2PX3A

Crystal structure of flhf complexed with gtp/mg(2+)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
258
structure length
256
Chain Sequence
PEPLRKAEKLLQETGIKESTKTNTLKKLLRFSVEAGGLTEENVVGKLQEILCDMLPSADKWQEPIHSKYIVLFGSTGAGKTTTLAKLAAISMLEKHKKIAFITTDTYAAVEQLKTYAELLQAPLEVCYTKEEFQQAKELFSEYDHVFVDTAGRNFKDPQYIDELKETIPFESSIQSFLVLSATAKYEDMKHIVKRFSSVPVNQYIFTKIDETTSLGSVFNILAESKIGVGFMTNGQNVPEDIQTVSPLGFVRMLCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the third signal-recognition particle GTPase FlhF reveals a homodimer with bound GTP.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Biosynthetic protein
molecule keywords Flagellar biosynthesis protein flhF
total genus 72
structure length 256
sequence length 258
ec nomenclature
pdb deposition date 2007-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1380 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2px3A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2px3A02
3BB3A 2O8BB 3EPLA 3FPAA 4M1OA 3VR2A 2RGEA 3AKCA 5EE9A 4DZZA 1UDXA 2ZVQX 2GJ9A 5FOTA 1W1WA 1MO3A 5CYOA 2D2FA 3KTAA 2GZDA 4HDCA 3CF6R 5F9FA 3ZZUA 1FQJA 4TLCA 2QMOA 2EYQA 2G3YA 1TMKA 3E1SA 3CRQA 3FTQA 3PVSA 3ADBA 1Y3AA 3BB4A 4KBFA 3RS2A 3SJBA 1WF3A 4BGDA 3QPWA 4F4CA 2V6IA 5GADl 3GJ5A 2SHKA 2F43A 5M04A 1GRRA 1M7HA 2WWXA 4M53A 5KUTA 5TVKA 3TR0A 1TU4A 4Y0VA 4CEJA 3B60A 2XZPA 1SVKA 5D3MA 5KYKA 1LS6A 1DAHA 4N0EA 4DCSA 4JLNA 3K70C 2Q9BA 3B9PA 1G5PA 4XTCS 1QG4A 1E2JA 2J1LA 2ZS8A 4Q7KA 4MUAA 2J87A 2V9PA 2DR3A 1F60A 3CIOA 1UADA 2BJVA 1AZSC 1DG3A 2G1JA 2P5TB 3NDPA 1AQUA 5A5GA 4X8LA 2QT1A 1ZAKA 2ZE7A 1Z29A 5G41A 2VTKA 2OXCA 3IDQA 3VTKA 4U7DA 4C0HA 4Q4JA 4O3MA 1VHTA 2ZRGA 4MRNA 1I2DA 3KXLA 4G5SA 2O8DB 2DWOA 3A6PC 3MGCA 2IW3A 5AUOB 4A9AA 1LFDB 1VCMA 2XXAA 4BEJA 4B47A 4M4SA 1EXMA 4IVRA 2QBYB 1FTSA 2JLVA 4Q03A 1XWIA 4M1SA 2DCUA 1NP6A 3ND8A 2BBTA 4PPNA 4RD2A 4BFTA 2ZRAA 4DCVA 1EWRA 1TAGA 3AM1A 2WSSA 4B34A 2VLIA 2ZRLA 2ODNA 3I32A 4D4MA 4WOPA 5FL7D 1E9RA 1F5NA 2Q6TA 4MH0R 2FSFA 5F3WB 3BH6A 4KFTA 5D3MB 4NONA 1I4DD 3OIWA 5FBVB 4GL2A 2ORWA 1ZVQA 3Q5EA 2CEAA 3PCRB 3Q85A 4TSFD 3Q7PA 4LX0A 2UVQA 1FZQA 5FPHA 3I62A 4NCHA 2WJVA 5KNBA 2NZ8A 1S3SA 4BQSA 1UBGA 4GT1A 2QENA 4AC9A 1EFTA 5FTKA 5KNCA 1ONBA 1LVGA 4CZ2A 3AVTA 3NDBB 3KJHA 3TBKA 1C4OA 4ZIRA 4BFWA 3AKEA 1U0HC 1YR8A 4M22A 3N70A 3K0SA 1OYWA 4HAWA 4HLCA 3L2OB 1G7RA 3RABA 1QG2A 4PO9A 3EA5A 4FMCB 4DSOA 2OCYC 4LYHA 1WB9A 4CDGA 3AF4A 4QM6A 4OHWA 2HF9A 3I72A 2O8EB 2NO7A 1GNQA 4Q7MB 4PC1A 1B0UA 1M1YE 2PT5A 3KDSE 4B76A 3PEWA 1NBME 1E2LA 4KFSA 2PLRA 4PPGA 4A2QA 2PL3A 4IXMA 3SOPA 4V0ME 5FL7A 1QHYA 4Z51A 2QTHA 3R8CA 2F55A 3FMOB 2QNRA 1N0UA 3FE2A 5B58C 4C7OA 4A0HA 1G7TA 3W5IA 5FR2A 2ZANA 1E9BA 5K8LA 4TSFA 5E7IA 4D80A 5C46F 1XMIA 4US0R 2GETA 3W34A 3W8RA 1KI1A 2HEIA 2C9CA 3B1YA 2IXFA 5AUQA 1LV7A 4ZDIA 1FTNA 2B7BA 2WMOB 1COWA 1Z0FA 4IDNA 2ZU0C 4B3FX 1Z6TA 2EFDB 4XVRA 5KOYA 5FL3A 4FIDA 2C98A 4KFRA 3B2EA 3D7MA 4W5JA 1JAIA 5L3RA 3A1TA 2ZSBA 5DHAA 3AV0B 2O0KA 2D62A 5G40A 2ZI7A 3OZXA 3ZD7A 3T35A 2C78A 2IK8A 4QFMA 3CNNA 3CPEA 4JSYA 4LHYA 2AXNA 1CR2A 2ZRDA 4QJ5A 1UBEA 2NO0A 4YMWA 1QZXA 3ICEA 1KSGA 1HTWA 4QGFA 4RCYA 4TQ9A 1Z08A 4YC7A 2VSOA 2IC5A 1Q22A 5DI3A 1E4YA 1F2TA 1XEFA 1E9SA 4JKIA 4UXIA 3SYLA 3TQCA 1Z22A 4JLKA 3KB2A 2F1RA 1V5WA 5EQTA 5J4LA 2O8CA 2ZI9A 3TQFA 4TL9A 3G82C 2O0HA 2OFOA 1H8EA 2B7CA 3OE7D 4LV8B 1HE8B 4PZYA 2R9VA 2V1UA 2BEKA 1OW3B 4CT4B 1U98A 3DMNA 3UIEA 1SHKA 3CWQA 2BIFA 1G3QA 2AKYA 3MWLA 2W00A 2NGRA 1OXXK 3TSWA 1CJTC 1GDDA 4HSEA 4HAYA 3THWB 3FMIA 3NBYC 3OF5A 2OAQ1 1QHNA 5DNYB 2XZLA 1WXQA 5SZIA 3ZH9B 3VR5A 4TL6A 3A1UA 3IIJA 2W0SA 4OI0A 2IYSA 5FI1B 2BMEA 1ZYUA 1F48A 1NMXA 3K0AA 4O0MA 3AVUA 4KVGA 5TV2A 3KQHA 1DELA 5HZKA 5EUQB 1ETUA 1COWD 4LDJA 3N2EA 1E2KA 2ERYA 4CRWB 4II7A 5IF9A 1W4RA 1NMZA 1TL7C 5FOSA 4JL5A 1NNEA 1M7BA 4Q4HA 2G88A 1XMVA 3AGQA 3FB4A 1NVVR 4A2PA 3LD9A 2IX3A 4RKFA 3X1DA 3C8UA 2ZUDA 5JSZB 3UK6A 1NN3A 4UNNA 2BMDA 2ZI4A 4RY2A 5F9HA 4PO1A 2PMKA 2FOLA 4MGYR 3ZGXA 2HLDA 2IYXA 2GRJA 2UZIR 3BGWA 1GOTA 3M0EA 4D26A 3ONWA 4GFDA 3RS7A 3T34A 4MITA 3B8HA 2IS4A 3NVAA 4RZ2A 5JCZA 3CRW1 1WA5A 5CK5A 1EFUA 3UPUA 4IFEA 5G3ZA 3ASZA 3HU1A 4A4DA 5UKDA 1AZTA 1E1RA 2ZJZA 4QBFA 1P2TA 1SGWA 4LRWA 2GJKA 4Q4AA 5HKKA 4Z54A 2ZSDA 4RD6A 2FNAA 2GDJA 1CXZA 2C5LA 1PLKA 3KKNA 4ON9A 4XSHA 3VX4A 2VF7A 3GJ6A 1NIPA 2ZSAA 1W5TA 1G3MA 4FXPA 3FOZA 2KE5A 1G4UR 3EIHA 2OCBA 2QE7D 5LB4A 3SYNA 1HURA 1W36D 1T5LA 4I99A 2XITA 1IAQA 1N25A 2C9OA 5BN4A 4HB4A 1D2MA 4JLVA 1W44A 4LJYA 1LB1B 3I8SA 1XZQA 1R0ZA 1VCIA 4X8HA 2QSZA 5BYJA 2R44A 4V0LA 4D6PA 5B30A 2REBA 2OG2A 3QENA 3HR8A 3SR0A 2QPAA 2B8TA 1XD9A 4PSKA 3ECCA 2A3RA 2ODEA 1HUQA 4P4SA 3B1XA 5FUWA 1JQLB 5KSPA 3UG6A 1Z5ZA 4MRSA 3RVBA 2N42A 2QP3A 2VP2A 2ZI3A 3RWOA 4B3DA 5BWMA 1M2OB 4UKDA 1TQ4A 4EAQA 1LS1A 4X8OA 1GVNB 4GP6A 1TADA 2CL7X 3O8DA 4OYHA 5H8WA 2P3SA 5FTNA 2CNWD 2OLKA 4R2IA 4ASUA 1R8SA 2WWIA 1VYTA 4TTPA 2O8BA 3MJHA 1ZC4A 3GD7A 1D6JA 2WJHA 4C0SA 1JR6A 4MA4A 1F2UA 1PLJA 4LI0A 1GIAA 3FYHA 3KX2A 4UNRA 1NJGA 1OFIA 4HUQB 5JWOA 1IY1A 2ZR9A 4JYCA 5JFGA 4ACBA 3RRMA 1KJZA 2ZPTX 3L0IB 1J7KA 2DYKA 4F38A 2CL6X 1SXJB 2CK3D 4M1TA 1ZIPA 2FF7A 2GXAA 5CJ2A 1GL6A 1E69A 2V7QA 3DPUA 2F43B 4Q9JA 5FOWA 5J4YA 4ARZA 3THYB 2CCGA 1L8QA 1OSNA 3C15C 1XCMA 4ZCLA 1ZM9A 2VHQA 1GL7A 2ECKA 4UJ3A 2PCJA 2REOA 4AIIA 1Q12A 4KYUA 1S1MA 2VPPA 3W6NA 4RKEA 5CJPA 2OFWA 2FSIA 3PEVA 4M1KA 5TXGA 3LLUA 4AKHA 2JLYA 1EG7A 2IYLD 4QHTA 3KKPA 5EXPA 1FQKA 5KTYA 4X8MA 4PZZA 5LB2A 4QM7A 2WKRA 4OJKA 4CYMA 2BJWA 5FOVA 3ZS8A 3U4QA 3K09C 2QM7A 3SN6A 1B23P 1RJ9A 1ELOA 2HDNB 4ERNA 1N0WA 3O8RA 1N5IA 1W47A 1ZMXA 3TH5A 2XNDD 2MSCB 5DO9A 3KXKA 3UKDA 1ESNA 5JWRA 1E2PA 3K09A 1IM2A 1G5RA 1ZW6A 3WBJA 1MRNA 4DT1A 2QQ0A 3QF4A 5AUNB 2ZJ5A 2J0QA 4ZDWA 4JJKA 3GMTA 4PXAA 1XEXB 1XTJA 4FINA 1ZNWA 4L9SA 5JRJA 2BM0A 1VG1A 1TEXA 1RE0A 3TSOA 4QBIA 3BFKA 5AJYA 1GWNA 2Q3MA 3THXB 4CF7A 4AG6A 1G6OA 1XTKA 1T3HA 2WSSD 3GJ8A 4EPVA 5A4JA 2YC2C 1BYIA 3KQUA 3TAHA 3T5GA 1CRPA 2QQEA 2QAGA 1Z2CA 1XMJA 4US2R 2BKEA 2FN4A 1UEJA 3P27A 2CK3A 2ZJOA 4Q1AA 4V0KA 5AWFC 3ZVNA 1ZP6A 1XEWY 3VR3A 2JGNA 4RVCA 1GKUB 5E7MA 1GRNA 3REGA 3QPUA 3SEAA 4LJ7A 3LBHA 4QL3A 2AHOA 1DG1G 1ZD9A 2RB4A 1NVUQ 3GLHA 1KIMA 4HLUA 5ANRB 1HYQA 2JDID 5JSZA 1E94E 2FX3A 2ZRKA 3SQXA 4YXWD 3X1YA 3SHFA 3CF0A 4QJ3A 821PA 5JWHA 5IHPA 1Q1ZA 3I5XA 3KKOA 3TRFA 4IDHA 3EPHA 4RJLA 2XJ4A 1G17A 1MO5A 4TQUS 3QY0A 3RRZA 1X1RA 2HT1A 5EP3A 4GOXA 1KI6A 1N5LA 1P62B 1A7JA 1P73A 3EA0A 5FPKA 1YZLA 2FH5B 5FPYA 3QQ5A 2ZS9A 1VG9B 1J8MF 4LV6A 3CZPA 3AP2A 3S1AB 4PC7A 3T1VA 3W6OA 3U44A 2Q21A 5J5CA 1JR3D 1PZNA 1N2CE 1RRGA 1U0JA 2A5FA 5E7JA 2CLDX 4QBGB 4PPQA 2PZFA 1EGAA 3KJIA 1FUUA 4EIWA 3EWSA 4G01B 3W6PA 1EFHA 4GDFA 1XB2A 1HY3A 3P26A 4TYPA 1D2NA 4ZI3A 3MFYA 2OCAA 2YWFA 2WICA 1F2TB 3I73A 4EJSA 3CRMA 1W7AA 1EFRD 2F6RA 2RGCA 3HU2A 4B6FA 3QE0A 1RRCA 1Z0JA 3QXSA 4RZ3A 3K70B 3OAAA 4AI6A 3VQTA 1SVSA 3IPXA 4C0JA 2ZXUA 1RFLA 1U9IC 5C18A 1U2RA 1SVMA 1ZUHA 2V6JA 2P6UA 5EE3A 3WBKA 2J9RA 2VP5A 4A0FA 2WWHA 1XEWX 5JCPA 2GXQA 4HB0A 4EFNA 3T5DA 2PJZA 1W0JD 4H1UA 4A8JA 1NIJA 2VRWA 3TLXA 2ZI5A 4PZLA 1P9WA 1UJ2A 2CHVA 2D7CA 2ZR7A 5B64A 3TW4A 2GJAA 1D9ZA 1N6RA 2ZTSA 521PA 1GKYA 4TYYA 4OI2A 5DI9A 5BW8A 4ZV4A 1LW7A 2FPLA 4JLOA 4RFSA 3REFA 4B6EA 2G1KA 3H0KA 2A5YB 4UQOA 3BH7A 3PXGA 2WWYA 4HUQA 2F1HA 2H16A 5DE3A 1X3SA 5J40A 4EJSC 2A78A 2ZI6A 3EIEA 1NSTA 1E1QD 1CEEA 1UAAA 2EYUA 4BFXA 4BZXA 1WBDA 3OEEA 2GEDA 1XXHB 4TMXA 4DCUA 1U8AA 1EFRA 3VX3A 1OXUA 4LPKA 4Q1EA 5GVSA 2W2XA 2BBWA 3FVQA 3GLGB 5HCIA 4FCWA 4PQYA 3NBZC 4KYIB 2D3WA 3QI2A 3VNVA 4EPXA 3IQXA 3U44B 3ZIAA 4RZXA 3MJRA 4NCJA 4DB2A 1Z2AA 1T9HA 2QT0A 1O87A 3UG7A 4JVLA 4TQAA 1U81A 2IUTA 1G8PA 1M34E 3RC3A 1AS0A 2HT6A 1QHSA 3CRRA 3FHCB 4OK6A 4A0GA 5AJZA 4DDTA 2D4HA 2IA5A 4JLMA 5HR5A 3BAFA 121PA 1NLYA 2GK7A 3F8TA 2C8VA 1BH2A 3WHKA 3UMSA 3CNOA 4E03A 5JRZA 3DO6A 2DWQA 4XWAA 2J0SA 1KK0A 2CHQA 1E3MA 3LX8A 3KUCA 2C99A 1JEEA 4A1FA 3U60B 3IPYA 4EQ6B 4Q9IA 4Q9KA 4AD8A 1XPUA 2IHBA 3KB1A 5CDFE 1M6NA 2Z0MA 3BWDD 3LDAA 4NCIA 3DDCA 2GILA 4DLVA 5LD2B 1IN6A 1TUIA 4F93B 2R2AA 3B1WA 4B48A 2QZ4A 4DT1B 2ZR0A 3QKRB 4LYJA 2J7PD 3EPKA 4MRVA 1A2BA 3CO5A 2PX0A 1Q3TA 1SVOA 2WWGA 3FHTA 3U7FB 4KI0A 4RZUA 1CJUC 1SXJC 2H1LA 2ZYWX 2V3CC 1TQDA 4HLDA 3TK1A 3GLHB 1J99A 4BLPA 1GZSA 2PX3A 1R5OA 3QKUA 2HLDD 3HJNA 1YZNA 4Q18A 3KFXA 5AJVB 2F1IA 2QSYA 3VFDA 4CEHB 1MABB 3M1IA 1W36B 5EP1A 4CIDA 2VF8A 1GTVA 5TDHA 3CH5A 5FTMA 4BLQA 1LF0A 1KSHA 1EX6A 4GSYA 1E2HA 1ZNZA 3GJ4A 2Z4SA 4ACAA 1UKYA 1JI0A 2ZRPA 3T12A 2A5GA 2ZRFA 3WNCA 1AM4D 2NO1A 3QIAA 1E9EA 3BD9A 1YE8A 3CW2A 4HB3A 3WNBA 4B2IA 2XZOA 1P9NA 2AWNA 3KXIA 1N6KA 3OEHA 4DLSA 1M74A 1DOAA 3CWZA 4KV9A 2XAUA 2PEYA 1ZUNB 3AGPA 2NMVA 2GJ8A 2IS1A 2OFXA 2QROA 3WRXC 1YZUA 5JJLA 4G1UC 1T91A 1T3SA 1KMHA 1SXJA 2W6JA 4QHYA 1OKKA 3UXMA 2OBLA 3SS8A 2OM2A 1KJYA 1OB5A 3P1JA 4QGGA 1P2SA 5CM9C 2RCNA 1K5DA 3RSLA 1P5ZB 4PSAA 5EXXA 2BMJA 1K5GA 2AXPA 1T3LA 5GJBA 4BASA 1QHXA 3KKMA 1MABA 3RRNA 1VG0B 1F6BA 1G8FA 2CHGA 4LJ8A 4CGZA 2QMEA 1FMLA 1J2JA 1XX6A 3EPJA 3OFND 3C16C 4Q19A 4XOIA 3RWMB 3K8YA 3TNFA 3VR4A 1P3JA 2XXAB 4IOJA 2H18A 2XOKA 1Z63A 2YYZA 1RJ9B 1SVWA 1G6HA 1X6VA 1UM8A 4XD7A 2EWVA 3LVQE 2FJUA 1OH6A 5F98A 1S0UA 4LBWA 2XSZD 2QN6A 3M6AA 2HUPA 2WV9A 2FZ4A 2Z6VA 1FMJA 5FPTA 3AVOA 4MKGA 1FP6A 5JHGB 4JZKA 5IT5A 2C03A 1A4RA 3L8YA 3GLFE 1KDRA 1JBKA 1GNRA 3GEIA 1Z6YA 2CCJA 4UNPA 4K8OA 2W2TA 4B33A 4EPTA 3BERA 4GP7A 5LDDC 1E32A 3GQBA 4P3YA 2JLWA 3GJ0A 3GLGA 1NVXQ 1VHLA 1XRJA 5EE5B 2NG1A 3CPJB 3LNCA 1GM5A 3BORA 1G19A 2V1XA 2ZS7A 3Q72A 3X1XA 1A1VA 3LBIA 4CEJB 2CJWA 4PAOA 4EDHA 3A4LA 5CITA 3ZS9A 5JJKA 2X8AA 4FI3C 4EPWA 1AS2A 1MO6A 2BHRA 2EWWA 4C7OB 4L4UA 3T06B 4TL7A 3ADDA 4WZAE 3IIMA 4GRAA 1S4QA 2ZSFA 4L8GA 2HCJB 3B9QA 4IOLA 4TLEA 1G5TA 2JCSA 4Q9LA 1Z8FA 1C1YA 2CCKA 4JT2A 4A8JC 1E4VA 2C77A 5CDFA 2FFHA 3CNLA 1X86B 1XEXA 3VR6A 3Q7QA 5AJWA 4DDWA 2NIPA 3I4LA 2QP4A 2YJTD 2L0XA 3ADCA 1HT1E 3QEOA 4JVSB 1W49A 4OI4A 1IY0A 4B75A 1KGDA 1OLOA 1II0A 2GVZC 3AVPA 5KHOC 3AVWA 4KO8A 3RS3A 1OIWA 3B5JA 4LC1A 4BUJA 3NG1A 4O25A 1Z6GA 3GLHE 1DTSA 1HE1C 4KLZA 2PH1A 5FBWB 1L4YA 2QAGC 4ESHA 1P2UA 1G3UA 4TTRA 2QGNA 5JBQA 2RAPA 3ZZTA 3A1WA 3H84A 3QJYA 4B2PA 1NJFA 4NMMA 5FBLB 3GLFA 1CJVC 1XU4A 2UZ3A 4IHQA 3NHAA 4KHZA 4AWXA 2YINC 4UNSA 3KKQA 2J0VA 5DH9A 1NF3A 2IEYA 1JNYA 3MSXA 1Q0UA 4C3ZA 3E2IA 4JJZA 3C5HA 2CMKA 1Z47A 4V0NA 3MUFA 2WJJA 1IXZA 4PHHA 5IK2D 3NKVA 4PO8A 4HI0E 1VIYA 4IOKA 3QPVA 3CR7A 1NG9A 3ZIAD 1JR3E 3SQWA 3LRPA 3C5CA 4TLAA 1M8PA 1CRQA 2OO7A 3A1SA 4URYR 2AN9A 2AX4A 4QOSA 4Z8YA 1GUAA 1N6IA 2R65A 1KDOA 2Z43A 2XNSA 3MRSA 3B13B 2YOFA 4XTRA 1G7SA 2FSHA 2F7SA 3RAPR 1KY3A 1G291 4QC2A 1XFAA 221PA 1MKYA 3C4JA 4GMXA 3EC1A 3IILA 2IXGA 1R8QA 3LVRE 1IHUA 2H17A 1ZM2A 1OV4A 1XCGB 2GEVA 3DOFA 3GJXC 2ZRBA 4LJ4A 1ZC3A 5EZ5A 5F2EA 3QVUA 3VU9A 1KI4A 2YVUA 1ZD1A 1VECA 1AS3A 3K0AB 1G41A 1NLZA 2AWOA 1NKTA 1RIFA 4EUNA 1W48A 4DC9A 2YOGA 4WXPA 1G1MA 4LHXA 5FOUA 1SXJE 2ANBA 3TUZC 2KI5A 1QDEA 4HAZA 2ZREA 1SKYE 3W3AA 4C9BA 2ZAOA 2ZUCA 3BFXA 2A5JA 4B3XA 1TTTA 1KZ7B 2VA8A 4Q66C 3W9YA 4OK3A 3TKLA 4OBEA 1T0JB 2KBEA 1LF5A 4IFBA 4V03A 1FP7A 4A6XA 2NPIA 2J46A 1TNDA 4Q1FA 3PUVA 4NP6A 1S3GA 4Z8XA 3KTAB 2XGJA 3MWJA 1II9A 1NL3A 3SJCA 1UKVY 4NYMQ 1OXTA 2HV8A 2HF8A 3QF7A 2DWPA 1K6MA 1QHHA 3IUYA 1UBCA 4LWZA 1S96A 4A8JB 3BFVA 2OT3B 3F3YA 4JS0A 4Q1DA 4B71A 3THXA 2RKOA 4H9GA 4H1VA 4HAVA 4URWR 1DS6A 4UXJA 1G3RA 4Q1CA 4M1MA 5E95A 3QKTA 4YMUA 1AGPA 1KO7A 1Z0DA 4AYWA 1XXHE 4BFVA 2GAOA 4GNKA 1G8GA 4ZDKA 4P4TA 1R0YA 2WBLC 3AKDA 4TZ0A 4TWZA 2BKUA 4LBVA 2FPMA 4RD4A 3U3KA 4WAUA 1P6XA 1AIPA 1XD2A 2FFAA 3B7GA 3TMKA 4AYTA 3VMFA 4R98A 4LJ9A 2BM1A 3DVLA 3QNUA 5D3QA 2ZYVX 3IHWA 3L82B 3NBFA 3QKSA 4Q48A 5KDOA 4RCZA 2YOHA 1JJ7A 2GCPA 5CLQA 4DSTA 3WHLA 1E2EA 5DHFA 2CE7A 4F4JA 2G83A 2XTMA 4MKIA 2G0NA 3K9LA 3AUXA 1UKEA 2YV5A 2ZE5A 1E2NA 2CVHA 1S2MA 3OEED 5FUXA 5TB5A 1IXSB 4P4SB 4S2EA 3UWKA 2P0EA 5JI2E 5TMPA 3ZQJA 2PJRA 1LY1A 3U61B 1JPNA 1G9XA 3D8BA 5IRCD 5EXSA 3A4MA 4EFLA 2ZITA 1G7CA 4JYBA 1FFHA 1T8TA 3I1FA 2JJ8A 3R7WB 4F92B 1RYHA 4BFUA 2OAP1 1D8TA 3I92A 1WRBA 4IVPA 5GJVC 3ZVRA 1YZKA 3EXAA 4BLSA 2BMFA 1E2DA 4DJTA 4ZKDA 2OXRA 3AB3A 3BRWD 2RGBA 3QBTA 4Q7LA 3D6TB 1E9DA 3WNDA 2N1BA 3AP1A 4LHVA 2FWRA 4QNMA 1KZGB 3L8ZA 3PUWA 3WMGA 1N6OA 1TUEA 1VTKA 1XD2B 3NH9A 1XJ0A 5GJCA 3ND9A 1R0WA 4B3CA 3FWYA 2HJGA 4PAQA 5G53C 1XPOA 1DO0A 4FMCF 4OL0A 1AA9A 2F1JA 3CKLA 1YHNA 2C96A 1AK2A 2VYFA 4DVGA 3FHOA 3I3SR 3SDZA 1ZNYA 4WIAA 2VHJA 3NH6A 2FA9A 3U6BA 2OZEA 4M9SA 4NL4H 3BOSA 1FX0B 5KO2A 2KJQA 4BFSA 5JZVA 3RS4A 4OK5A 4CEHA 3T1QA 1N6LA 2B21A 4XVUA 2RGNA 3GPLA 1CP2A 2WKPA 2WKQA 3H2YA 4HDOB 5H1YA 5FR1A 3CRVA 1E2FA 3EC2A 2EW1A 1I2MA 1UPTA 2YWEA 3W90A 1GRQA 4IRUB 4HDQB 2QRZA 4FWIB 1E0KA 1YR6A 3C41J 3IEUA 4O2LA 4WXRA 3PG5A 2NQ2C 4QBHA 1UKZA 2VSFA 2GCOB 3QUSA 2ZRHA 3DEFA 1GFIA 2Y8EA 4PQRA 4JBWA 2XJ9A 1OHHD 4TMVA 3GFTA 2O8FA 4YMVA 3LO5A 1XTRA 5DIFA 1KO5A 4L5BA 4LYFA 1OB2A 2RMKA 3OEHD 1L2TA 3AF0A 1KMQA 3ADKA 3UMFA 1RVDA 4MGIR 3GLFB 5IDVA 1BO6A 1PUJA 1KJWA 2A2ZA 2BOVA 1KO1A 3IBYA 5FPSA 2O8EA 5EJEA 1RZ3A 1M7GA 5L3SA 4MYCA 2OV2A 3CR8A 4GOKA 4DCTA 2ZVPX 1IONA 4D0LB 1OXVA 1ZU4A 4RFSB 4LZZA 1MH1A 1NSFA 1NN5A 2ATXA 4M8NE 1IY2A 4J0QA 1T6NA 1CS4C 4MYUA 2WJIA 1VYVA 1WMSA 2ERXA 1AN0A 5B2ZA 3PEYA 4OKSA 5JS8A 621PA 1E2GA 4FCVA 3P4XA 4MQBA 4ILEA 1E79A 4HZIA 4E07A 2MMCA 2CL0X 3G5UA 3QXHA 1E1QA 2O8CB 1O3YA 3UANA 2PZGA 1WBBA 3P32A 4DIDA 3EWAA 4ABYA 2WTUA 2H7VA 3U7HB 1PV4A 4AY2A 1ZCBA 4R9UC 3NHBA 4NHOA 3QKRA 4WZ6A 4B32A 2BBSA 2LCFA 2Q3HA 1QVRA 4XD7D 4DUGD 4KLNA 1ANKA 1OJLA 1ZBDA 1JPJA 3A58B 1R10A 4ESVA 2XSZA 1U8YA 1OHHA 1XMSA 3THWA 3AF2A 1R5NA 4K46A 3W5JA 5FTLA 1P4SA 2CDNA 4TTQA 4L15A 4GI7A 4BRUA 5FTJA 1Q57A 1W0KD 1R4AA 4B74A 3CX8A 3LH5A 3PUZA 5KSYA 2D7DA 2X2EA 1DAEA 1E0JA 1E6CA 1UEIA 2QM8A 4Q4JB 1G18A 2GXSA 1RPZA 1GAJA 1NRJB 2ODBA 4XSGA 2ZJ2A 1FPMA 1DVRA 1QHGA 4G0NA 4KJZA 2R6DA 5TARA 4BWYA 5H68A 1A5TA 4YLGA 1OPXA 4HLUC 1NMYA 1E2IA 2ONJA 1NN0A 2AFHE 3GJ7A 1WCV1 4Q21A 4WA7A 5AR1A 4Z1MD 1YZTA 2JASA 1R5BA 2ATVA 2DHRA 4OJQA 4C0QC 3V4FA 1X1SA 1JB1A 2RGXA 2JAQA 1QVAA 4RD1A 1CULC 1EX7A 3DL0A 5GJWC 1XPRA 4LHZA 1DO2A 2QRNA 4MKHA 4KITB 5DYIA 1CR4A 2VHTA 1TF5A 2QMHA 2ZRMA 1VMAA 3KQLA 3CB4A 1TEVA 3CX7A 3SHWA 3AVVA 1QHIA 1AQYA 2FGJA 2CNWA 5AK0A 3MD0A 3P4YA 5JS7A 3EZ6A 4NCNA 5BN5A 1D5CA 1YZQA 1N6HA 4JKYA 3EX7C 2RGGA 1EESA 4OI1A 4PHTA 2GKSA 1KI2A 1Q44A 2BEJA 2E9SA 1W36C 2VSXA 1CR0A 2X2FA 4QNRA 4Y0AA 4TYQA 3R7WA 3WYFA 3AP3A 3NC0C 3DHWC 1S9HA 2BVNA 3OE7A 1MV5A 4Q02A 4W5WA 4ZIRB 2CXXA 3TW8B 4PHFA 2IL1A 3Q5DA 2G6BA 3K0CA 1VDZA 1US8A 3HU3A 1TQ2A 4MKFA 4IXNA 3NC1C 3SZRA 2FEOA 3AUYA 3CLVA 2VP4A 4D4LA 3J81k 3CUEF 3KFVA 1HH4A 3K9NA 4HYYA 4MGKR 1YZGA 2EU8A 4N0DA 4DSNA 4F7WA 3PJRA 4LK2A 3OAAD 2ZRNA 4C30A 4QG7A 2J7KA 3MCAA 2ODWA 2H5EA 5JI3E 2GZAA 3MMPA 2FMXA 1TU3A 3RRYA 3W3ZB 3THOA 2HXYA 1RW4A 2O52A 2J3EA 1I4LD 2PZEA 4A0RA 4U00A 2C9YA 1QRAA 1Z07A 3HYRA 5GVRA 2NZJA 2JATA 2JJ2A 4OHXA 2ZJ8A 3TIFA 1U90A 1SQ5A 3N5CA 1XDBA 1XTIA 1ZCAA 4JL6A 3ZVLA 2IUUA 5FBRB 1II8B 2OBMA 3LQQA 3RYTC 3C7KA 2ORIA 4NYMR 1G20E 4DEYA 2WIAA 5J47A 2GESA 3V9PA 2GBLC 3R9WA 5DN6D 3FKQA 4UXHA 1XXHA 3IHLA 2QMUA 2FV8A 2EFCB 1I4TD 4C0KA 2P6RA 2YZ2A 1S1CA 5CLLA 2O8FB 2GEUA 1N0VC 5EP2A 5SZKB 4JMPA 1FX0A 2P6NA 4I1OA 5SZJA 3PV0A 1Z83A 3QVVA 1GNPA 3OFNA 3NBXX 4ZI2A 5A0FA 2MSDB 4CT5A 3EZ9A 1KDPA 2KSQA 3GEEA 2RHMA 4IEIA 3TE6A 3ZD6A 3ICQB 1TF2A 2MSEB 1W2GA 3SC3A 1AKYA 4BLOA 3PITA 4TMZA 2IYQA 2JJ1D 3FFBA 3FKSD 2FSGA 1XJQA 1KOFA 4JBYA 4LYAA 3BBPA 4IEEA 1U94A 2WWWA 4GZLA 1GSIA 4PHGA 2FG5A 2GF0A 2QG6A 2J0UA 2WJGA 4DLXA 4QKQA 5L3QA 1OH8A 4LJ6A 4XJXA 4O2RA 3ZJYA 4I1SA 4BEBA 4TYNA 2QE7A 1K8RA 3SFVA 4FMDF 3WY9A 4G5GA 1H8HD 3IGFA 2A7QA 4KAXA 2IBMA 3VHXA 2GBLA 1MO4A 3LAWA 3GJ3A 4DWJA 4PR0A 4JVMA 3SBDA 3WYGA 4BFYA 2GJSA 2YC4C 2EFHB 1IBRA 4ZO4A 1SVIA 4JLPA 1E99A 4U02A 2VEDA 4DLTA 1XBTA 1S9DA 2GF9A 1NG1A 4PSVA 4EFMA 1YRBA 1P2VA 1ESMA 1GL9B 2Q9CA 1G21E 2OHFA 5AJXA 3X1WA 3PUYA 5LD2C 1OXSC 2OLJA 5KDLA 3VKWA 2JLSA 2J45A 4D4KA 5B57C 3CF2A 3IO5A 5CB8A 3DMDA 4W7SA 2FZLA 1BYUA 2ASEA 4BLTA 4DLWA 1HEIA 4LBZA 2W58A 4UNQA 1JQJC 1Y63A 2IYUA 3BS4A 1OFHA 4YXWA 2HCBA 5KPJA 1JECA 2QY9A 1EFCA 1RRFA 2DFKB 3X1ZA 3TUIC 2DPXA 1G3IA 4MRPA 721PA 4POAA 3U4QB 4B2LA 3ZDQA 4A92A 1W5SA 2BDTA 4LSGA 4MGZR 4EKDA 3LW7A 3B6EA 5KPDA 3NTUA 1DARA 4F4IA 1IN7A 4WZBE 4HB2A 5HTKA 4R71A 1LNZA 3QG1A 1U9IA 1XZPA 1YR7A 1AGRA 2ZAMA 4CEIB 1FL9A 5CB6A 5HE8A 5FH9A 1DADA 6Q21A 4LOAA 3SFZA 3E5HA 2JLRA 1BKDR 1KAOA 3FGNA 4G3XA 1MR3F 1P9RA 3CPHA 4BRWA 1KY2A 5L8VA 4OHYA 4HUTA 4TL8A 3A8TA 1UFQA 4DLUA 4IDPA 4N3NA 2OEPA 1FNNA 2PBRA 3DOEA 4F91B 4RSGA 4DKXA 3GFOA 1D2EA 2GK6A 4WBSA 4BE7B 5JEDA 4C0LA 3I5YA 3NWJA 1U0LA 1W0KA 1US8B 4P31A 1RYFA 4M1YA 3A36A 2B6HA 1KO8A 3MAAC 1ZU5A 2B92A 2HXSA 2WSMA 2F3RA 2TMKA 3R20A 2IWHA 3KL4A 3OIYA 2FDCA 2IUSA 4C0AC 1FOEB 1OFUX 5L3QB 2GVDC 1E96A 2FGKA 1KI8A 2F9LA 3BE4A 5EE0A 3VHLB 2ORVA 2XX3A 1KHTA 3AF1A 4HLQB 4IW3B 2V54A 2QL6A 1GG2A 2VP9A 3JZAA 4LJ5A 4PX9A 2G9NA 2H92A 1PLLA 1W0JA 2LKDA 3F5FA 2ZJBA 3K53A 4QGAA 2XOKD 4QHSA 2DB3A 1TX4B 3CZQA 2VBCA 1A82A 2XNDA 2ZSEA 3HYTA 2IHYA 4FN5A 4XVQA 4D82A 1EK0A 1QF9A 2DBYA 1KDTA 2R6GA 3L43A 4IJMA 2MMGA 2I3BA 4B44A 1DAIA 1R6BX 1OIVA 1A2KC 4KVAA 2KB0A 4M9ZA 3T15A 4W9MC 3LBNA 1DAGA 4A6PA 4EJSB 1JEDA 2Z83A 3QXCA 2IYWA 2XB4A 4TZ6A 1KI6B 4P32A 2WAXA 3U3MA 1Z0IA 2A9KA 1WP9A 1L4UA 1XD8A 3O8BA 4L16A 3OIUA 3TVDA 1ZD8A 2EFGA 1Z3IX 3U3JA 1DE0A 1YJ5A 4JL8A 3GLIE 4NCKA 1W46A 2NOAA 5EE1A 3RNLA 2AL7A 4DBLC 2X19A 2W6ID 3AH8A 1NBMD 3PUXA 4IDQA 1ZINA 1F2UB 3AVXA 1CTQA 2WVJA 2PLFA 1YVDA 3CONA 1KAGA 5DSZA 5EZ6B 4DXAA 1Z06A 2OSBA 2BBOA 3ETLA 3KZ1E 4I81A 3SYKA 4M2LA 2ANCA 2WAYA 3A4NA 1R7RA 4CEIA 3O8CA 2IXEA 1HT2E 3GCGA 4JIMA 4PANA 2WOJA 4C2TA 2E87A 4FCTA 3WXMA 4RFVA 2RGAA 2VIIA 2WZQA 4Q47A 1KKMA 4DIEA 3RLFA 2VQSA 1L7VC 1MRSA 4DSUA 4TMKA 4LGMA 2V4ZA 3AVYA 5K8IA 4WVFA 3K0FA 4DB4A 5BN3A 3DZDA 1JXMA 2X77A 3I61A 3PQCA 4OQMA 4OHZA 5JEEA 1CF4A 1KK2A 3RC8A 2K5UA 3KQKA 4NZYA 2NPFA 4URXR 2ZEJA 4Q1BA 1ZM3A 1Q21A 5E3HA 4QXAA 3VKHA 1II8A 2W2VA 3V4RA 3MLEA 4KSBA 5EUMA 3NXSA 4P33A 3R9XA 3VAAA 3I8XA 3AQ4A 5K8TA 4DUGA 2JIZD 1NVWQ 4BLRA 4BECA 4JVNA 5CK4A 3EIQA 5JMTA 1AJEA 4E09A 4DLYA 3FKSA 4IOMA 3T1OA 4OQFA 1JALA 2ZU6A 1N5JA 2PEZA 4MUBA 3LXXA 4C0BA 4FW9A 2I1QA 1VKJA 3VR1A 1EWQA 1NLFA 2FFQA 2AD1A 4PPFA 1P61B 4LY6A 4A15A 3NEYA 4I1UA 3ZZ0A 1UF9A 4KU4A 3K0CC 1NN1A 3G0HA 3KQNA 2Z5FA 3LW8A 2JLZA 4V0MA 4LC0A 4LCBA 2IS2A 1KYIA 1H8ED 3Q8XB 2GCOA 3K70D 1PVOA 2BV3A 4BZPA 1NBMA 2KBFA 3TGPA 3K0FB 3ZYCA 5IK2A 2ZYUX 5ELXA 1E9AA 1KK1A 3LQRA 2OILA 3QEJA 1P60A 2IS6A 2ZE8A 2OBNA 4MYTA 2C95A 4XH9B 1F3OA 1FNMA 1CBUA 1Q1BA 2ZE6A 1WQ1R 2ZJYA 3QOFA 4TN1A 5BYKA 3HPQA 1ZM7A 4XWOA 2RHDA 1T0HB 1SKQA 4AK9A 3MWKA 3U2QA 2QP9X 3FMPB 1OH7A 2DY1A 2D74A 4P4UA 4M1WA 1SHZA 1YRAA 2FFBA 5H70A 4D25A 4YDHB 4CVNA 1QBKC 1IQPA 4S35A 1VYUA 2IWRA 4EQ6A 2ZROA 2BCGY 4MDEA 1FUKA 1ODFA 3L0SA 1GP2A 2VP0A 4NKRA 4KODA 3MG9A 4URZR 2P65A 4TMWA 3T1TA 5BXQC 4B43A 1YQTA 4Q4LA 3TUJC 4TT3A 2ZJAA 2GXUA 4QRHA 4PAMA 2O8DA 1DEKA 3SJZA 4NTZA 3BB1A 4AKIA 1IOZA 2XTZA 2GNOA 1E98A 3H1TA 4JSTA 1V43A 3A37A 2YNMA 3B82A 4JLAA 3CX6A 2QU8A 3CH4B 4Q7JB 3RS0A 2JIZA 5TY0A 4A36A 3O47A 5HKKD 1BOFA 1XP8A 2CJWB 2R6FA 4PC2A 4DDUA 5CM8B 2BC9A 1CR1A 1E1RD 4HZUA 5KSOA 4JBXA 3LXRA 3SJAA 3LY5A 4KFUA 2R62A 2P5SA 2ZM5A 5JLJA 5J4KA 2QPTA 3H4MA 1KNQA 4NU0A 3ZLJA 1G8YA 2A30A 2Z4RA 2FE4A 2VHUA 4FMDB 3PEUA 4PQFA 2JDIA 2ZUBA 4MRRA 2GAAA 3EASA 4YDSA 1OFTA 1CIPA 4C4PA 1GITA 4R2HA 5FFMA 2H57A 2FEMA 3M4YA 3Q9LA 5KU1A 4KCGA 5FI0B 3RANA 3UMRA 3WYAA 2ZRJA 1IXRC 1N6PA 1Q3HA 1KI9A 1OYYA 1E79D 3RS5A 1Z0KA 1YKSA 1Q20A 3EZ7A 3BK7A 3F0TA 3PFIA 2IF2A 3WP1B 1Z6AA 3Q3JB 2VHCA 2IYRA 3B1ZA 4IVQA 4LHWA 2BCJQ 1NY5A 3GEHA 3RDPA 1ZIOA 2HYDA 3N2IA 1P72A 3TR5A 1KI3A 5FUVA 4TT3D 1IN5A 2JA1A 3DM5A 4NYIR 2G77B 1MOZA 3C14C 3GLGE 2QAJA 4GBMA 3EZFA 2DFTA 4GZMA 3LLMA 2FU5C 3TAUA 2WJYA 3L0PA 5C2JB 2AKAB 3DM9B 2V55B 4CW7A 4QGHA 3H86A 4OQNA 3UWOA 3IKJA 3U7GA 3KUDA 4B73A 1RRPA 4I4LA 2IF0A 2XB2A 4RD0A 1SULA 1VCOA 3HR7A 2RGDA 2VL7A 4NE2A 1X8KA 2J5XA 1G16A 2ZRIA 3GFPA 3U5ZB 2IT1A 4DDVA 3KJGA 4NH0A 2WPDA 3TSZA 2CLSA 1UDWA 4XIGS 3AVQA 1W2HA 2J59A 2GWHA 1UBFA 4FMBB 1S8FA 1DAMA 4AKGA 1JAHA 1VIAA 1SXJD 2J41A 1E9CA 4LJAA 5C1BA 1XTSA 5KNDA 2ZQ5A 4G5QA 3U3OA 1H8HA 2ZETA 4D2IA 4JLDA 4HATA 4B3GA 1NKSA 1T8UA 1E0SA 3EG5A 1N6NA 4D4JA 4PTLA 2QAGB 1QHHB 4P0TA 4N1AA 1OT3A 3P20A 4EPYA 4NPHA 2AD5A 5FUYA 4G5OA 4GPTA 4PFSA 5K8UA 2YHSA 1H65A 4DLZA 4TLBA 5L3VA 1HA3A 3DZ8A 5JECA 1KTVA 3EW9A 1WE2A 1E2MA 2IEZA 3OESA 4K81B 2C2HA 4RD3A 1X8LA 1KK3A 1KKLA 1OE0A 3AF3A 2JLQA 3MWYW 1Z28A 2O5VA 3HP1A 4ZCIA 3BH0A 1JJVA 1BIFA 1DBSA 3D31A 4GMDA 4KSCA 4G5RA 1W4BA 4IKEA 1N5KA 4D0NA 2WMNB 2LKCA 4Q4HB 1R0XA 4D0GA 2I4IA 2D06A 1J8YF 5HZHA 4AKEA 4ZKEA 2NO9A 1CJMA 1VPLA 3TVTA 5FBQB 4XWKA 2G0TA 3HWSA 5DGXA 1XTQA 3WP0A 2HJVA 4C2UA 2ONKA 3NIBA 4YMSA 1P7CA 2WPDD 5EP4A 2GA8A 1HQYE 3RSOA 2PMDA 4U5XA 2VP6A 4B3BA 4JLJA 1YU9A 3WRYC 4LV5B 2KWIA 5BQ5A 3IBGA 3VKGA 4HEJA 2IYTA 1JXOA 4LBYA 2PT7A 3B1VA 5KDDA 3R8FA 3RHFA 3PR1A 5C4GB 3HPRA 3U7EB 3VU9B 3QSYA 4WW0A 3IIKA 1DAFA 1T4GA 2QPOA 2FPKA 3IQWA 4URUR 5HE9A 1D9XA 3LA6A 2H8KA 4PC6A 5SZHB 2GHIA 1XF9A 2RGNC 3EARA 2YKGA 3E70C 4M0LA 4NYIQ 3QF4B 4Q9HA 2RH5A 1CJKC 1NVVQ 3ZQ6A 3AKYA 4D81A 3DKPA 3L0OA 4V0OA 3IO3A 1N3BA 1W4CA 3DKVA 1VG8A 1HQCA 4Q00A 3CM0A 3JVUA 3K9GA 2E1RA 2J7PA 2V8OA 1E9FA 4OQXA 4KXFB 1X8JA 5JJIA 2D2EA 2P2LA 4TLDA 3JZMA 2YWGA 2X1VA 5DN6A 4AYXA 2R6CA 5JHHB 2Q3FA 1ZUIA 1NY6A 1NI3A 3CBQA 2REXB 3D3QA 4Q4AB 3GP8A 3KJEA 3SI7A 5CIQA 4BFZA 3K1JA 4E5UA 2EVWX 3U6KA 1CU1A 3AEZA 3K9HA 1OH5A 2WOOA 4ASUD 3BJIC 3ZVMA 1OF1A 4QJ4A 1J90A 2V7QD 2AR7A 5L3SB 1JR3A 2QA5A 4MDFA 4Z1MA 3BC1A 3NEJA 1C9KA 2JLUA 2UKDA 2WHXA 1ZM4A 3QXJA 4ZCMA 4FWTA 2WWFA 2YWHA 3UATA 3VNUA 1VCNA 2XTNA 3K0EA 2JJ1A 3IEVA 1OIXA 3A1VA 1GILA 1XCPA 4NDZA 2BWJA 3HDTA 4YQFA 1KO4A 2NTYC 3EAQA 4BZQA 4M9QA 1OKKD 3WMEA 2ZYTX 1WDTA 3LV8A 4M9XA 1G64A 1LTQA 5HCNA 2JEOA 2Q0HA 1DAKA 2QBYA 1KNXA 3LFUA 3W8NA 3FMFA 4W5HA 2F9MA 4KBGA 2R8RA 4LUCA 2ZRCA 1RKBA 2W6JD 4NYJR 4URVR 5KSZA 1XNJA 2NO6A 4YONB 5P21A 2PCLA 1YR9A 4FD2A 1CLUA 1ZNXA 4DCNA 1R2QA 3JVVA 4NBSA 2OUKA 2R6AA 2OESA 4Q01A 4LPSA 5HPYB 1E0AA 4TYWA 3ASYA 2VH5R 5E4FA 3SE0A 4DRZA 3GLIA 4I1VA 1SZPA 4ZDJA 1G8HA 2LWIA 2QORA 4PC3A 1IJEA 4V02A 3SBEA 1Q1EA 2IYZA 3PENA 3PIRA 8OHMA 2AK3A 1TF7A 2GZHA 2Q9AA 5FOXA 3B78A 1J70A 1KI7A 3QKSB 1W4AA 3SNHA 1GKIA 4YMTA 5J4HA 1BS1A 3LWNA 2WM9B 4M21A 2WIBA 4EPRA 1E2QA 4ARZB 3THYA 2N46A 2C04A 1IN4A 4ITRC 1U99A 1IN8A 1BMFA 5LBIA 1ZRHA 1KMHB 5DLQC 1PJRA 3BIFA 2CE2X 2ZIAA 4JLBA 2JJ2D 5DISB 4IDOA 2QI9C 4A82A 1DPFA 2QTVB 1CKEA 1TQ6A 3TJZA 1TPZA 4BPBA 3B85A 3OIVA 2B8WA 4TMTA 4AURA 1Z6XA 4ZPXA 4MYHA 3WMFA 1T5IA 3LX5A 4DLRA 4E22A 2CBZA 4JT4A 2A5DA 1SVLA 4A2WA 1MT0A 2AK2A 2J0UB 2F3TA 3U3RA 3FDIA 1U8ZA 3BXZA 1Z0AA 1AKEA 2JLXA 5DI3B 2CLCX 1XJCA 5C4MA 4DHEA 2VO1A 4GOJA 4R7ZA 5DYGA 5EXTA 4DEXA 2QGZA 2QUZA 2GTPA 3R9IA 4AG5A 5CIWA 4B35A 1RC8A 3QG5A 2EFEB 3T61A 5AUPB 2CVFA 2OE2A 2DFLA 4HAXA 2IYVA 4OHVA 5G3YA 421PA 2QTFA 1SKYB 2O0JA 1PUIA 2DFNA 1FW6A 5LPNA 4HZUB 1P75A 4OQLA 5CYPA 1BMFD 4Q5IA 2XEXA 2I1VB 1G4AE 2HYIC 4US1R 1Q1QA 5J4VA 1KSJA 4L9WA 3V00A 1KSFX 3QBVA 2OCPA 4NYJQ 2W83A 3EZ2A 2W6IA 2GCNA 2W0MA 2P67A 4UJ5A 1ZJ6A 2AFIE 3GLIB 2IYYA 3X2SA 3FFAA 1IJFA 3OHMA 1HV8A 3S1AA 2QEQA 3QXXA 4HAUA 2EQBA 3SU8A
chains in the Genus database with same CATH superfamily
2D13A 3DLCA 3PC4A 4G8JA 3KKLA 1XKTA 2O8BB 5I5EA 2PA0A 3EUFA 2HSQA 1BHQ1 1KOJA 3UUFA 1KOGA 3EXIA 2RGEA 3AKCA 5BYBA 4DZZA 1EAYA 4PLPA 1WD5A 3IEPA 1MO3A 4MOWA 4R16A 2PZJA 5CYOA 2D2FA 3HP7A 4IJQA 5AKKA 3NTRA 3CF6R 1JKXA 2XCOA 3EMKA 5EJ8A 1KJIA 1Y9EA 2FPIB 4TLCA 3A6HA 4EYOA 2RBEA 3GUYA 2WQ7A 1HZZA 3COWA 3DDSA 4NFLA 1SHJA 4EUHA 5ITSA 2G3YA 1TMKA 4FS8A 1GZHB 2EL7A 1U0TA 5MN4A 1Y3AA 3BB4A 2V58A 4NARA 3BMCB 2P68A 3KQOA 4HWSA 5ARCA 3SEZA 4DDMA 5M34A 1WF3A 3SXUA 1XPJA 3QFTA 4P7FA 2FLVA 2VWGA 4RABA 3PLNA 4BGDA 5GADl 3VJRA 1GRRA 1M7HA 1QYCA 3FRHA 4M99A 3JZIA 4X6YA 2I8CA 3R4VA 1RYYA 3TQHA 4Y0VA 2HZBA 3T7TA 3AESB 1YOBA 5B7QA 4FC6A 1WCWA 2XWSA 2OD2A 5D8DA 5D3MA 3HBFA 4RHXA 3STYA 2PAAA 3DZKA 1T9DA 4N0EA 2LW7A 1P4RA 2VF5X 5BV8A 3Q87B 2QJTA 1P6QA 1YI1A 2P6OA 3H05A 5GZ6A 2AYXA 1G5PA 2AVNA 4XTCS 1OPRA 1PGJA 1QG4A 2J1LA 3KVRA 1G20A 1PV1A 1BFUA 2J87A 2V9PA 1H0KA 1UADA 3TX6A 2G1JA 3CEJA 3JZ0A 3NDPA 4P0PB 2GNPA 1RBZA 4N6GA 1AQUA 3Q7GA 1FRZA 2EFYA 1D03A 5DSTA 5L0JA 2QT1A 1CB7A 4GYYA 4Z49A 2OXCA 2XB9A 3FI0A 3IDQA 4C3UA 5KKAA 4C0HA 5KX5F 2C4VA 4L8WB 1URPA 1U7OA 1HDCA 4O3MA 1ZJWA 4WLOA 4GQHA 1QC5A 2C3MA 2ZRGA 1FMFA 2A1UB 3PHF2 1AURA 4H6PA 4FNGA 2JFWA 3KUUA 3Q40A 4AF7A 3GT7A 3W5SA 2C1ZA 4RKWA 3A6PC 3KT6A 1Z74A 2PD6A 3NHWA 4F86A 2O8DB 1VP9A 5DN9A 1TT7A 4I4IA 4A9AA 1YFLA 2QLFA 4QOJA 3V32A 4UOZA 1FFTC 1L1RA 1H0RA 1ZVJA 4G84A 2HTEA 4MWOA 5ENDA 2QW0X 3O4RA 1D3AA 3MWEB 5GP1A 3ND8A 1HE9A 4YASA 3IXMA 3V8EA 1PAUA 3RJMA 5KBYA 1XQ9A 2OHIA 1MIOA 1EWRA 1TCVA 2Q4DA 2Q6KA 2QTGA 1CLEA 2YZMA 4LF6B 5HDQA 1EDDA 1EYZA 1F14A 1ISGA 1QG0A 2HQ1A 5DK6A 3UT0A 2VLIA 2PGIA 4B34A 1HDZA 1QRSA 2CC2A 2B1QA 1MB4A 2Q6TA 1R0BA 4KFTA 5JO9A 5D3MB 4CDAA 3HYNA 2DBQA 2OCGA 4O59O 5FBVB 3VR3D 2AC2A 3WGZA 5EHZA 3GWLA 4XWJA 3GUHA 3C5WP 4IR7A 5LJIA 4LX0A 2UVQA 5IVPA 5L6LB 1M1NA 1JW9B 4EG5A 2QNLA 1YCDA 3DLHA 4ZU6X 4BWFB 2R8PA 4NBVA 3AGUA 3VR6D 5KNBA 2FGYA 2VATA 4P98A 1Q0TA 2QENA 5D3KA 1BHJA 2RKWA 2BEWA 1EH5A 4ZYZA 2WQ6A 1FS5A 3ESXA 4F71A 3U3DA 1SC9A 2P90A 1S8AA 2YHIB 5J9FA 3ZV3A 3ORYA 3PFNA 4H4DA 3FTFA 4I55B 1Y3HA 2JNWA 3AKEA 1U0HC 3Q8KA 3ODGA 1ZK0A 2O1SA 3QTLA 3N70A 3RJ5A 2QDKA 5I4BA 1L8OA 3GHHA 4PYNA 4MR8B 1QX4A 3U09A 3L7YA 1T3TA 3D7KA 2Q1TA 2K87A 1TM1E 4LY9A 3QBDA 3N2ZB 4MLPA 2PU7A 5IXYA 2OCYC 4IF4A 1IB6A 2OFFA 2GLTA 5F51A 5F9MA 4OHWA 2BLNA 5GMOA 2Y99A 1GNQA 3K9WA 1SBNE 4Q7MB 3GFQA 2XDWA 5DX1A 5EZYF 4D9MA 1LSSA 5TT0A 1MW9X 3HYSA 4MI6A 3KJNA 4PYQA 4L6RA 1B15A 2X1LA 4B76A 4ZYVA 3J81k 2PL3A 3SOPA 3WG7C 4LXHA 3O8LA 1JYEA 2OB1A 1Z4JA 3ORSA 4Z51A 4V1CI 4JWKA 2F55A 1QLJA 3IE0A 2NUBA 5AESA 1N0UA 3RVQA 2CKDA 1EVEA 2ZANA 3NGMA 5K8LA 3NIWA 1W6RA 3AU8A 2OYRA 3W34A 3W8RA 3D6JA 1FU7A 1ODKA 1XU9A 5EIBC 4CIWA 4KE7A 3RU7A 3MBIA 2HEIA 1NU8A 1UJNA 2C9CA 3BRWA 1X1BA 4MEAA 4XYGA 1QRDA 4IDNA 3TSCA 4B3FX 2UUOA 2JHFA 3DTVD 4PRLA 4RNCA 4NMHA 2MHCA 4FIDA 5FL3A 5KOYA 2HBZA 4W5JA 2JK1A 4MWTA 2P6MA 4QI0A 3A1TA 2ZSBA 1NAHA 2IZZA 2IQ5A 1CPRA 3BQ9A 3EVCA 3UKJA 1G4WR 3EY4A 5EN4A 5G40A 1VMEA 1QOZA 2R84A 1FC0A 3MF4A 1BX1A 2PXAA 3HFJA 1CR2A 4EHJA 4I50A 5CNIA 1V5IA 2NO0A 1WXXA 4ZFNA 4YMWA 1D1PA 4I46A 3ZDFA 1KSGA 4H7IA 4O5AA 4YRNA 4TQ9A 2HWKA 3LHFA 1OLXA 4HDMA 4YJKA 3EAFA 1V9SA 4AFNA 1PJBA 2OBYA 4H3KB 1QO7A 2IC5A 1C4XA 1UBOS 3G2NA 1QLWA 2K7FA 3SYLA 1JIVA 4PS0A 1IL0A 2JVJA 5JSFA 1WPRA 3M6FA 1CX9B 4NIMA 5D6OA 1IRIA 2F1RA 2OZLB 4FEYA 4DV5B 1C3JA 2X51A 3KEOA 1XMXA 4O4IF 5JAOA 1SZJG 2OFOA 1NQUA 1H8EA 2B7CA 4MPRA 4NS1A 2IBFA 5LLTA 4L8LA 2VHWA 1VIDA 3G5TA 2V1UA 1TGVA 1JVBA 3GU3A 3WB1A 3L7IA 4F92B 1RVV1 5EJMA 5JXIA 3DMNA 3UIEA 4C4AA 2I6QA 3FPGA 3IESA 3KEQA 2ACKA 5CXSA 2AKYA 3AY3A 2W00A 3FOZA 5G0WA 3AG5A 1OXXK 4IDDA 3LLKA 3WX0A 1N7JA 4MEBA 4MK4A 4HSEA 4HAYA 1GN9A 4LOHA 1T6YA 3OFVA 3ZSUA 4OOFA 2DLCX 3DSRA 5IULC 1OV6A 5J23A 2XZLA 4GMGA 2YL7A 4F2WA 3BWCA 3R75A 3A1UA 3IIJA 2W8BA 3ZY6A 1YB7A 4UDXX 4Y2SA 1TD9A 2H4XA 1GHTA 1NMXA 2PD3A 2ZBUA 2V6FA 2F59A 1Z8DA 2XQIA 4MQEB 2QNIA 3OMLA 1ETUA 1ECGA 1COWD 1Z12A 1E2KA 3O6VA 4JY7A 2VWQA 2QRVB 2ZSHA 3TIVA 2B34A 1ZOLA 2QAIA 3DXZA 4K1LA 5E8JA 3HA2A 1W88B 3IAHA 3C1AA 2YS7A 5IWCA 4I4NA 4JXJA 4MUKA 5G1PA 1XMVA 1QS0B 2A9JA 2QSUA 3AF5A 1FVXA 3NM5A 3R0XA 1VHJA 4M9UA 4RKFA 2ZUDA 4C03A 3OLQA 5AM4A 2O3SA 3NRJA 3UK6A 1A1SA 2BI7A 2HREA 1O9GA 2BMDA 1E5LA 1SQFA 4RY2A 2QTNA 5ENVA 4MGYR 1T1JA 1EQAA 4AVYA 3L0IA 3HVIA 5IW8A 5BV0A 1OR2A 3SXPA 1GOTA 2OORA 4ND7A 4EY4A 1XAHA 2CVOA 1B2LA 5EOVA 1DFIA 3F5MA 2CFRA 4GBED 5AOAA 4GFDA 5TJ5E 2Z98A 4C3OB 4CM9D 1QKRA 4JQZA 2ZG6A 4IY1A 5A0TA 1E6MA 2H8GA 4RZ2A 4NZNA 4QLAA 2HJWA 2CXTA 2PTHA 1Q0FA 1EFUA 4EGAA 5AOCA 8ABPA 4CDNA 2V6GA 5FJJA 5M7EA 5AKGA 2ZRQA 4A4DA 1AZTA 1OGJA 1K3FA 2I80A 2JBAB 3B8EA 4BEWA 4X66B 4QBFA 1MQVA 1L0BA 2GJKA 5F78A 2ZUTA 4NTFA 4Q4AA 4X84A 4X3CA 4Z54A 3F1LA 3HVRA 1A5AB 4EB6A 3V8MA 1Q84A 2PPLA 4OHFA 1KBQA 2C5LA 1PLKA 3KKNA 4ON9A 5AI9A 4FVTA 5AVVA 3GJ6A 1WOYA 3KTDA 5GPGB 4UM9B 1G3MA 2QW8A 1G4UR 1NMQA 2OCBA 3EIHA 5JDIC 5C51B 3SYNA 1K89A 1XEAA 1T5LA 4A0QA 3EXHB 4YY3B 4PCVA 4HB4A 1W44A 1P1JA 3I8SA 3H1AA 5CFOA 4CL0A 1MMFB 2QSZA 1GV1A 3BGOS 1VL6A 2R44A 1HDOA 4NZZA 3K94A 4HGNA 1Z7WA 5FBZA 1J0BA 4FE7A 2REBA 3IAM1 4YRLA 1A8PA 2PBFA 3FSGD 3QENA 2CLHB 3U7IA 4LOJA 5I6DA 4G7ZF 2ID8A 3S90A 3HJAA 4D9EA 1XD9A 4PSKA 3ECCA 1LWNA 4NE9A 4QUBA 1GA6A 3HBMA 3BHJA 1GAWA 3HJTA 3MQFA 1QZUA 4J1QA 5ALYA 4YN0B 4KWIA 3GCXA 2I55A 1Z5ZA 2OU6A 3RVBA 2N42A 1J33A 1JPVA 1VL8A 4UKDA 1UMBA 1LS1A 1EGQA 4GP6A 4EY3A 5MHTA 3EXFA 2CL7X 3N8KA 2L7AA 2P3SA 5CDGA 2C00A 3ITFA 3AXTA 4HEHA 1QPZA 4G0UA 1IMJA 1U5BB 3AESA 4R2IA 4ASUA 2R60A 3IAM6 2Z58A 1CGME 4QEKA 2FUNB 1PR0A 4F72A 3N58A 3VH4A 4BUCA 1ZC4A 3GD7A 3R3ZA 1KARA 4RL6A 4DQLA 3KX2A 1TUBA 1NJGA 2ZIFA 1BE6A 3FETA 2HSDA 2PKEA 4JYCA 3ZTYA 3HCNA 2NUPB 5IASA 1KJZA 1ZJYA 2O20A 1G8SA 2DYKA 3LDGA 3R40A 1FYFA 5KWIA 4BWGA 2I7CA 2BGLA 2M9MA 1X92A 3R3JA 3DZCA 4EI7A 1ZIPA 1GPNA 2B61A 1LU9A 2CXHA 5CJ2A 4G7HF 3UTDA 5HJ7A 3QJ5A 3N2LA 3E03A 3CLSD 4YI5A 3PGVA 4IICA 4BWVA 3L0DA 2LDXA 3FHJA 4ARZA 1L8QA 1OSNA 1NOIA 2VPTA 2XE4A 4YJFB 1A9QA 4FZ3A 4K88A 1ZM9A 3MJ4A 3JQBA 4INZA 4JDUA 2C58A 3SQOA 3ZU6A 1VJTA 1X13A 4KYUA 1AN9A 3W6NA 4RKEA 4R6XA 2FSIA 4M1KA 4Q3LA 5KKCA 2ILTA 3GDFA 2JLYA 1NFOA 1MH9A 1EG7A 2ZWIA 4RZIA 3KEGA 3KKPA 1YZCA 4IG9A 5FADA 3L02A 4X8MA 2FTKE 2XMGA 3BF7A 4WNCA 3DFIA 1BDBA 5L0FA 3DE4X 5A05A 3ZWOA 1V1JA 5KWSA 5K0SA 3WLLA 4CYMA 4QM7A 3M15A 1JR2A 3U4QA 3JZFA 5E3AA 4FFWA 3SN6A 1B23P 1U3DA 3ZG6A 4BLUA 1JHQA 1EBFA 1VSUA 1ZA2A 4ERNA 3TSYA 1N0WA 3O8RA 3ZU5A 1MTOA 5TQJA 4RKQA 3NLLA 1WM1A 1W25A 4JQSA 4OIQF 5IUKC 2PGXA 2XF8A 1LVUA 1YV9A 2JCGA 3K09A 1L9KA 4KV7A 4MV6A 5IDQA 2G1UA 1ZW6A 1H3FA 1MRNA 2YIJA 5CFPA 2BKVA 3C48A 3IDOA 1LK0A 3NB0A 4IJ5A 1NUPA 4I5GA 3HVHA 3GMTA 4U5EE 4JFRA 4PXAA 1XTJA 1ZNWA 1BC5A 1AHHA 1RMVA 3RVMA 5LWHA 1RE0A 2DOKA 2IDKA 3IIIA 4QBIA 4Q1VA 3TSOA 5JAQA 3WJ2A 1KR5A 1W75A 4R1SA 1WKVA 1X2EA 2N0SA 2GN6A 2CNNA 3L1KA 2DR2A 2QMYA 3HUTA 4RU1A 1PR3A 1OA1A 1Y5MA 3KVOA 2YC2C 1IG3A 1XR3A 3K1YA 3MXOA 1BDHA 1IWOA 4G24A 5F3RA 3KQUA 3PX2A 4D4HA 5B1HA 2Z8ZA 3GJYA 2QAGA 2JI9A 5KVQA 1A9OA 2XUHA 3VR5D 1WHTB 1V11B 2AKEA 3ZK9A 4US2R 2BKEA 3ZU2A 4ZOLF 2CJYA 1RKEB 2VQ3A 2FXIA 4Q1AA 1Y7IA 4V0KA 4F85A 4EFDA 1I94B 3DVAA 3OT5A 4WFKA 5AWFC 3DP9A 3B70A 2C4UA 1XEWY 2XT9A 4BKRA 3UUWA 4CIXA 4EECA 3H75A 5DTJA 2F4NA 2FW7A 5AM2A 5C37A 2VLBA 2UV8A 5E7MA 1WASA 1PFUA 4WKBA 1PRYA 1EZ1A 4E5PA 2OTCA 2I6SA 3WGQA 2RB4A 3LMKA 1E77A 4HLUA 5ANRB 4HYQA 3GXBA 5D87A 3ZQKA 3NYWA 2ZRKA 4ECAA 2WKSA 5F73A 4AECA 4AMBA 5IHPA 4MVJD 3OZWA 4FZ5A 3ZQUA 4Z4QA 3IDAA 1XTTA 2TECE 4LJLA 3RTCA 4IDHA 1JDZA 4DLBA 4Z0PA 4JNCA 2C5AA 3X0DA 1G17A 3M34A 3ED1A 1RLJA 4KXXA 3ZHUA 4QLOA 4B17A 3JWPA 1GUFA 5K0EA 3FM9A 3EA0A 2A67A 1GRVA 1R66A 3AMVA 2CFTA 4Q3DA 1TA9A 3KZMA 1JHVA 1UDCA 5KI6A 4JBHA 5DXJA 1FMWA 2WTBA 1KQ3A 3DEHA 3L41A 2FAXA 4BX0A 1PGQA 3AP2A 4PC7A 5CLFA 1E4EA 4CUZA 3NYJA 1K86A 1MQ9A 1PZNA 1RRGA 2J31A 4MAAA 3PE6A 4R0VA 5CCEA 4QBGB 2CLIB 1G98A 3IP7A 2CLKB 2FG6C 1Q0GA 3KJIA 4EIWA 2O7SA 5CP8A 3LUAA 1T8RA 3ESYA 3TZBA 4K6HA 4G01B 5I47A 2AEJA 3FRIA 4ZVKA 4OKNA 2H1HA 4BNUA 4R7TA 2WLTA 8ATCA 1IVSA 1DZ3A 3LKBA 1NR7A 4ZEWA 1XB2A 1HY3A 1ULUA 2V8BA 4HGPA 1L8XA 2W2KB 3P26A 4W7HA 2IUEA 3UAXA 3MFYA 3L4JA 3I1JA 1QYXA 3GJSA 4L95C 3CW9A 1S7ZA 3QMKA 1EFRD 2DGJA 3CLRC 2GPNA 3SSOA 3UUEA 3CVVA 2RCYA 1ZX1A 3MYYA 3QE0A 4WX2B 4R7GA 3QXSA 3O9ZA 1SO8A 3GDWA 4HX5A 3JU3A 3PDJA 1GU1A 3VQTA 4C7BA 3IPXA 2E82A 3L40A 5AK3A 2VYND 2ZXUA 1U9IC 3BUSA 5FLXA 1MJ5A 3VPAA 5JLIA 1RD4A 4EDFA 1POXA 1BD4A 2J9RA 4P92A 2VP5A 5KYXB 4C01A 1WZIA 5JCPA 4ZJUA 1NW9B 2V6BA 3RQFA 2C1EA 4MVJH 2HRBA 4TMYA 4YRFA 3VBEA 4JJIA 3RVOA 3VV3A 1W0JD 2CZCA 2I8BA 4A8JA 2VRWA 3WIOA 3TLXA 2CHVA 3IXLA 3CEMA 1ECLA 2J9YB 3FXAA 2ZXPA 4KDRA 2G1PA 4JITA 2JBHA 3II6X 1L1QA 3HACA 2FMFA 2F3UA 4BKUA 3ZCRA 4TYYA 4OI2A 3O31A 2PUAA 2D59A 5DI9A 1MMDA 3PCVA 2FRDA 4OM7A 2OQVA 4F06A 5BW8A 1PWXA 3ER9A 4ZV4A 2RHCA 4IINA 4PTYA 2I7VA 2WZGA 3VPGA 3VO9A 4CMAA 2G9ZA 1VMIA 2BHNA 1XZNA 3BH7A 3PXGA 1BWQA 4RY9A 1ZEJA 4WN3A 2F1HA 5DE3A 4EUKB 1X3SA 1JMWA 1ZZPA 4EJSC 5K8CA 2ZI6A 3WWEA 3KPUA 3LPNA 2HSZA 3MOGA 1RRVA 4BZXA 1D0IA 2G76A 3T4UA 1D4AA 2I7XA 1ZHHA 4Q6BA 1JVNA 3WLPA 4DCUA 1EFRA 2KC3A 1CPQA 2V4UA 4KOAA 1RLOA 4JB0A 4U9EA 1QONA 2HV9A 1I14A 4ARUA 5B58T 1Y8ZA 2ATEA 2RGYA 3C3JA 5HCIA 2PH7A 3W2FA 4QYXA 3GL9A 3NBZC 4KYIB 4WJ0A 2KGOA 4YCCA 4EPXA 2PWPA 1I3OA 3JYLA 3U44B 2JI7A 3MJRA 1ENOA 1Z2AA 1G1AA 3BN3A 1O87A 4QASA 3W5CA 2C54A 2OZVA 1XQXA 2D5RB 2PGJA 3CLRD 1JF8A 4BNWA 1N78A 4IJKA 1BR2A 4KRFA 8MHTA 3OFKA 2I7TA 1QKIA 1ODTC 4BKOA 5I3ZA 4N6CA 4A0GA 1MPXA 4AMUA 5GINE 2ZUEA 1VA5A 5JJBA 2VJQA 4JLMA 1EI7A 4KH1A 4QEDA 1TW3A 3IAS1 4WJZA 4FHEA 2VS1A 2J8ZA 3I05A 2NU6B 3H2HA 4GEKA 4IFIA 4OHBA 3F8TA 5ALUA 4KUEA 4UVGA 3UMSA 2FWAA 5LM3A 1QX3A 1KK0A 1ZITA 2OHOA 4WKPA 5DP2A 2DUWA 3UYKA 1JEEA 1NVKA 3V1KA 4EQ6B 4YUYA 2D0OB 3B3QA 5FWYA 5JROA 1V4AA 2CSUA 2IHKA 1CY2A 4ZT4A 3WLOA 4E2XA 1OWMA 1SC3A 4TS1A 2AUTA 2EZ4A 4B0PA 2IHBA 3OLCX 2HUJA 1L5HB 2XLHA 3IB3A 1FP4B 4OJYA 2M1ZA 3LDAA 3UK1A 3ZGNA 1WB5A 4DLVA 4MR9B 5CVTA 5LD2B 1TUIA 3D0QA 4AF8A 3HFSA 2HA2A 3ACCA 2ZR0A 4LYJA 3HRHA 3ACDA 4BEMJ 3I4FA 4RDHA 3ZDEA 4MRVA 1A2BA 2Z56A 4AM8A 1NI4A 2WWGA 4H60A 3FHTA 3OUZA 4ERXA 4KI0A 1SC4A 1WXFA 2H1LA 5P8WA 2V3CC 2DKNA 3MGGA 1JQEA 2CNLA 1J42A 1RKVA 1J99A 5AXAA 3A6KA 4I1RA 2Z2JA 1QYVA 3E9CA 2HLDD 1EWKA 3OETA 3DULA 4QU8A 3VSDA 3D4IA 2EWMA 4DR7B 1J8DA 4MVSA 2P9YA 4QJBA 1GPLA 1P0IA 2DF8A 1KRXA 1MABB 1PR5A 1AKUA 1W36B 1NHWA 1E6KA 2JHCA 1XCOA 5FTMA 5CX4A 4EAAA 2B8EA 4IJVA 3H97A 3NKFA 1FDIA 4X20A 5IWAB 4OK6A 1E2HA 2AC7A 3GQBB 1W9HA 2GBCA 5CGZA 1KMIY 1K7YA 2Z4SA 3U3BA 1DV2A 1I5RA 1ZGGA 2AQHA 2ZRPA 4WGYA 3OWHA 3QLJA 3OOEA 4H27A 4B4VA 4E70A 4BJ1A 1P45A 3IPAA 2KPOA 1SU7A 4OO3A 4Z9BA 2WMYA 4B2IA 4CV3A 4N76A 4Z4GA 1X1DA 4G2NA 4B8WA 3N8HA 4S3MA 3KOZA 3CUYA 3NWBA 2DETA 4IUDS 4DNPA 1U28C 3IOBA 4GGMX 1DOAA 2WP8J 3CWZA 2X5NA 4KV9A 4Q4DA 5F4BA 1FP2A 1X94A 4ZRMA 2ZW9A 1C7EA 3KD2A 5EPEA 2NMVA 4LOIA 4CQMA 3FWKA 1GUDA 2ZJ7A 2RGRA 5L7YA 3WRXC 3KC2A 4JWTA 2AEMA 5TSDA 5BMVB 1YNOA 4ZCPA 5HF8A 1Z16A 1KMHA 1RQLA 4CU2A 1BXZA 2DQKA 5A9SB 4G9EA 2Q4FA 3EGWA 2R1VB 2W4MA 1QVWA 1RKUA 1ZZGA 1FFBA 3WGMA 1GSHA 1OKKA 1KDVA 2OBLA 3R7DA 3SS8A 1K92A 4NY1A 1R74A 2OM2A 4O4LF 1OB5A 5JPDA 4G4GA 2AF3C 4QGGA 5FPPA 3T38A 4FOPA 4KWCA 2Q5JA 3SIPA 1RI2A 2AXPA 1T3LA 2EDCA 3HJCA 3EVFA 6REQA 4BASA 2JB9A 3NYMA 1QHXA 1SIUA 1VYHA 2ORYA 3T5MA 1MABA 1JMKC 6YASA 2BGJA 2CHGA 1SWWA 2EEZA 1FMLA 2BGGA 4BTVA 1X1CA 1J2JA 2GKGA 5ECWA 1O77A 3EEQA 1Y4DE 3R7SA 1FSFA 2VSQA 1AQ6A 1IYZA 4MLCA 1ABFA 4GM1A 1YK0A 1K1EA 2C92A 4PXYA 1WXHA 5DWVA 1P3JA 1RT9A 4IWNA 1F4PA 2TYSB 4DTCA 2HX1A 2PFGA 4IOJA 2VWPA 5LQJA 3C8GB 1MAAA 2H18A 2XOKA 1Z63A 1X9IA 2PO7A 5J1TB 3W8DA 5INTA 2PUFA 2C9BA 5DEIA 3AIKA 2BM8A 4MV5A 4XD7A 1O5TA 2I6TA 4N7BA 2FJUA 3FVRA 4UCFA 3OD5A 4PYRA 1OH6A 3WK8A 4BO3A 2AP3A 2BH9A 3AHGA 4PRZA 2Z6VA 2IYOA 2WV9A 4JKVA 4YECA 1VE5A 3ELBA 4C4XA 1THMA 1F17A 1GZ3A 4P86A 4D3SA 4J90A 1A7DA 1X7XA 4JI8B 1LTHR 5JHGB 3V6LA 1XQWA 4PLGA 3TD6A 1A4RA 2DFPA 2HJ9A 2B98A 5EMHA 3ULKA 5G4KA 5ES4B 2AEFA 3GEIA 1Z2PX 4BKQA 3I01M 4K26A 4EPTA 3VPHA 2CUNA 3Q0IA 1N9ZA 4GP7A 3IPMO 5FWXA 5ITWA 2JLWA 3GJ0A 1NVXQ 1VHLA 2I2DA 3DD7A 1AXGA 3CPJB 3UZUA 5AVZA 4Q3CA 4HFKB 3BORA 1W8IA 1VSTA 4H18A 4N5LA 5KAPA 2ZS7A 3X1XA 3LBIA 4KQIA 4RY8A 2YUTA 1HL3A 2Q2NA 5ADUS 2XWBF 2H3HA 3A4LA 4EDHA 1YAUO 5TPWB 2C2XA 3ZS9A 4CQMD 1A3CA 2HNBA 1K88A 3QW0A 1AS2A 1VJ5A 2EKPA 2BL4A 2W6OA 1I9CA 3G13A 4IS2A 4C7KA 1HDGO 4NZMA 1PNVA 1JEQA 2SKEA 4GRAA 5ALXA 2ZSFA 3EGOA 3SF8B 3O03A 3SHQA 3NWEA 2HCJB 2WHYA 1QP7A 2JGRA 2GPYA 3E3OA 1CS0A 1G5TA 2JCSA 3LT1A 1IPEA 1G2OA 3NBQA 2CCKA 2ICAA 2XCSB 2MDTA 3T3IA 2FFHA 2CB0A 1XEXA 3K8QA 2GWWA 3V5YA 4OHKA 2QPLA 2QSJA 5AJWA 1FBNA 5IVIA 1Z5OA 4KQ2A 2QP4A 1U02A 1HT1E 2LVBA 1W49A 4ZICA 2WFZA 3R6TA 4B75A 1OXKB 1II0A 3AVPA 4BRZA 1NP7A 1CC1S 4FHZA 1QQ7A 1W5EA 4KO8A 1OIWA 5ESXA 4N3GA 3EFHA 2AE1A 3NG1A 2AVKA 4O25A 2H65A 2R96A 2XQVA 2XHZA 4KLZA 3WK5A 1C5KA 4MICA 3UOWA 4R8MA 4DR2B 1G3UA 1PE0A 4TTRA 4XQGA 2IV3A 4D7AA 5K01A 5ICMA 3N2GA 2PSFA 3A1WA 4B2PA 3ROFA 3OMWA 4U63A 3M4ZA 3AGTA 3SC2B 4LF4B 1GA4A 2GZSA 4EY7A 2PP4A 3RAJA 2R8YA 2B0JA 2YINC 1U8UA 4QOFA 2C8LA 3QK7A 4ZARA 4I36A 2IOFA 2XADA 4HPJB 1LSUA 1AKRA 4C3ZA 3BWYA 3O75A 1OQCA 3A4IA 3C5HA 4JJZA 3LL7A 1JQ5A 3PC2A 4I9NA 4L22A 3FFXA 1UFRA 3MUFA 4JYMA 4V0NA 3CA8A 5FQOA 1CY0A 4C0XA 4J43A 1BDIA 3ND5A 4PO8A 4IOKA 1QTQA 3O9VA 1O4WA 1YMUA 4RDCA 2X9VA 5HMLA 4YMHA 1JR3E 3SQWA 4M49A 3UMBA 1FRQA 2RONA 3FZEA 4HGRA 1DRVA 3DE8A 4CF3A 3A1SA 1LJ8A 4Z8YA 1GUAA 2R65A 1BXGA 1DUVG 2Z43A 4AP5A 5G0VA 3MRSA 4XFJA 3OI7A 1D6SA 3D2AA 1CEQA 1GNSA 1PNRA 1PT8A 1U89A 3C8ZA 3ER6A 2F7SA 3HV0A 5HZMA 4QC2A 3KYDB 1XFAA 221PA 4CLRA 1MKYA 2R97A 1UQRA 5BV1A 5CBKA 1K6IA 4YX9A 2CXQA 5JS2A 3RTAA 1NUHA 3AFHA 4PBRA 1TM7E 1P2BA 2XGGA 4WZZA 3VM6A 1IHUA 3LC7O 3CKMA 3NHJA 1XCGB 4LJ4A 3VU9A 3U3XA 3MMSA 2YVUA 1ZD1A 1LE2A 2E4VA 2O7VA 3HO6A 1NKTA 4M46A 2WM2A 1W52X 1CUWA 4ZGWA 4MQEA 3G7UA 3NANA 4O8ZA 3NPAA 4RL4A 4D0LB 3LUGA 3JW8A 5KB3A 4IVNA 5DGHA 4BNVA 4IJJA 1I51A 4E4TA 3G5AA 3PD7A 3B89A 4BV8A 2AH5A 5BQHA 4MINA 3PXBA 2ZUCA 1TTTA 3F90A 1V1RB 1TMYA 1ZNQO 3ZNOA 3HNRA 2M6SA 4X60A 3MPOA 3G88A 2YWCA 3AWDA 1LF5A 4RQBA 3V48A 3LX6A 1WD7A 3MQ2A 2PWBA 2KX7A 3D5QA 1MB9A 3BA1A 1X7ZA 4NP6A 4ZU3A 3GLVA 1YDHA 2PD4A 1MF7A 3LPCA 4Z8XA 3IE2A 2VZ8A 4GG1A 4JCOA 1JEYA 4F4FA 4ETNA 3MWJA 4KZKA 2QB5A 1U65A 3CE6A 3HXTA 4G86A 2Y1XA 2HV8A 4UREA 5LUAA 4CS9A 2XDQA 5JTUA 4QVGA 1NR1A 1AHNA 1W85B 4W6ZA 2B37A 2GN8A 4FUTA 2O1WA 1J97A 3KSZO 2EHJA 5TEWA 1TM4E 2OT3B 4JS0A 4MUEA 4P3KA 2YL3A 4Q1DA 3B53X 4MVMA 4H9GA 4KW7A 5C9ZA 4HAVA 2GS9A 3THXA 4LI3X 1JRAA 5BP7A 3YASA 3F6SA 5D2CA 2V5UA 1SC1A 2YRFA 1QHEA 4ND8A 1X39A 1KY4A 2B2XA 1QAMA 1G3RA 4Q1CA 5FHRA 5DM2A 4ZLCA 5E95A 4YMUA 4EW1A 5LA6F 2AQ8A 2HC9A 1AGPA 3FF1A 4AYWA 1D2HA 4MO9A 1WUYA 1Y8QA 2IOYA 2GAOA 2J67A 1G8GA 2AMVA 2Y68A 4P9FA 2Q9UA 4GNKA 5H5JA 1NRWA 1R0YA 2PX5A 3AKDA 4LBVA 1P17A 2RFLA 1N2GA 1P1BA 3F46A 3U3KA 3OE4A 1P6XA 1V3QE 3IUBA 4FE4A 2FFAA 1XD2A 3LY8A 4AYTA 1MD9A 3VMFA 2QVGA 4R98A 4AUMA 3NVKI 3DVLA 4FJ0A 3EEYA 3OPMA 4MUNA 4KYVA 4RCZA 1P3Y1 1T2FA 4E32A 3OICA 3K0BA 5T41A 5DHFA 5KS2A 4UZEA 4Y1GA 1EFDN 1P7PA 3RJTA 4FLMA 1NYTA 4XX1A 1WTAA 3CURA 4GO1A 5IG2A 3X2QC 2AN1A 2OHJA 2YV5A 2ZE5A 1E2NA 5TB5A 1RPNA 5A1TA 2C5GA 1IXSB 4P4SB 1M67A 3ZBQA 4DYDA 5K0LA 3UWKA 3PWSA 3ZE2B 5JI2E 1K9VF 1JHUA 3QKIA 5DGDA 5HQTA 3D7RA 5F23A 3AJRA 2QX8A 3HLYA 4RYDA 1XDGA 4JYPA 4EFLA 4V1CA 4E18A 4JYBA 4RLFA 5C7OO 5I4CA 5C1OA 3M9XA 1TR2A 3I1FA 2LZ0A 3PIIA 4G8CA 1TIKA 4XPYA 1JIUA 1ZH8A 5GJVC 4HNUA 2QD4A 1D6NA 1UOQA 4BP9A 3N2GB 2OXRA 3IUMA 4KXVA 3BRWD 2N9UA 2RGBA 3GFFA 3RFUA 4BPRA 4TXNA 3D6TB 1VXRA 3JQ9A 1E9DA 3WNDA 2N1BA 2QXUA 3AP1A 3VOAA 1T15A 5LMNB 3P45A 2IV7A 2OHGA 4CJXA 1U2QA 1N6OA 1TUEA 2Y1KA 1GTG1 4OGWA 2P91A 1BVHA 2GSWA 1RAGA 5A04A 2YN2A 1R0WA 2GEBA 4CHGA 2YWRA 4JVSA 4PAQA 5G53C 5JD6A 1Z0SA 2VYVA 4FMCF 4ZANA 1R4MA 4G1MB 3SLGA 1LDBA 2W6PA 2NZUG 4I5DA 3O4GA 3WGVA 3I3SR 4F3TA 6AT1A 1ZNYA 4WIAA 3RUIA 3NH6A 1K66A 5J2TB 2FA9A 4A5SA 3U6BA 3X1JA 1KZ9A 3NT2A 2DFDA 1OZAA 4TV8B 1JILA 1RKQA 3AL2A 4NOKA 5JZVA 2B21A 3JAWA 4L4SA 1XQVA 1M6VA 3WLSA 5CT5A 4UAVA 3QNMA 4E1AA 1XRRA 5H1YA 2PFDA 3LL4A 4EKEA 2EW1A 1R27A 1HL7A 5CLIA 4C5BA 10MHA 1TFRA 5GOZA 1G5QA 3WLFA 1GRQA 4IRUB 4X95A 3IKLA 2KNHA 2HI0A 2QT9A 1FVHA 1E0KA 3AFNA 3EDOA 4TV9B 3MIIA 4DV1B 2V0NA 4D4XA 2HA7A 1A2QA 5AT1A 1UKZA 4U5GA 4QYWA 1T1RA 3SXKA 1ISRA 3PT9A 4GWGA 3DEFA 3OZUA 1GFIA 1ZSNA 4PQRA 3WK6A 4CV2A 3BQNB 3KSAC 3ZXIA 2I22A 1UG7A 1R9GA 1BEEA 5C52B 4DR5B 4QQ8A 4LXYA 1DUIA 1E6EA 2QUBA 2H7VC 1ZUD1 4L5BA 3IRUA 1KXZA 3BGSA 4YALA 1WSBA 3ISJA 3KOYA 3AG4C 4RTSA 3OEHD 2WF7A 4YAUA 1TAQA 2PQ2A 3WSWA 3FSRA 3GLFB 1BO6A 4HRXA 1U6KA 2A2ZA 4JQOA 4B79A 2O8EA 4GWLA 3EXG2 5B7PA 1H2RS 5L0GA 3KM0A 1MJNA 2UZ1B 4MYCA 2OV2A 4E1BA 2IXAA 4BP3A 5FF9A 4DCTA 1I24A 2ZVPX 2BDEA 3GBPA 1DEAA 5C5EA 2PH3A 3W1EA 3E1KA 1AA6A 1ZQ1A 1ZCFA 1AKMA 1MH1A 2ZIUB 3L34A 1L4LA 4HGQA 2BGTA 4RENA 4WV3A 3BXGA 1U2GA 3NCHA 5CX1B 4ZZIA 5JXHA 3FUTA 3I9KA 1RKEA 1YQGA 3V8PA 3A6FA 1KU0A 1AQJA 1F0YA 1AQLA 4C2BA 1MG0A 1WMSA 1N77A 2JEZA 3NIFB 4OKSA 4BNJA 4ND8B 4CKBB 3LT0A 4MQBA 5IUJC 2EW8A 1AUEA 4XDYA 2MMCA 1BRTA 2CL0X 4F8EA 5ISMA 2Q3EA 1HE4A 1K75A 3PXAA 1KEWA 1CY6A 1L4NA 1C8VB 3IALA 5IBCA 2PZGA 2GA9A 4JMLA 3WO1A 4DIKA 1V55C 1DQPA 2XD9A 4FJ1A 3W9BA 4DIDA 1PV4A 2VH2A 1OFGA 1JRLA 3PDIA 5BWNA 3X43A 5TEVA 3PXXA 4HX2A 4OHRA 4CDVA 2ZQZA 4NHOA 3O84A 4R9SA 5KOHA 2BBSA 4S1OA 2X0EA 3O4JA 2QF7A 3E9NA 4NBNA 1AXRA 1ANKA 2OQRA 3K16A 3OT4A 2RB5A 1A7KA 1OCEA 1R10A 4ZO9A 5ERYA 4ESVA 1BBHA 3H8WA 4C4RA 1XMSA 1ZK2A 4U7PB 4XCXA 2JH3A 1V96A 1WW8A 4E0IA 3ZQYA 1FYEA 2R1UA 3AF2A 4DAOA 5B7NA 1QR6A 1Q57A 1W0KD 1R4AA 3NASA 3OZDA 4NEGA 4OKIA 3CX8A 3LH5A 4B74A 4CMIB 5FNVB 1ES9A 2J32A 4WOKA 2QYOA 3Q7TA 1DAEA 1G4HA 3D1LA 3V9AA 2QM8A