 2HXSA 3LDAA 1ZRHA 3AGQA 1G8YA 4AKEA 3AP2A 3K9GA 5B58C 1E1QA 1S1CA 3NDBB 1OH5A 1F3OA 3PFIA 1V43A 1DEKA 3DOFA 4GMXA 1GNRA 4BEBA 4DB4A 3PITA 4Q1FA 4TQAA 3U6KA 1GKUB 1N25A 5AJWA 4Q00A 2QPTA 2ZU6A 4NCJA 3L0PA 4GZLA 2OG2A 2VL7A 1CXZA 1DTSA 1G5RA 4B32A 3MJRA 3Q85A 4D25A 2J9RA 2XSZA 2W6IA 3AM1A 1G291 4G3XA 4B2IA 3GEEA 4PC2A 4B3FX 1OH7A 4XVRA 4O25A 4MQBA 2WSSA 3TUJC 5JZVA 1KNQA 2JJ2D 1QHNA 1XU4A 3I62A 2W0MA 4IVRA 4NYJQ 3UXMA 2XTZA 2FWRA 1AKYA 1ODFA 1W0KD 4TSFA 1ZUIA 2FPMA 3ICQB 2IYVA 2ZR7A 4PX9A 2O0JA 3KQLA 3K0CC 2PJRA 2XXAB 2G0NA 2OSBA 2YVUA 2J0UA 1OB2A 3GLIE 1KI2A 1P62B 4URYR 1QHIA 2KE5A 4Q1CA 2QG6A 4XJXA 1EGAA 2NPIA 4PANA 1MRSA 4XSHA 5LD2B 2QE7D 2PX0A 2JLRA 3QG5A 5SZIA 4A4DA 2GDJA 1UKZA 1A4RA 1N5LA 3FMPB 4IDPA 2ZE7A 2R44A 5JJIA 3IEVA 3KJIA 4LHXA 4DDUA 4IFEA 1NKTA 4LWZA 4HLUC 1WXQA 3PUYA 5G53C 2SHKA 3GQBA 3SHWA 3EX7C 4L9WA 4HAZA 1KDTA 3EWAA 4BFUA 5KNBA 1M8PA 1OHHA 4JYCA 3SEAA 3L8ZA 2Q3HA 3Q5DA 1E2HA 3TAUA 1KNXA 2PT5A 4BEJA 4OJQA 3PEUA 3R9XA 2MSDB 1G8GA 2VF8A 4QXAA 4DLRA 1Q1EA 1Q22A 2ZE5A 3Q7PA 4RJLA 5IK2A 1CULC 3AF0A 5L3SB 2C78A 1QDEA 4MKHA 4TTPA 4QNMA 1AIPA 3GJ8A 2FDCA 1R10A 1ZNZA 3AKYA 4P4SA 3DEFA 4DLYA 3BJIC 1SHKA 2IHYA 4KYUA 1D9XA 2ZUBA 4DCTA 2XB2A 5G41A 4BZQA 1ZIOA 1PVOA 4JLVA 2CLSA 1QHGA 4LJ5A 2FH5B 3ZIAA 4KLZA 4OJKA 2CCJA 2ZRBA 4V03A 3QXXA 2AK3A 2W0SA 4JLJA 1GNPA 2IL1A 1HURA 2A5YB 4CVNA 1RJ9A 4BLTA 2OLJA 3IBYA 1G7CA 3LXRA 3V00A 4PSKA 3T34A 2ZR0A 4LYHA 5KYKA 5L3QA 5KDDA 1G17A 1O3YA 4IW3B 4YDHB 2LWIA 4IOKA 2QORA 5DH9A 4RVCA 3PUVA 4XWKA 5LD2C 1Q21A 1RVDA 5CM9C 4EJSA 2AHOA 4M1YA 1S0UA 5HE9A 4BFYA 1T3HA 1E9RA 4MUAA 3NVAA 2BC9A 1OH8A 2IYSA 2DHRA 1UBEA 5B64A 3RRMA 1CU1A 5BN4A 721PA 1OKKD 1XJCA 4P4TA 5G3YA 2ECKA 2JDID 2NO6A 4G1UC 1E1RA 2BBWA 2GJAA 2ZJAA 2I4IA 3PENA 4B33A 1M7GA 4C2UA 2FSHA 4B74A 2ODNA 4R2IA 2REXB 4O2RA 2C9CA 4EAQA 1M34E 3B60A 5H70A 2VPPA 2VP9A 4BPBA 3OIYA 2CL7X 3QF4A 1ZNYA 3CPHA 3Q5EA 2XZLA 2EVWX 1Z22A 3HU1A 3BE4A 4B3BA 2QENA 4IKEA 1E2DA 4HLUA 4M21A 4QGAA 4Q1BA 1C1YA 3NC0C 1TNDA 3CWZA 3BS4A 4Q5IA 3SFZA 1L7VC 3IHWA 4DIDA 1PLLA 3SYNA 3CRW1 2G1KA 4FXPA 4LV6A 3SHFA 4JJZA 3TR5A 2DFTA 4PZLA 1G18A 4A0GA 2OCBA 1TU4A 2EFDB 1BH2A 3H2YA 1B0UA 1N0WA 3AGPA 1KI1A 5CLLA 5FUWA 4WXPA 5AJXA 4BECA 5JS7A 1R0XA 2WM9B 4PHTA 1NY6A 1DE0A 1HE1C 5EXPA 4EJSC 4D2IA 2WICA 2BEKA 5DN6D 3TRFA 3DZ8A 3OFND 2ZAOA 3KJHA 1MABA 1T3SA 3SFVA 3KFVA 1JAIA 4HAXA 1XEWY 2WKPA 1I4DD 2QMUA 3I8XA 1F2UA 4MRNA 4YQFA 4W9MC 5ELXA 4BFZA 2O8DA 1VHLA 3W8RA 4QM6A 3A1VA 1WA5A 4N3NA 1FTSA 4MRSA 4TTQA 2QQ0A 3QI2A 2N42A 5B2ZA 1Z0IA 4QC2A 2YKGA 821PA 1ZJ6A 3R9WA 1Z63A 3QXCA 3QKSA 4KO8A 3P4XA 3ZDQA 1ZBDA 2G0TA 2BM1A 5JI3E 1P2SA 3I8SA 2IW3A 1GRQA 4GPTA 3OEED 3G0HA 2DCUA 1X86B 4JL5A 5CB6A 1DAHA 1TEVA 2ZYTX 1AJEA 1M1YE 1NVXQ 1NLFA 4E22A 3QXJA 4EPVA 1XJ0A 2IXGA 1DPFA 1LS1A 3ADBA 4FMDF 4C7OA 5HR5A 4OK6A 2Q9AA 2PEZA 3C16C 4KVAA 3RSOA 1LW7A 1JQJC 1E79D 3CF6R 1P7CA 3GCGA 2NPFA 3UG6A 4KFUA 4M2LA 3ZZTA 4QHYA 5H8WA 4TQUS 3WRYC 1G1MA 2WWIA 1IN8A 1WQ1R 1KY3A 4Q4JB 4DCNA 3ZGXA 3KJEA 2V1UA 2G77B 1L2TA 3LA6A 3TBKA 3TSWA 3QIAA 4AYWA 4G5OA 5GVSA 4ABYA 3SZRA 4EJSB 2V7QA 3FHOA 5C2JB 4Q4LA 4W7SA 2J7PD 4NDZA 2WAXA 2IS2A 1GRRA 3LX5A 1X8JA 1W0JD 4TL6A 3O8RA 1DS6A 4KAXA 3X1DA 4JYBA 3MGCA 4LZZA 2Q3FA 2WMNB 1NKSA 4BQSA 4V0ME 1D6JA 1OXSC 3A4MA 4ZCIA 1SVKA 4IDHA 1F48A 1CP2A 1N3BA 1AM4D 4IOLA 1C4OA 2AL7A 1RIFA 1FP7A 1TQDA 2VSFA 2HCBA 1JNYA 3EG5A 1F5NA 4POAA 3RLFA 5AUOB 2XGJA 1TU3A 1LF0A 2DR3A 3RNLA 1KHTA 2YOFA 3HR8A 3K53A 1W36D 3KKOA 1Q0UA 4GOJA 1EXMA 2E9SA 3LW7A 4Q4JA 3GPLA 5E4FA 3THXB 3EC2A 2JCSA 2A7QA 2IHBA 2NO1A 1OYYA 2R6CA 1IAQA 2J0UB 1UDXA 3P26A 1G8HA 2A9KA 1TUIA 1WCV1 1ZP6A 4TL8A 1VECA 3THYA 3PG5A 3TQCA 4IOMA 4NONA 1ZIPA 4E07A 4WXRA 3FGNA 3WXMA 3Q9LA 2XTMA 2RKOA 4WIAA 1M74A 2VRWA 4PO1A 4WZBE 1P4SA 4XOIA 3MG9A 1GL7A 4JS0A 4KYIB 4LBVA 1KK1A 3B82A 2X2FA 3FFAA 1N6OA 3CO5A 4H1UA 2O8CA 3SOPA 1JECA 4NKRA 4O0MA 4HYYA 4WZ6A 1WE2A 4PZZA 2QUZA 2EWWA 1LFDB 4HAUA 4PPFA 5EE5B 1UBFA 5FOSA 4OHXA 1KDRA 2BMEA 2LCFA 3EARA 3IEUA 3K0EA 2UVQA 4Z54A 3BIFA 1NP6A 2CJWB 2EYQA 1R7RA 4MRPA 5TVKA 4LC0A 2Z5FA 4E5UA 2AK2A 2FEOA 1D2MA 5KSZA 3AUYA 3MUFA 1HE8B 3KQKA 5D3QA 5JSZB 3R9IA 1E2PA 4LV8B 2ZXUA 2JEOA 3KZ1E 1W46A 3ZLJA 2O8CB 2VH5R 2ZRPA 5KPDA 2GHIA 1TAGA 1XEWX 3QOFA 2VHUA 1A2BA 3U60B 2P6NA 4IDOA 5L3RA 1HT2E 3TE6A 1FX0B 1MO4A 2F1RA 2ONKA 3U4QB 3EA5A 1ZM2A 1NIPA 3SU8A 4D0NA 4Q9IA 4D0LB 2ZRKA 3CWQA 5EZ5A 1E4YA 4JVNA 2DPXA 4PQYA 2WIAA 4YMSA 5LB4A 2F43B 3G82C 3FE2A 4Q66C 3A6PC 2QP9X 1E0KA 3BGWA 4TMXA 2KWIA 1OFIA 4B6EA 2EFHB 1VIYA 2VEDA 3T15A 5F98A 3MSXA 1IQPA 1NN1A 3DHWC 2BJVA 1KSGA 4B71A 4BFWA 1N6LA 1OFHA 1E2EA 1FPMA 4JLOA 4KSBA 2IK8A 4NBSA 4L15A 4D26A 2ODBA 1E1RD 3A37A 2XOKA 3A58B 2W00A 1AS3A 3PEVA 2IBMA 1ZU4A
chains in the Genus database with same CATH superfamily
3EWIA 3HEMA 2FGJA 5CM2Z 3PQDA 4UVEA 4W8OA 1DJNA 3K8YA 3FRJA 1GRNA 3F6RA 2MJLA 1NDUA 2P1RA 2B1QA 4YYEA 3RR2A 4BMCA 2MYSA 1A04A 2V96A 4MQUA 4A03A 3AIKA 3EMDA 2AOTB 3MRTA 5IVKA 3LUCA 2WYUA 4IWYA 1OI7A 3CRNA 2CYAA 4RDIA 3ATPA 1A7JA 2BF4A 5L4NA 4OOFA 1W5EA 3EXIB 3QYFA 2QQFA 2CNDA 4CKEB 4DM7A 5IF3A 4P1ZA 3RH3A 3CR7A 3F9IA 4I9UA 4M7RA 1I2AA 1SC4A 2J9VA 2UKDA 1M9NA 2WBLC 1JAZA 2WMOB 2QTNA 1XN1A 3DJYA 3MWLA 4JA0A 4Y2UA 1QMGA 3WWZA 5ITZA 3S81A 1WBBA 1CZNA 1A0BA 1G64A 1DBRA 1KMHB 4NEQA 1XDBA 4XWTA 1QTQA 3C63A 4LJ8A 2CXHA 3DOHA 4QOJA 3K9HA 3CSSA 5A6BA 2WWHA 2OBFA 3NO4A 1J0XO 3B5JA 2RGDA 3C41J 4LXQA 4EEXA 2FE1A 3G2NA 4CJXA 2C2OA 1FYXA 4F3CA 5C8XA 1GILA 2PKYX 1A98A 4U6QA 3EC1A 4HFNA 4ZDWA 3BORA 1WF3A 3HNRA 1BE0A 4QEKA 5HZHA 2EKQA 1UXGA 5J4HA 4WW0A 3K6SA 2G3VA 2CN1A 4INJA 5KOHA 3H5IA 1O94A 3TOMA 5AW9A 1DTEA 3K7DA 4HHEA 4Q37A 5C31A 4JY7A 3VVMA 1XTSA 1D1SA 1DGQA 2GPBA 4RSRA 3PE3A 4KPGA 1EDBA 5KMGB 3P9RA 1AMUA 4YC7A 4DKJA 2X6QA 2P78A 3TLJA 3F98A 4HDCA 3TFOA 5H83A 2OYCA 3R1IA 1TO6A 4RY8A 1B8PA 5FP0A 3MPUA 3RRBA 3ZV4A 1LUAA 1USWA 3F5MA 4WWHA 1HT1E 2KB0A 5G1NA 2ISCA 2QA5A 2WG2A 3GAMA 1X3LA 4UJ3A 1W7AA 4NCXA 1X1BA 4BMVA 2NUPA 2PBRA 2PGXA 2O5EA 1WOLA 4MV0A 3R40A 5LQDA 4Q34A 3SWWA 4JIMA 3BD6A 1IEQA 1R15A 5K8IA 3K8QA 3UGOA 2X4IA 2IYEA 1BDMA 3KALA 4I1RA 4ARZA 2VXOA 8OHMA 1ZKMA 3OT5A 3IBGA 3RDPA 4CMEC 4HGQA 4RZUA 4B3GA 1WDKA 1SRRA 5JY6A 2EW2A 4HXEB 3D31A 3GJRA 5DLEA 4EKIA 3ZK8A 3JYNA 1TCCA 5DMXA 1C4KA 1U9JA 3AFGA 2OKCA 3O73A 5K3BA 1HR0B 4OXIA 2Q1TA 5KQPA 1BD3A 4AE4A 3DEZA 1MGPA 3OHMA 3EDCA 2EKPA 5JOQA 2ZT8A 4F38A 1OA0A 5CB4B 1Z6QA 3CS3A 1NBEA 3ND7A 2IYWA 1SUAA 2QM3A 3DDCA 3M9WA 4KE8A 4C0WA 5IDQA 4DT1A 4MTFA 1IXSB 2O1WA 4DJTA 2D62A 3ASYA 3MOGA 1PV3A 5JAMA 3JQ9C 1S8AA 2TMYA 2LSEA 1B8OA 1E8NA 4TLDA 1V95A 2RD9A 2R0QC 1E0AA 4CLDA 4M1WA 1JYSA 3BMXA 3QNUA 1WB9A 4LCEA 2EU8A 3RS5A 1Y6RA 4H4KC 3DE0X 4RHFA 4F4DA 4LRSB 3OPQA 1GQYA 4FOLA 1VHTA 3ZE1B 4DA9A 3RGWS 2VDPB 4DLZA 1BWRA 1N2GA 1TT7A 2CHFA 3KEOA 4EA7A 1ZUD1 3L01A 4G01B 4I50F 2GEDA 2NYRA 3HP1A 1NNUA 5F77A 3W9UA 2B4YA 4OQPA 1V55C 4GWKA 1KI4A 4CI0B 2IPNA 3AESB 4RZSA 1IPFA 3GDHA 3U5TA 2DU8A 2QM0A 3ET4A 2FPLA 4GI5A 1VIAA 3FVTA 4QPPA 4B5LA 3N2GA 4R51A 4CKZA 1YHYA 3B6JA 2VQDA 4KTTE 4TRMA 1UZNA 1EFVB 2X5JO 4HN4B 4M83A 4V3CA 2E18A 5JXJA 1XRMA 1KSHA 4OK5A 2OZVA 4JIOA 4WH0A 2BLLA 4URVR 3ACDA 1TKNA 4CI9A 3BZUA 3NOXA 4RTQA 2OCKA 3AKEA 1YRHA 5LM3A 4NZPA 1NBME 1P1CA 4EW3A 1I5NA 1JQDA 4ISBA 5CNJA 4A2QA 4ZVQA 4YJWA 5JAUA 3T3IA 2V6MA 4INOA 4ZOEA 1CLEA 1IOZA 3C48A 2GYUA 4PRZA 4G4JA 3VHLB 5AW6A 3AVWA 2R65A 4RL6A 2GBCA 2BMJA 2LR0A 4MKIA 3GV0A 1Z8FA 2WTNA 3TOSA 2C03A 3L6UA 2AIRA 2VAVA 3AB7A 2PS1A 2O48X 1Y1PA 3HB1A 4TWAA 1Q83A 3DFIA 4AZ3B 4B9EA 4EM6A 3EGCA 2P6VA 1XWWA 4YMGA 1Y7HA 2FWNA 4J43A 5JZ9A 4MYTA 1AZSC 4L4UA 1S8FA 3BRSA 2EJUA 4YREA 3V46A 3UK7A 2VJPA 4DVGA 5LC1A 4V0LA 2PFSA 2FFQA 1I6MA 2ZTHA 3KL2A 3PC4A 1BIFA 5DP2A 3UJ9A 1A7EA 1WASA 1CR1A 1NYTA 4RK6A 1JB9A 1SZDA 2A0WA 2MYUA 2YMPA 3LV8A 4WX2B 1E1CB 1GVNB 4H9GA 4Z99A 3V1NA 5AP9A 2D0OB 5AKHA 4AF8A 4R8SA 3VNUA 5KYWB 4YV7A 3AM5A 3BDAA 4RMJA 9ABPA 3MAGA 3CIFA 5AJUA 1VHJA 2ZVJA 4X6UA 3HZRA 1YCDA 5HVNA 3V7WA 4OQ4A 1A8HA 3HB5X 4Y1EA 4LKRA 1VLSA 4DV0B 2ZIZA 2BR4A 4O4HA 1J8MF 3OD5A 4L4ZA 4PX3A 3F9RA 3ISVA 2YV5A 1I9CA 3NP7A 3UWKA 2X2EA 4WVFA 2VJLA 5ALLA 1XDGA 3LS1A 1JQLB 3WV4A 5A5FA 4FFBB 3HXPA 5AKLA 3BXXA 1T4GA 2PVPA 1ORSC 4ZEMA 4PZ9A 1LE4A 1VYVA 4IF4A 4E3ZA 2OGSA 3CN7A 2RBGA 3DXFA 2EL9A 3FOEC 1GKKA 1AGYA 1TX4B 1ZGZA 4KQ9A 4D6PA 1KAEA 3VU1A 1CB0A 3CF4G 3KD2A 5EHXA 2I91A 1TZKA 1UFQA 2ONCA 1T2DA 5SV2A 3UMSA 2Z95A 1WR8A 1V3QE 2VDWA 3GLIB 1FMFA 4KODA 3BQMB 4AJEA 1XAJA 3NGMA 1E9DA 1X0VA 3F2IA 4C4TA 2ZZNA 4D43A 1CTQA 2V4MA 4KZKA 1AVOB 5FTNA 4Y6PA 1ZI6A 4GBJA 4JEIA 1L3PA 1UFOA 2NZWA 4RHUA 3RVKA 3RBAA 3O8BA 2JCYA 1D2AA 1RYZA 1QC5A 1V35A 4X7BA 1MC5A 2PAAA 4J0IA 4MK4A 3BGSA 3L0IB 4QNRA 2QSYA 5JECA 1CEYA 1HA3A 3VNVA 1KYQA 2AWOA 3AUXA 2JRCA 3LPDA 4IXNA 5C8YA 2AX4A 1SIOA 1YKSA 1AF4A 1LX6A 1ABEA 4JJFA 1WEKA 1WXWA 2MMCA 3JVIA 4X8MA 3I4LA 5GV7A 3KYJA 3QW0A 2QN2A 3RU9A 5HW0A 3FTFA 4JLAA 3ESBA 3IFSA 4X5OA 2RHCA 4CN8A 4DDTA 3OPVA 1LA2A 2IUSA 2PPLA 4RH1A 4YTEA 2IOQA 1TKCA 3LX8A 1TMKA 3BFJA 3ZVKA 4ECEA 2C4KA 3PA8A 2O8DB 3D8BA 4QATA 2HV6A 2AG0A 4N0DA 1QRTA 4F8YA 2GM5A 4J16A 4L27A 2PPVA 4MA5A 3AUTA 1RD4A 1JALA 4OMCA 5WRFA 3UAYA 4DG8A 2XWSA 4RIFA 1KWGA 4GEGA 4UUMA 4D9CA 3O9ZA 3M6UA 5LDGA 1KVTA 4C3EA 1SURA 4E32A 5ICEA 3T9OA 4R2XA 3E9VA 1EDOA 2JFYA 1R0ZA 1FFAA 1SOVA 5J63A 2LCQA 2HREA 4YRNA 3OQPA 1O9HA 3NVDA 3ASUA 2IT1A 5HWSA 4C3DA 4R6WA 4RGQA 3ABQB 5FB3A 4GXNA 3CCBA 4J7CA 2X14A 4EPWA 3DONA 3HJAA 1O8CA 5IMSA 1N5DA 4Z9IA 3PXBA 1J20A 1J99A 1UC9A 4RWEA 3BMQB 4CTJA 2XT0A 3GMTA 3RRJA 4OL0A 1KTVA 1YTLA 3ZWPA 3E58A 5F5LA 2W58A 5L0JA 2H7VA 3TINA 1YR7A 2X9VA 4D9KA 2XY4A 5A2GA 3Q4GA 4TTSA 2HUNA 2LRHA 1AXEA 1KU0A 5IVIA 1L4KA 1Q92A 1V4NA 1PWZA 1HDGO 4RLFA 1A2QA 1JRLA 3VPSA 3QVZA 2CYBA 4G1EB 5JD6A 1EAMA 3IHTA 2QLLA 3ILHA 4OMDA 4OQLA 3L8DA 3DM9B 3BCRA 1W1UA 2JARA 2W8BB 4Q4HA 3TF5A 3KIPA 3WLLA 5EJGA 3I04M 3QITA 4DNFA 4ZICA 2IVFA 4BNXA 3OJ0A 2ZWMA 1P2UA 1GSOA 4TTAA 4XLTA 1F1JA 1XA3A 1MC8A 3QE0A 2DFLA 5TB5A 2HJSA 1RWMA 2FRVA 2HIAA 1VPWA 1YE8A 3V55A 1XD2A 3LCMA 4IHQA 1ATIA 2TMDA 1RBMA 2VC9A 2F3SA 4RKYA 4WZZA 5D91A 4I8XA 3Q3HA 4MRMA 3E5HA 5AM1A 5BWCA 2PDAA 3LL7A 1BHJA 1JEDA 1Z4LA 3QVGA 1QDUA 5DX1A 5E6SA 4CDGA 4RD4A 4OQYA 5JSZA 4UAVA 1B6RA 1TZ2A 1F3LA 1XVIA 3E9QA 3GXBA 4R1QA 4DCJA 3DZGA 2VYNA 3LDUA 3LL4A 4MOWA 1NVAA 4ZQGA 2HF9A 3OX4A 5HFJA 4OLAA 3ZKWB 2CLKB 3ED5A 1P17A 4I5IA 2HDWA 2GXUA 4URWR 4XVUA 2CJPA 2DFKB 2ZT7A 2PZFA 4JA2A 4KBFA 4XDYA 4RW0A 4FYJA 4QDXA 4OYHA 3ZBUA 2C99A 2YHSA 1GUDA 3MD9A 4IIFA 2GEKA 2YYZA 3WYBA 4NPHA 1NYLA 3CX6A 1TYEB 3WR5A 3EVGA 3NDIA 1NX6A 1E2QA 1HQCA 4FR0A 3JVDA 4CMJA 3IV9A 2X7HA 1BVYF 4P58A 3ZUGA 1H2YA 2NACA 4RVFA 1PW7A 1QH8B 1WDWB 3HRIA 5SY6A 3AVQA 5BORA 1JW9B 1Q0TA 2BW0A 1MV5A 4J0DA 2FR0A 2VTDA 3ESDA 4WAUA 3AF6A 2AQKA 1OLUB 1TQ2A 1WG8A 5AJZA 2LTAA 1YBAA 1Q7GA 1GUZA 2WB2A 2XECA 4GKJB 1KJYA 4J49A 1T8PA 3V6LA 4BMZA 4F46A 1TT5B 1OWNA 4MLPA 4CEIB 2BEUA 2QRVA 5LBIA 3A1SA 4IX1A 4E30A 1L7NA 5CXQA 2GCNA 1A77A 3FSGD 3IBFA 1NXPA 2BCJQ 3EG9B 1D5CA 3C5CA 4FOSA 4ILKA 5K8UA 2YR0A 3GAZA 3RYIB 3E8SA 3GCXA 4MW0A 1RYFA 5IBQA 1ZNQO 3P94A 3L7BA 3FTPA 5FJIA 2WHXA 2C7QA 3GCWA 3TD7A 1VSBA 3B38A 2GA8A 2VP2A 3IBCA 4H18A 3NKVA 3BERA 3JW8A 4JC8A 3ESYA 2PMKA 5IXJA 4R1OA 3D8NA 1G8FA 4X6YA 1IJFA 5YASA 7MDHA 2P4UA 3DJUB 1QTNA 1E9BA 1LGYA 1Q7RA 1T15A 5KYUA 3E5NA 1UPBA 4IJMA 3OQMA 3ZD9A 3MT0A 3NBXX 1CWUA 4ZI2A 3GGOA 4LX8A 3LOQA 1X3SA 1IZZA 3PFNA 3NC1C 5ECWA 2G1JA 5SICE 4LE1A 1DFIA 3U56A 4J94A 3HY3A 3UJ6A 4BNDA 4BNNA 2Y0EA 1RW4A 3F96A 2IQIA 1TE2A 4QL3A 2G76A 1NZJA 2ZPTX 4YJHA 3T06B 2UXDB 3FUTA 1P2DA 4XFKA 1Z18A 1BC5A 2BZSA 3GMDA 4JGGA 5DBEX 1R6DA 2NO0A 4BMYA 3SJCA 1OWLA 1F2VA 3VSCA 5C1PA 4L8LA 1GDHA 1H6CA 3DT6A 3QX3A 5J5CA 1VK5A 3AY3A 4ZWNA 4A82A 3UCFA 3DE5X 3NASA 3S2EA 1UXKA 2G5TA 4BN4A 1N0VC 1VKZA 1YJ8A 2DFPA 3IUBA 3OQJA 2Q6KA 1TJNA 2GN9A 5GJBA 5DISB 1IB0A 4PSDA 4XFJA 1ULBA 1RFLA 2AH5A 3QVSA 5D5PA 5DXFA 2ZZMA 2OQVA 1DLIA 1WSAA 5FO1A 2GWRA 4O4JB 1K2VN 1E96A 4HL6A 3DMRA 1EPUA 5GOZA 4LYDA 3DMNA 1OQAA 3W8IA 2N1MA 3GJ6A 3KPUA 5B5SA 2HA4A 2P2CA 1D0SA 2QRJA 4LE2A 3GJ7A 1N3IA 2FMKA 2IXAA 3AWDA 4TQGA 2VTBA 3T6BA 4FS8A 2HSJA 4OH7A 1JHMA 1OCEA 3E18A 3MT8A 1QE3A 3ND6A 4BE4A 1YDHA 4N0QA 4C6TA 1QFJA 5ITSA 3NTQA 4JYMA 2WKRA 2NN3C 2NSJA 4NMXB 5E6UA 4GYWA 4JCOA 4DY6A 3JWJA 3LQ4A 2GHQA 2JHFA 3OKFA 3BA6A 1K8XB 2YNMD 1AG9A 2VLBA 2QE7A 3W9BA 4YJ2F 2JHCA 4BE9A 6ADHA 1PR4A 4U2KA 3N6XA 3DBLB 3WDKA 2CJFA 2GRAA 1D04A 4LDJA 3WDSA 4AWBA 4AQ7A 5E0OA 4R3UC 4MAFA 2EIKC 3QJYA 2REQB 4M8KA 4TTTS 3IMCA 1QQTA 2EX1A 1N1GA 1UBHS 4BUJA 4BNIA 3IILA 3RK1A 3BZBA 2WSLA 3C87A 2BMAA 3IMEA 4FYWA 3A6JA 1L7DA 3GGCA 2O5CA 5HGJA 2C94A 2ZUWA 1RHJA 2E85A 5ALMA 5CA0B 5I7RA 4E31A 2XT6A 1J39A 3AR9A 3OZEA 4BNDB 4L6CA 3IDZA 3DB2A 4FDLA 4RY2A 4CV2A 3IQXA 5AVTA 4IP0A 5HCIA 4N6CA 3CNEA 1KI6B 4QM7A 1XAHA 2OD9A 2NXEA 3FXHA 2ZSDA 4R1PA 3N2EA 3Q98A 4IHJA 1SMKA 4NBUA 1JQ5A 2H9IA 2OCAA 5B1EA 2GM4A 3OESA 3V8RA 2WVNA 3A26A 1XQ6A 3MCTA 1WAMA 2VXBA 4EYGA 4LY9A 1RKEB 4EHFA 3DTVB 3D81A 3UKDA 3FPLA 3VR5D 3K0KA 2DBYA 3M6AA 4H7IA 5DX0A 3U49A 3W3AA 4KGVA 1GTRA 1CFJA 2WTXA 1P4RA 2DB4A 3N58A 3JQ8B 1OZ0A 3CEJA 4H2DA 2FCAA 3INYA 1RKBA 3Q8XB 5K45A 4II7A 3THRA 3LY9A 4MKGA 3OQBA 4QU9A 4E88A 1II8A 1OI4A 2JBAB 1CR2A 2WF6A 4M63A 3NYLA 2BFCB 3PXEA 3Q2IA 4ER5A 1VPVA 3C8GB 4H60A 4EB8A 5I7EA 4GRAA 1NVUQ 4DIKA 2AN4A 2X77A 1ORDA 1GV0A 3MJHA 3N53A 3OE5A 4FIDA 4QTZA 5FR2A 4YL0A 4C22A 4FEAA 3UGQA 1H1TA 1CS4C 4KC0A 1VJRA 3FBGA 2QPAA 1J22A 2WJ3A 3CLHA 1N3YA 3DF9A 5EQDA 4ZVPA 2F1JA 4FWIB 2P2GA 4JLBA 3R3UA 4AXXA 4TLAA 1I32A 1SOAA 2NYUA 1Z73A 2WHQA 1GUBA 3NCTA 4Q82A 2BISA 4GP6A 1A4IA 2IE0A 4TT3A 2J09A 2OK7A 3HU5A 4K3UA 4UE6A 3RTDA 3KQVA 4DEXA 5BV7A 1NF8A 3EEIA 3B9QA 4AUKA 1HDXA 4IEEA 2PX5A 3ELDA 4CNBA 5I45A 1K63A 5L0HA 4KK4A 1XA4A 2HWWA 1CR6A 1Q3HA 3QEMA 3EQ7A 3RTGA 4AD8A 2IEBA 4HNHA 1EXDA 4AS2A 1E9SA 3V34A 1D1BA 4ZU3A 4L73A 4P5DA 4QE3A 4ZXPA 3SJ7A 3PIDA 5HS6A 5G02A 1MDFA 3ZW9A 4DADA 5FEMA 1GUFA 1J09A 3OPYI 3LT1A 1NN3A 2Y3DA 2Q8NA 1PVVA 2FW6A 3DUFB 4ILEA 5EKDA 1E0SA 5BUSA 1M76A 1T6NA 1DINA 1XRLA 2R7TA 3K1IA 1MORA 2JKYA 1GGMA 3BSSA 3O2JA 4R3NA 3V2IA 3ZWYA 1KH3A 3S29A 2NU9B 3UAWA 2YVQA 4D81A 3KV1A 4ZZ0A 4RD3A 1MQVA 1VPLA 1GUAA 3BGIA 3HKEB 4Y2QA 3K4PA 3MIZA 3WMRA 3OZBA 5BMVB 1BQ3A 1D2GA 3LKVA 4ZQCB 3AL2A 3PCTA 3TUZC 2VG8A 1BU8A 2HXGA 2G5PA 2VWHA 3CUYA 1MN6A 1UP4A 1H4TA 2C31A 2QRGA 3MAAC 3W06A 3IRUA 4ZREA 3HYRA 4UCFA 2HA7A 3ZHYA 2UZ1B 5CYPA 4KWEA 2V3VA 4U2BA 4BZZA 2WZLA 1W85A 1XLUA 3GLVA 2Q7OE 3WIDA 1PFQA 3KTAA 2PUDA 3QU7A 4CR6A 2EEPA 5EJFA 5LYJB 3U7JA 3GJTA 1W36B 2A0BA 5DM60 3HEAA 1TTTA 5C18A 5ILQA 1CZHA 2WJWA 4N3GA 3NUZA 1WF6A 3ULKA 3TIGA 2BHSA 4Z4FA 4DRHB 2HRQA 2VDVE 2PT6A 3C18A 4I9NA 4XEHA 4UFNA 3ZIDA 2GK3A 1D3AA 4BAUA 3OZAA 1ZW2A 1TM4E 2D5IA 1MT0A 2R7SA 4BLUA 1OXKA 2GXSA 2H31A 2G4LA 3H5LA 3KR1A 4NHOA 1HEIA 3RT7A 4BN5A 4EY6A 1ZG3A 1MJNA 3JD1A 3RC1A 1JQKA 5I01A 3DW1X 3ANMA 2G40A 3FWKA 2AEJA 3BFKA 1LRJA 3S44A 1TB4A 4GL2A 3NHWA 1GU7A 2DCMA 2YWFA 4EYKA 4LQCA 3QKWA 2OYSA 1DRKA 2TMKA 3HJTA 1M2OB 4NEHB 4P3KA 5CLGA 3P71T 2BGJA 3I6YA 2QI9C 3P2YA 2ZBRA 3O9VA 4WN9B 1E5DA 3JSEO 1YRQA 3IELA 3LZCA 3QEJA 3RUFA 3P2MA 3LHIA 4MVCA 1P18A 2F22A 3JQBA 3JPWA 2XYGA 2OZKA 3OIDA 1EX6A 1WMDA 2P9CA 3GJSA 4C0JA 2CXUA 2QN7A 4MJ3A 2B4AA 5EAIA 4EUNA 5L9AA 7GPBA 4U8GA 3A4VA 2ATVA 1OF1A 3GMIA 3HDTA 4FMBB 4G5GA 4RZQA 1OT5A 4N7RA 1XPOA 2YQ5A 1C3OA 1IWPB 1N0IA 4XD7A 2OEVA 2NSLA 4E15A 1XQXA 2PJDA 1N5RA 1XMJA 3OEOA 1H93A 4BFLA 3BXOA 1CUEA 3DMTC 4MHSA 2SCUA 3I1YA 3ETNA 1TC2A 1F1BA 1ZMTA 3QZUA 4E94A 4UXIA 1B8NA 4FINA 2WFAA 4NYJR 5DTEA 4BJ5C 4I5EA 1KSFX 3FUCA 5TGZA 2ID9A 3TEJA 3WLNA 4CIBA 1BAPA 2DPHA 5ESXA 2D1TA 2HA0A 2AJ8A 3WNVA 1ST3A 4XRGA 1CNFA 1CY4A 1W34A 2GJSA 1R4ZA 2R8BA 5JFGA 3KJGA 1ECBA 4C87A 3GJ4A 3KD3A 3MD0A 3EYAA 2QUBA 1DPGA 3FVRA 3IAEA 3LPLA 3G2PA 4YAEA 2JZCA 3AC0A 3DMFA 2HY7A 1O97C 4RZHA 3SFTA 1L1RA 4DA0A 1QRDA 2HQBA 2XMBA 4L85A 2A5FA 5BV8A 5JZBA 2KJQA 1PJBA 5KTYA 2VJMB 2XSZD 4H4DA 4P9FA 2ZROA 3AJRA 1Y33E 3GB9A 3FBWA 4O6VA 4CKXA 1GRCA 4LHZA 4P6VF 3O8DA 2AXEA 1XKLA 1Q12A 1W0JA 1CD5A 2CNKA 2W2XA 3INTA 4PZAA 4ZO7A 2ZUTA 1HKUA 2EKBA 2ZQZA 5IJ0A 3E9DA 2QHXA 2G17A 5A0FA 4NCNA 2I22A 5IAKA 1E3TA 5E4JA 1JEOA 1LF5A 1XZHA 2GCEA 3DFMA 2AOUA 2JCBA 1LVKA 1KEPA 2XMQA 1TIBA 4FYHA 1DTWB 1YVIA 1EBFA 1QVVA 1VIDA 1PS0A 2Z5LA 3MT7A 3FB4A 4KVFA 4MUFA 4RYLA 2HJVA 2H51A 4Y2YA 4D0GA 5C5IA 5CDFE 2WLTA 4XPXA 1XSEA 3GO4A 4HEA6 4M1KA 4UAJA 2GASA 1FNTc 2A14A 1UBLS 1R2QA 2C8VA 2P69A 4OG2A 1RRFA 3RD5A 4ND8A 3THOA 4WJLA 1B6GA 1C7JA 1FQKA 5KYWA 2BIFA 5EP1A 4BQRA 3O84A 3JZMA 3UUGA 1GKLA 3O4JA 2BMWA 3ZY5A 2G5CA 3KDPA 3WLSA 5DKFA 5CB4A 3MLGA 3ZH9B 1H22A 5CFLA 1WNFA 4Q05A 4D45A 4E09A 3LP8A 4DMHA 1CGME 1JR6A 3WZLA 1JHXA 4Y7DA 3T1QA 4J4HA 4RPHA 5DHTA 2R03A 4TTVA 3WJ1A 4MPTA 1KFJB 3B8EA 1KQOA 4OBEA 4YNBA 4WBNF 2QEQA 2IX3A 3C6QA 1YA6A 1AV6A 3ETEA 1T9GS 1XTVA 3P0JA 4PW0A 5AOAA 5M04A 1EDDA 1QX3A 1T25A 3QU9A 4V3BA 4B6SA 2PLRA 4AUMA 4PLGA 4YRIA 3WP0A 2XUZA 2WFLA 3DE6X 3IIEA 3KT0A 4QEZA 4UCXA 4Q9LA 1NI4A 2BONA 4FGKA 2A57A 5F73A 3HB7A 3GJZA 4JKOA 1FVOA 2C8KA 1MW8X 1GG8A 3U4QA 5B3LA 2FX2A 2IQ5A 3HHPA 5MGBA 1OB5A 4HYEA 4XTKA 2SECE 3HCNA 3FNEA 1GPH1 1XP8A 3SQWA 3D0OA 4B84A 3E23A 1C14A 1NXWA 2R1TA 1JZTA 1S1MA 3FAZA 4N9WA 5D5HA 4C78A 4R8MA 5JT4A 5E9JA 5EWMA 1ZHHA 5FCDA 5JJKA 2B8JA 2ZRDA 1IH8A 2GWHA 1JS1X 4PAMA 1OXXK 1J2TA 4R83A 3WGTA 3I01A 4KGDA 5EMLA 5A6BD 2J5QA 5TV2A 4COOA 5CIVA 1O94C 5F28E 1V6AA 2UZIR 1KZ7B 3DE1X 4RZ2A 2AFHE 4A23A 4JI2B 3SP1A 4Y9RA 1KC1A 5CFZA 3RK0A 4QOIA 3D59A 2E5FA 4PLYA 1L7CA 1IM8A 1KKLA 3GHHA 3KQUA 3NM5A 3X2SA 1FS5A 3NHLA 5ESDA 1YOBA 2HJHA 5H5JA 1SU6A 4Q0MA 1PV4A 3PEWA 1JE0A 3C1AA 1YT5A 1X1QA 4OIQF 4HLDA 4OF4A 3A9WA 5L0IA 3AF3A 4J7TA 3ESRA 4DPLA 1KZ6A 3IE0A 3VZCA 3WL6A 3NALA 3EMVA 1OKKA 1E77A 2ZI9A 1UIRA 3KR2A 3QE9Y 2IS6A 1T8UA 3BA1A 4GP9A 4TT8A 1NTRA 5A5GA 3HTXA 1JVSA 3R9XB 4EVIA 1CX9B 2VYND 2M6RA 4UDNA 1L7OA 1Z5UA 2FWAA 4YP5A 1PTJA 1DOVA 5I51A 1L1FA 1JWAB 1YCGA 4BV2A 4ZHQF 1FBNA 1P72A 3FTNA 2BRUA 2YH2A 3L18A 4GLFA 1HEUA 5JD4A 3U44A 1R4NB 3CNLA 2QVGA 3S2SA 1IDN1 1Z6YA 3ESAA 3DZHA 3JR7A 3LBFA 4UEWA 3ZTYA 4P54A 3ABSB 3OPMA 1AK1A 1XHFA 1GT6A 1OSNA 3NJ8A 1OQCA 2GN1A 1C03A 5TF0A 2YJ3A 4FE7A 2DSNA 4UAGA 2H5JA 3Q8KA 4Q7MB 3KQHA 4FN5A 4HAYA 2FZ5A 3LWZA 4IDGA 2GBLA 1QIJA 3FLEA 5C1DA 4EL0A 4K46A 2L6FA 4EHKA 1FFWA 1ZIXA 1GL9B 5EFOA 3UENA 2MIIA 3SMVA 4G5XA 5CD1A 3MS4A 2W2VA 3L8IA 2CJXA 3CSDA 3S7ZA 1SXJE 4H3SA 4M88A 3GIWA 3SSOA 3GLFB 3FOOA 2GBLC 1KO1A 1XALA 2DSTA 4TN5A 1USKA 1JR2A 1SNYA 2NTYC 3RS9A 1QYVA 3ZU6A 3VR6A 4OIMA 1SUCA 1UWCA 4BKMA 3LPCA 3S0XA 2D2XA 4PAGA 3T0IA 5IDVA 3RK4A 3H0KA 4A2WA 3UBMA 3M6LA 1NSTA 1RS0A 1ZK4A 3ZNOA 1ZC3A 5DYGA 5A0TA 1I0ZA 1SCDA 1CPQA 5CHEA 4DCVA 3J06A 4CEJB 1DO2A 3R77A 5GJVC 4XCXA 4POOA 3PHCA 1CK4A 3IP3A 3TQHA 1E66A 4B6FA 3ZHUA 5I9NA 3V9PA 4BNVA 1LDNA 1HUQA 2OV1A 4Q9JA 3IB3A 3E70C 1THMA 2VTVA 4G1BA 1GAJA 4TXNA 2HH9A 2WHEA 4A7PA 2FFRA 4PQEA 3V80A 3W2HA 1ZR2A 1YFJA 1DWOA 1ZZEA 3V5ZA 4UTOA 1XXHE 2ZW9A 3OJWA 3JD0A 4RIIA 2DOKA 1JKXA 3BGDA 5FOWA 3FNRA 4IVNA 3CAXA 4X00A 4WZAA 5DHSA 1ZJYA 2A30A 3LO5A 4RFLA 2QX6A 1UINA 3USES 2TYSB 1FNMA 4GGMX 1L8AA 3H9EO 3ZG6A 2R8YA 2WNSA 4P08A 4EW1A 2VASA 1CEEA 1PJSA 4N40A 4WINA 4KGXA 5G4KB 2K87A 5M3BA 1V8BA 2FB9A 5BW8A 4URUR 1B00A 3CF4A 3QU4A 3WC4A 1M72A 5K09A 1E6CA 3DUFA 2AX3A 2XQFA 1XZBA 2FGYA 3Q6NA 4PFPA 1KI6A 2Y2UA 1W4AA 2YX1A 3DZBA 1VKHA 1L5MA 3IMFA 1NFNA 3I2HA 3KZCA 4KX3A 4YBRA 5CLHA 4XPZA 4BIMA 1WB4A 5ER9A 1AN0A 4PJMA 3EMBA 1IJKA 3LT0A 1ZITA 1KZYC 4JK3A 1BXRA 3AM3A 5CVUA 2FUNB 4HQ6A 4ZAYA 2PA0A 2XITA 4KLRA 1X77A 1Y3HA 1ZSYA 5CBPB 2Y2VA 4GT1A 3NEYA 2QMYA 3DMYA 1SC3A 4UNPA 3TW6A 3GEIA 4OHBA 1L5SA 5I7AA 2RKWA 4PAWA 4RF5A 5BXQC 1BXGB 1WM1A 4NVRA 3CNOA 4MQ9F 3EGWA 5DU2A 2EPNA 1GG5A 1UF9A 4GE3A 2YWGA 5EE0A 4EGCB 5IS2A 4RK0A 2VUUA 3NWJA 4UU1A 3U61B 3RRZA 4DIUA 1ND5A 1IBSA 4JFAA 2C4MA 2IXBA 2JFNA 2XNCA 4REOA 3WP1B 4AO6A 1RC8A 1TJ5A 4C89A 1ZHOA 5DEIA 3V8PA 1B1AA 3L4SO 3RE1A 1A41A 1ESNA 2XMGA 1L5GB 3A28A 5ICMA 4MVJE 4FW8A 4B4DA 4PSVA 3THXA 1RQ2A 1TCUA 4KU4A 1L5YA 3I72A 4XTRA 4OXNA 5CK4A 4BLPA 1KYYA 3LP5A 1SKQA 5EXTA 3CPJB 3LWNA 3NIWA 4RPKA 4G0OA 5JXHA 4QXQA 1VCMA 4IIVA 2DYRC 2R6GA 4WY8A 1OLXA 4JITA 4BXOA 2J5BA 1I4LD 1IEWA 1JQBA 3O2SB 4NFSA 5TF4A 2I6QA 3LBYA 3OWTA 4ZD6A 3WL8A 4AZSA 5K0JA 5DGHA 4ITRC 1RLMA 4XWJA 1CQWA 1DEOA 2ZB3A 2KK1A 4ENVA 1AUVA 1W1IA 3X2FA 5KSYA 1F06A 4O0LA 1N34B 2QRHA 4M22A 3WI7A 1NSFA 3UO8B 4LX0A 5TPZA 3VU0A 2ZYWX 4N5IX 3U3MA 1NQ5A 2GAOA 3HABA 4E5PA 3JQ7A 1GZHB 2QW0X 4JL8A 5IULC 3F4LA 1SVMA 4YRKA 4WKOA 2FJ0A 2QM7A 2HYDA 2ZSUA 3A36A 3OOHA 4HB4A 4RY0A 3TH5A 4LF4B 2QF7A 1JZQA 3KQTA 3NTVA 4MTGA 4XI9A 1YC2A 3I5YA 2WSBA 3MMNA 4HDMB 1UFBA 1T3ZA 1GTL1 1R5NA 1DADA 1V2GA 1E1QD 4XASA 3RI3A 2Z0MA 4DEYA 1PN3A 4AULA 3STVA 2UUOA 2QNRA 4DF3A 4X93A 4YR9A 5B7QA 1RHKA 1L4NA 1M6HA 1RWQA 3GK3A 4CR7A 2PSFA 4IVPA 4DDVA 2OCGA 3NMJA 4IFBA 3PNPA 2XDYA 1TTPB 2F1IA 3M5CA 4MR7B 3VHRA 2BKLA 2FOXA 5MN6A 3PHHA 2D06A 4HJXA 2Q07A 4OP3A 1OV6A 1FRVA 2VDLB 2PZAA 3SKVA 5BPFA 2C9YA 1OAKA 1T6ZA 1UQRA 3MCAA 3O7WA 4Q01A 4B9AA 4KE9A 1T5BA 3HU3A 2RC5A 3T4XA 1UKYA 4PBRA 3W90A 4Z6KA 5LOVA 4X62B 4ZT7A 3JWEA 5JHHB 4MA0A 4A73A 1FIUA 3CURA 1XDZA 4UMFA 5LMNB 2WYWA 3FXAA 4FGSA 3O2NA 4B4UA 2XKKA 4TMVA 4CM8B 1WCWA 3WBJA 4AM8A 4K5QA 2ZEJA 4ZYUA 2FF7A 1U0GA 2ILVA 3F46A 2C2KA 3FPKA 2FEPA 4XIYA 3AIIA 1GA1A 3SK0A 2Q6LA 2E49A 4ALJA 2QXYA 1GNSA 2KBEA 4QBGB 4B2YA 3CRQA 4BVHA 5AD1A 3W8HA 1JLSA 1QE0A 5B7GA 5IU6A 4ZO8A 5JXWA 2G6TA 1V4BA 4FBMA 4LTNA 1GPYA 2VZ0A 3VDNB 4BNMA 3BE6A 2AFHA 5BOSA 2D7DA 1R4MA 3WGZA 1XZDA 2XYPA 2HA3A 2OM2A 3WAGA 2ZQ5A 4UEJA 2G9NA 4BCCA 1N33B 2UYQA 4FYMA 4AROA 2ZUDA 2XE6A 3VX3A 3KO8A 2RAPA 1GZ6A 3LSTA 3UEOA 4WGZA 2YW2A 4LBZA 4QJ5A 5DI3A 3UKJA 1G8PA 4B6JA 3RYFA 4P3NA 3QEBZ 1FQJA 1FMJA 1CY7A 2NZ2A 1S3FA 3ANTA 3L9XA 4HDAA 2GAFA 5TDHA 3KAQA 1TPZA 1HRKA 1DAFA 1SQ6A 2E4UA 1V5IA 4RE5A 4MLDA 1IXRC 3DTVA 4CLRB 5C5EA 4CEHB 2PX3A 2WZGA 1X7XA 3EZNA 1Z7YA 4BUZA 3T3GA 4IX9A 4QREA 1VBFA 3V7UA 4E5MA 4P0PB 3LO8A 3BH6A 3FLMA 1BOFA 1Y5NA 2H4HA 4H7FA 1ZYRF 4HAOA 4TMWA 4TLCA 4KOEC 1Z5PA 2R5FA 4CMIA 1N2CA 4TVKA 3X44A 1H3NA 4YXWA 2PO5A 2IHUA 4FD2A 4P84A 1M2WA 2VDRB 4YDRA 4URZR 3X1XA 3I1IA 4Z0TA 3T1TA 3EXEA 3K09C 3AIOA 2IYAA 1QK5A 2PXAA 4GMDA 1QHSA 2R7WA 3OJCA 3NHFA 4F1KA 1O0SA 1AGNA 2O2DA 1B0AA 2QTVB 5D85A 1H5QA 2ZT5A 2IYZA 1DEAA 3OIFA 4GAEA 1NBMA 1DXQA 1W48A 1Z26A 3GNTA 3IPXA 4JLUA 4NS4A 3SR3A 3VR4A 1UPXA 1VKOA 3MWJA 1MB4A 3Q7QA 1G3QA 4XW2A 3UK2A 3TCKA 3GPCA 2J9XB 1KOFA 2YUTA 3L0YA 3KE9A 3SOZA 4PLTA 4HQFA 1YASA 4S1WA 1JR3A 3AZQA 3G7SA 4B2LA 1KYVA 2VLIA 4PM4A 4BXOB 1N2CE 2OCXA