2PX3A

Crystal structure of flhf complexed with gtp/mg(2+)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
258
structure length
256
Chain Sequence
PEPLRKAEKLLQETGIKESTKTNTLKKLLRFSVEAGGLTEENVVGKLQEILCDMLPSADKWQEPIHSKYIVLFGSTGAGKTTTLAKLAAISMLEKHKKIAFITTDTYAAVEQLKTYAELLQAPLEVCYTKEEFQQAKELFSEYDHVFVDTAGRNFKDPQYIDELKETIPFESSIQSFLVLSATAKYEDMKHIVKRFSSVPVNQYIFTKIDETTSLGSVFNILAESKIGVGFMTNGQNVPEDIQTVSPLGFVRMLCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the third signal-recognition particle GTPase FlhF reveals a homodimer with bound GTP.
pubmed doi rcsb
molecule keywords Flagellar biosynthesis protein flhF
molecule tags Biosynthetic protein
source organism Bacillus subtilis
total genus 72
structure length 256
sequence length 258
ec nomenclature
pdb deposition date 2007-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1380 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2px3A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2px3A02
4B71A 2ZRIA 3CRRA 2G1KA 2VA8A 2D7CA 3A4MA 4AD8A 2IC5A 1W0KA 1NJFA 5HZKA 2ZE5A 1E0SA 2J0UB 2GESA 2IYZA 4U7DA 3FGNA 4C0QC 4NZYA 4IDPA 3ZJYA 5JLJA 2AWOA 2R2AA 2RGNA 3AVWA 1JI0A 1R8QA 2FZLA 3RS0A 1F48A 1Z22A 4BFVA 3MD0A 4PXAA 2OXCA 4LJ8A 2GJ8A 1S9DA 1CJUC 2REOA 4PZZA 3IEUA 1NY6A 4Z8XA 1EXMA 1UEJA 2DR3A 1FNNA 1UPTA 4JLOA 1F60A 1GKYA 2E9SA 2GVDC 2GVZC 4QGGA 3HU3A 3KQLA 1HYQA 3Q3JB 3QXXA 4A2PA 2HT1A 1YU9A 2WTUA 4LHXA 1SXJE 1E2KA 1LS6A 1AZTA 1T6NA 1E2FA 2GRJA 1XPUA 3GLIA 3H0KA 3MSXA 4DEYA 2A5GA 1RKBA 3C4JA 3QOFA 4L15A 2ZU6A 1M8PA 3R9IA 2HDNB 1AM4D 2OBNA 5KYKA 2J0QA 1E9AA 4L8GA 2NQ2C 3T61A 4IKEA 2D2FA 4Q7JB 2QBYA 2FE4A 3FYHA 3T12A 4EPXA 2RCNA 3BH6A 3I8SA 1EK0A 2F9LA 2GAOA 2Q9AA 2V6IA 3Q72A 1UJ2A 2ZI9A 4KFRA 4P33A 1IY1A 3BRWD 4JLDA 3NVAA 3CRQA 1E2QA 3RS7A 4B6FA 2BM0A 1G3QA 4GOXA 4JIMA 3K9LA 5IT5A 1AJEA 2B7BA 4MKHA 4NYMR 2FSHA 2W0SA 4EJSB 3U3MA 1E32A 1ONBA 4MRSA 4W5WA 1DO2A 1JEEA 2AXPA 2JJ2D 1CRQA 3CF0A 4K81B 4L5BA 4NTZA 2ZIAA 1ZM9A 1KK2A 1KO8A 4B34A 4BFUA 2Z43A 3NTUA 4QGHA 1EGAA 2EFDB 2WKQA 3WY9A 1P3JA 2ZRLA 1KJZA 1MT0A 1ZM2A 2Q9CA 2YWHA 4M21A 3EG5A 3TE6A 3QENA 4GL2A 1T8TA 2IHBA 2A5DA 3GD7A 3QKSB 1NI3A 3BFXA 3P26A 4V0MA 1N6NA 2KI5A 5KPJA 3TQCA 3C41J 4PX9A 4YDSA 1PV4A 3EZ6A 4Q4AB 4RD2A 5A0FA 1P72A 5AUPB 4TTPA 4JVMA 2J46A 1T3SA 4YONB 4NBSA 3VU9B 3M4YA 3ND8A 4UNSA 3AKEA 4ZDJA 1L4UA 4FD2A 1NSTA 5KDLA 1ZCAA 1HQYE 4JVLA 4OHXA 3E1SA 3K0AA 1BO6A 4UXIA 1E79D 2AX4A 1YRAA 1VCIA 4D0GA 4DZZA 5E4FA 2V54A 1GNRA 3GJ5A 4URYR 4MDEA 2OBMA 2N46A 3QI2A 1NG9A 1JJVA 1DS6A 1U0LA 1JR3A 3UMSA 2PJZA 4DSNA 3S1AB 2NO0A 2WPDA 5IK2A 4DDTA 1N5IA 5E7MA 3E2IA 4M1WA 2VP4A 4O25A 4BLQA 4M1SA 4LYAA 3AVOA 2LCFA 3H1TA 1NF3A 5EP1A 1OSNA 1OXUA 5H1YA 4MUAA 5JSZA 3RANA 1G4AE 4TL6A 4ZIRB 4OI1A 3KXKA 2IS2A 1KOFA 4PPFA 4GOJA 2IL1A 4MRPA 5F9FA 2MSCB 3GLGE 4GFDA 1KI6B 4M4SA 4A15A 4LY6A 4CEHA 1CKEA 1R4AA 4DCSA 5GJCA 1SZPA 4Q7KA 3U2QA 2ZR9A 3BIFA 4KU4A 1E94E 4A8JB 3RRMA 1BMFA 4O3MA 3BB4A 4LYFA 1FP6A 1H8ED 1KAOA 5J4LA 4JS0A 1Z29A 3OESA 2ZU0C 3ZH9B 3U61B 4OJQA 4ZDIA 1XTIA 3P20A 5DISB 4FXPA 2FEOA 3CH5A 2ZS8A 3EPLA 1W4BA 4NP6A 2GXUA 3IO3A 4R71A 4G5OA 1M74A 3SJBA 5AWFC 2CBZA 1GG2A 3NC1C 3SJCA 2ZS9A 4L9WA 4ASUA 5HR5A 4TYPA 3X1ZA 1IAQA 5G41A 5LBIA 1P75A 2QL6A 4I81A 1GRNA 3VR5A 3B13B 4GBMA 3VMFA 1Q3HA 1G9XA 3X1YA 3OE7D 1D2MA 4HI0E 2G9NA 3LY5A 4OKSA 2BIFA 3QKTA 4MYCA 5DO9A 1UDWA 3Q85A 1FUUA 1J2JA 1KI7A 3F3YA 4QM6A 3CNLA 4BUJA 4BRUA 4XD7D 2PEYA 3HP1A 4UJ3A 1XMIA 1P6XA 5SZIA 2F9MA 4A82A 4ZKDA 5K8LA 2XOKA 4IDQA 5FI0B 3IBGA 4MRVA 4TTQA 1U9IC 2GXSA 3GLFA 4Q4JB 2NMVA 4DCTA 5HE9A 2YOGA 4YMTA 1JAIA 5J40A 1KMHB 3ADKA 2GXQA 3UMFA 4TLAA 2BDTA 1E1QA 4M0LA 1H65A 1GITA 2FGJA 3DHWC 4TYYA 3DPUA 4BGDA 4TMXA 3QSYA 4MYHA 4B2PA 1E0KA 2DCUA 2IUTA 2RMKA 2VHQA 3MCAA 4CDGA 1CBUA 3WP0A 2BMDA 5EE5B 4ARZB 3FVQA 1BKDR 4TT3A 1GOTA 5FUVA 2YWFA 2IS1A 2WWFA 4WVFA 2DWOA 4G5RA 4GZMA 5H70A 2OCYC 3OEHD 2ONKA 4WA7A 3KJIA 1Z6YA 2AFIE 2IS6A 4A1FA 2ZR0A 4HDQB 5EXXA 1R8SA 5L3QA 1VG8A 1E9EA 3KL4A 5D3QA 1VYUA 5KTYA 5HPYB 4FMDF 3TVDA 3HU1A 3VX4A 2QRZA 3U44A 1ZUHA 1ZINA 3DL0A 4US0R 5EE9A 3EPHA 4Q5IA 1N25A 5HZHA 1NVXQ 3O8BA 3N70A 2IYQA 4EKDA 2FSFA 3A1TA 1L7VC 1VG0B 2A3RA 4HLUC 2H57A 4DC9A 4OQMA 4PHFA 5C18A 1JQLB 1HE8B 2R8RA 1KIMA 3NKVA 2Q3FA 2JIZA 2QSYA 1E1QD 2CVHA 4CT4B 1NIPA 4A9AA 3K53A 3AVVA 3OZXA 2ERXA 1DBSA 1MH1A 2ZE8A 1G5RA 4TMZA 1T3HA 1ESNA 1OXXK 3U4QB 1G8PA 5EXTA 1KMQA 3EZ7A 5CM8B 4MITA 5TY0A 2GHIA 1J99A 1SXJC 2GEVA 2GJSA 3DMDA 1MO4A 1SVIA 4PHHA 3CO5A 3CRMA 5M04A 4LGMA 4WXRA 4AKEA 1E99A 2IF2A 1UKYA 2ZS7A 2JLYA 2VSOA 4JJKA 4QFMA 5DE3A 4AK9A 4B43A 2OILA 1Q1ZA 2ZROA 4U00A 4ZKEA 4Q9JA 2IBMA 4PR0A 2FFHA 2NZJA 4DIDA 1TU3A 2CL0X 3RC8A 1QHNA 1HURA 3LV8A 3I73A 3LLMA 5CK4A 4XWOA 2BMEA 1ZNXA 2DHRA 1QHXA 5D3MB 4BZQA 3TAHA 5FL3A 1XMSA 3SDZA 3GJ6A 5K8TA 2J1LA 3ZGXA 1Z08A 2JA1A 1P9RA 1V5WA 2GJ9A 1OHHD 2OXRA 2VRWA 1X3SA 1IY0A 2ODNA 3GLHE 5JEDA 4D4LA 1MO6A 1Z5ZA 1RRPA 1E9DA 2EU8A 4G5QA 1FMLA 4NDZA 4R7ZA 4JKYA 1CRPA 1IXSB 1HV8A 1P61B 2UZ3A 1XMJA 2JDID 1AA9A 2P5SA 2WWWA 4LJYA 4EJSA 1OLOA 3BFKA 1KZ7B 1IN6A 1EFRA 4IW3B 5CM9C 5JZVA 4JLNA 5JRZA 1TAGA 2D06A 5JJKA 621PA 4LV6A 3CNNA 5KSYA 4V03A 2QPAA 4LV8B 2G3YA 2VH5R 2V55B 4DWJA 2AK3A 1GNPA 3VKWA 5KU1A 2AL7A 1I4DD 2ZRNA 1U99A 4ON9A 2R9VA 4RKFA 3I61A 1WMSA 1GZSA 4RFSA 3ZDQA 4Q01A 2P6RA 3RRNA 4ABYA 4TYNA 4LHZA 3QKSA 1TNDA 4D4KA 2F1JA 1M1YE 1XD8A 4UNQA 1E2MA 4NYMQ 3ZIAA 1UBGA 3QXCA 5DIFA 3AF3A 3B9QA 1OYYA 4ESHA 2A30A 3TBKA 1U0JA 1IM2A 1KJYA 3LX8A 4TLEA 5AUNB 1IHUA 4KJZA 2Z83A 3EA0A 4PSVA 1CR0A 5TVKA 1XEXB 3LBNA 4HZUB 4QXAA 4FIDA 1PLJA 4PAQA 3Q5EA 1RRFA 4YC7A 2YOFA 2XB4A 3SEAA 3SC3A 1VYTA 2GZHA 4QOSA 5TXGA 1KSFX 1NNEA 4NKRA 5J47A 4PHTA 1ZIOA 5CJPA 3V4FA 4IDOA 4NMMA 1X8KA 4RFVA 4GRAA 5SZKB 3L82B 1XTSA 5FL7D 2VHTA 1NL3A 2WMOB 2G1JA 1LTQA 4BFSA 1LW7A 1G3IA 4A6PA 3CZPA 2GEUA 4ZIRA 2W00A 1OFHA 1P4SA 4ZCLA 3UANA 5FPHA 5FTJA 1OT3A 4JLMA 1G18A 1KI6A 4ESVA 4YMVA 4Z51A 1AKYA 1W48A 3OAAA 3QVUA 1Z0AA 1TL7C 1GFIA 4OHVA 3LFUA 5CIQA 4LC0A 4FCVA 4UXHA 4B6EA 3QNUA 4G5SA 4DUGD 1XPOA 1G19A 1IBRA 1OPXA 1JALA 4A8JA 1JNYA 3QVVA 4W5HA 2IS4A 1LF0A 2GZAA 1DG3A 5ANRB 2ODEA 5H8WA 4F93B 2IA5A 1MABB 3PENA 1CR2A 1EFHA 4C7OA 3H4MA 1OB2A 3FDIA 3CWZA 3W9YA 4GZLA 4QRHA 3O8CA 3AM1A 2JLSA 5B64A 5CB8A 2JGNA 5TDHA 3AKYA 1OIXA 4JJZA 5FTLA 2C9YA 1VKJA 1A4RA 2QAJA 2V9PA 1RVDA 4C30A 5DGXA 1E2IA 5AR1A 4IFEA 1Q20A 3BBPA 1GKIA 3GLIE 5FI1B 3L0SA 3H84A 1DE0A 3CUEF 4HEJA 1FQJA 2B8TA 5A5GA 1D5CA 1KI9A 1EFCA 2HCBA 2BMFA 3NDBB 4P0TA 4KITB 5HKKA 2GJKA 5FR2A 2VF8A 3UMRA 2RAPA 1HY3A 4QKQA 2XXAB 1JR6A 5JHHB 3GQBA 1XZPA 4C0JA 4GNKA 3LO5A 2YKGA 2G0TA 2PL3A 4Q4JA 3QXJA 2ECKA 2W0MA 3K9HA 4XVRA 2O8FB 4B75A 1N6OA 1OXVA 2OCPA 1KMHA 3HYTA 4US2R 3QG5A 2UZIR 3CX6A 3L0PA 4B3DA 1OXTA 3A37A 4KYUA 3Q8XB 3HYRA 2ZUBA 4Z54A 3ND9A 1NVVR 4LPKA 4DJTA 2X2EA 3D7MA 5BWMA 1W2GA 3SQWA 2FPLA 2Z6VA 2O0JA 3ADBA 4DVGA 2OEPA 4CT5A 3MAAC 5AJZA 5G3ZA 3OIUA 1VIYA 5L8VA 4ARZA 1II0A 1NLYA 2J45A 2IYYA 4LPSA 3RNLA 5EJEA 2HF8A 2BKEA 5JECA 3K70D 5GVRA 1TQ4A 5JWOA 4V0ME 3C16C 2GK6A 2WICA 1VDZA 4HB3A 2ZI6A 2P67A 3IHLA 4N0DA 1KI8A 4C9BA 4UNRA 3SJZA 1XJCA 1R0ZA 1WA5A 2Q21A 2W58A 3CX8A 4RD3A 1P5ZB 5AUQA 3UWKA 2NGRA 4QM7A 3P32A 3QKRA 3R7WB 5FBQB 3LBIA 1ZRHA 2J87A 2NO6A 1Z2CA 1Z07A 2OG2A 4YXWD 4FMCB 2QM8A 2REXB 3GEHA 3IHWA 2OO7A 2VP9A 3KUCA 4FINA 5HTKA 1GILA 2OLKA 4JLJA 1CXZA 4MUBA 2W2VA 1KSHA 1CJTC 4X8HA 1RRGA 3VR1A 1CIPA 1N0UA 1S1CA 5KSOA 5FPKA 1TADA 2HCJB 5DNYB 4GMXA 3W34A 2ZUCA 1P9WA 3U4QA 4MGKR 2OV2A 4R98A 4FCTA 4ACBA 1QRAA 4E22A 3PEVA 2ZRMA 3CIOA 4Q18A 3UKDA 1GAJA 1XP8A 3QPUA 2IYLD 4MGYR 4TN1A 3SJAA 1XZQA 1Z0IA 5TARA 5JFGA 2CK3A 4WOPA 2WWYA 1SVMA 2X1VA 2ONJA 3ZS9A 4DSOA 2Q3HA 4PQRA 3PXGA 3DMNA 3L8YA 4XVUA 3RSOA 4JT4A 4GMDA 1P60A 2WHXA 3W5IA 1XD9A 2A9KA 4DSTA 5D3MA 1RW4A 2XNDA 2ZETA 3AF4A 4OQXA 4FMCF 3JVUA 1KNQA 4B2IA 1R0XA 1VCNA 1VIAA 2XZOA 1CULC 4O2LA 3W3ZB 4FN5A 2VP6A 4Q9LA 4B44A 4HB4A 4C0SA 3IUYA 4M1MA 5DSZA 3H86A 1ZNZA 1KO7A 4F4IA 3J81k 1EFTA 4DDWA 3AB3A 2KE5A 3FPAA 1OYWA 1Q0UA 1VG9B 2PCLA 3ZZUA 1KK0A 2EQBA 4UXJA 4BWYA 5LB4A 1GM5A 4XSGA 4Q47A 2P2LA 4W9MC 5TB5A 2PMDA 4LJ7A 4BFZA 3R9XA 2C03A 3IEVA 4KBFA 2O8CB 1A2BA 4V0LA 1R10A 1WP9A 3U3RA 1E98A 2WWXA 5GJVC 1EFUA 4GSYA 3BC1A 3GLFE 3L2OB 4C0BA 1T9HA 2QP3A 3K09A 2IWHA 3WYGA 3X2SA 3LVRE 1T5LA 1X8LA 1FUKA 2FFAA 3CM0A 4NCNA 4B76A 3W6NA 1FX0B 5KNDA 4FWIB 1RPZA 3SHWA 2PBRA 1SHKA 3FHCB 2TMKA 3CBQA 1HEIA 4Q1AA 5CYPA 1W36C 2XNDD 1S2MA 1W4AA 2VL7A 2QMEA 2CHQA 3KJHA 5AUOB 4C0HA 1II8A 4BEBA 5LDDC 2RHDA 4KVGA 2IWRA 3FE2A 2J59A 2BKUA 1SVLA 1DAEA 1GDDA 1XEXA 3M0EA 3QUSA 1SVSA 3TW8B 2ATXA 5L3SB 4O2RA 2IX3A 4FI3C 3W8NA 2JLZA 4Q21A 2ZVQX 3RSLA 1R5BA 1E3MA 3SN6A 4KHZA 2JJ2A 2K5UA 5GVSA 3RYTC 1CLUA 3QPWA 1ZVQA 1KO5A 2G77B 3RS2A 3K0FA 3RC3A 3K9GA 2HXSA 2ZUDA 4TL7A 1ZUIA 4H1VA 2QE7D 4C2UA 2HLDD 4G1UC 2J41A 1Z0KA 2XAUA 4XSHA 3LNCA 2IYRA 4IEIA 1ZU5A 2CE7A 1W46A 3SYNA 3B6EA 4LZZA 3PEUA 3I4LA 5G3YA 5DYIA 1ZIPA 1E2DA 4LBZA 2GETA 2RGNC 3BORA 4KV9A 1P62B 3PUVA 2OFXA 2RB4A 4HSEA 1KI4A 1E79A 2PT5A 2H7VA 2C98A 2PX3A 4F4CA 5ELXA 2WJHA 2YVUA 4FCWA 4PC2A 5BYJA 1VCOA 5BN4A 2O52A 3LXXA 1QF9A 2LKCA 5F98A 4V0OA 2FF7A 3SBEA 4R2IA 2QPTA 2H92A 2IYVA 3BD9A 4DLYA 2V1XA 3KJGA 3A6PC 4URZR 3IBYA 4XTCS 1PLLA 1WXQA 1X1RA 2D7DA 4NONA 2DFNA 2JJ1D 3REFA 1YZLA 2YJTD 3CPJB 2D62A 2GA8A 2JLRA 3OEED 4OI0A 4AKHA 1XD2B 4NE2A 4DCVA 2VLIA 2CE2X 4QBGB 1WBDA 2WKRA 3U7FB 3W5JA 1J7KA 3VHXA 4D4JA 1GL9B 1QG4A 2ZREA 5LPNA 4KLNA 3MJHA 3MMPA 1Q12A 3LQQA 2FPKA 3PR1A 3BAFA 2X19A 3WNCA 2F1HA 2ZYWX 1AKEA 3VTKA 4EFLA 4JL5A 2QUZA 5EP2A 3MWKA 3DEFA 1S3GA 3SOPA 1H8EA 1DEKA 4LBVA 1G1MA 2R44A 2BJVA 2XXAA 2F55A 2F3TA 3FHTA 2ZXUA 4GP6A 1YR7A 4PAOA 4OK3A 121PA 1JBKA 1JJ7A 5TMPA 1XTKA 3U6BA 5FOUA 3W8RA 1KNXA 3OHMA 1C1YA 4DRZA 4YMUA 4IXNA 1XWIA 3UK6A 2OE2A 1SVKA 1W4CA 1MRSA 4URVR 1IN4A 4XWKA 4MKIA 2ZTSA 2IW3A 3LWNA 4A36A 1K5GA 4LV5B 2B7CA 3VHLB 3PEYA 4NCKA 1IQPA 2ODWA 3ZS8A 3VQTA 3FKSD 5BYKA 3OE7A 3BWDD 2QENA 4M53A 4PZLA 1CF4A 1XEWY 2FG5A 1UAAA 2LWIA 1OFIA 2WM9B 2QAGB 5KUTA 4AI6A 1E9BA 4WXPA 1AIPA 3THYB 2ZSFA 3JVVA 1GNQA 3C15C 3KQKA 4XD7A 3VR3A 2BJWA 3FMIA 2E87A 1VYVA 4KYIB 1DAFA 1U8ZA 2VBCA 3DZ8A 2IYXA 4NPHA 4Q1DA 3N2IA 5B2ZA 2YZ2A 4RZ3A 4URXR 4Y0AA 3AP3A 1NVVQ 1ZD1A 1DAGA 4PAMA 2BBTA 2GK7A 721PA 4LI0A 3TSWA 4ZDKA 3CPHA 2Z4RA 3CZQA 4DLXA 1PZNA 4EFNA 3D3QA 1ZC3A 3QJYA 5G53C 3R7WA 2XSZD 1N6PA 1CP2A 2FMXA 4GT1A 1KDRA 3P1JA 3U60B 1COWD 2V8OA 3T5GA 3ZD7A 4FWTA 1NVWQ 3ASZA 2ODBA 1T5IA 1YE8A 1YVDA 3TQFA 3WRYC 1OH8A 2VP5A 2FSIA 3JZAA 4HB2A 3AVTA 4HUTA 3VKGA 4Z1MD 1XDBA 4K46A 3GJ3A 2QM7A 1DOAA 1R0YA 3K70B 3B60A 4IOLA 3UATA 4G3XA 4DHEA 4F4JA 4EPVA 4PQYA 1R5OA 3TR0A 3OEHA 3O8DA 3JZMA 4ZCMA 4DKXA 3EIEA 3FOZA 1KK1A 3WHKA 1E96A 2CNWD 2FA9A 2DBYA 3O8RA 2WV9A 3C8UA 1QHSA 2GNOA 3UXMA 4EPYA 3ETLA 3I5XA 4DEXA 1Z8FA 1DELA 3QE0A 4FMDB 3TH5A 3A1VA 2J0SA 5J5CA 1OH6A 4D2IA 1I4TD 1FTNA 5FOWA 2GZDA 4B47A 2XX3A 1KKMA 5FBLB 3F5FA 3PFIA 4NCJA 2ZJYA 2DY1A 3KB2A 1MOZA 2QTFA 2OCBA 4LDJA 1E4YA 2ZQ5A 1OIVA 5C1BA 2IF0A 2ZYUX 5CIWA 3REGA 3EPJA 1Q1QA 4CVNA 4E03A 2O8DA 3HPQA 4CEJB 1ESMA 1X8JA 4ZCIA 1NBMD 4B48A 4EPRA 5B57C 1XU4A 4BQSA 3T15A 4D80A 4JBWA 4O0MA 1IY2A 4D0NA 4PC3A 2IYTA 1AQUA 1W5SA 1VCMA 4RD0A 4OQFA 1NVUQ 5G40A 4CRWB 1U8YA 5CLLA 3PJRA 2C9OA 1OE0A 3ASYA 2C8VA 4U5XA 3TK1A 2IXEA 3C5HA 2OBLA 4PSKA 4BFXA 1E69A 2CLDX 3AV0B 4DLTA 2BOVA 4PTLA 3DVLA 4YLGA 5SZHB 4EAQA 1KK3A 1MV5A 3NH9A 4HLQB 2AKAB 1TQDA 1FX0A 1OHHA 2GF9A 3A1SA 3QF7A 4LK2A 3NIBA 3BJIC 2BCJQ 8OHMA 2JLWA 5DYGA 1JECA 4LJ5A 2ZAMA 4M1YA 4TL8A 3B2EA 4Q7MB 3HJNA 2HF9A 3EZ2A 1TEXA 3MWYW 1N5KA 4LX0A 4DCNA 5E7IA 4E5UA 5F3WB 3L0OA 2BM1A 2ZSAA 1HUQA 5HE8A 1YZKA 3N2EA 1NN1A 2J0UA 4Q4LA 5LD2B 5J4HA 2C78A 2JDIA 4ERNA 4PPQA 4DLWA 1NKSA 2IUSA 3KKPA 3AVQA 4LYHA 3QF4B 1T8UA 4MRNA 2F43B 1D6JA 4TSFD 4KBGA 1OKKA 1U2RA 2C9CA 4ZDWA 1SKYB 4F91B 1WCV1 3DOFA 1W2HA 2X77A 3EWAA 2VIIA 3PG5A 3GLHB 1QVAA 4M1OA 2X8AA 4KSCA 1G7SA 3DKPA 4AG6A 2FGKA 1F5NA 2QA5A 5KSPA 3QXSA 4TMTA 3RS4A 4UNPA 1K5DA 3BK7A 4LJ4A 2ZJ8A 5AJXA 5JI2E 4QJ5A 1Y3AA 1LF5A 2KBFA 1WQ1R 1XCGB 2YYZA 3W6PA 4D81A 1N6RA 2OM2A 1Z2AA 2XNSA 2YINC 3NEYA 5JMTA 3ICEA 4TLDA 5FR1A 4DLVA 1J8MF 1EG7A 1JPJA 1KGDA 1G21E 2PLRA 1Z06A 2FX3A 4BFTA 1AQYA 2D4HA 3BB1A 2VF7A 2P6NA 2ZJAA 4L4UA 1OH7A 2O0KA 1YHNA 2I4IA 4JLKA 2VPPA 2ZI7A 4NL4H 4RJLA 4AC9A 2QTVB 3IIJA 2ZRJA 2JLUA 2EFHB 5EUMA 3WMEA 1SXJD 4KXFB 4U02A 3UG6A 2CVFA 5FL7A 3CRVA 3CW2A 3B1ZA 2VO1A 4LUCA 1NN3A 1U0HC 2XTZA 2ZI3A 1OKKD 2FDCA 3ZLJA 2BV3A 1GIAA 4AKIA 1OFUX 3EZFA 1K6MA 1M2OB 1JAHA 1Y63A 5B30A 2ZM5A 5AK0A 2R6GA 2QP9X 3C5CA 2PMKA 1ZP6A 3TIFA 1W36B 1PLKA 3GEEA 2OZEA 221PA 3THWB 4Q4AA 4DUGA 3AVYA 2RGEA 4EJSC 1FMJA 5C4GB 1IXZA 3VU9A 1P73A 1XXHB 2D74A 3TGPA 3WXMA 3MWLA 4B35A 2ZSEA 3TVTA 4JYCA 2QZ4A 2RGXA 1L2TA 2B92A 4IOKA 2V1UA 2FJUA 1E2PA 5IHPA 3RRZA 2WWHA 2GBLA 1RJ9B 2Q0HA 1WRBA 5FOTA 4I99A 2N1BA 3GJ7A 3KDSE 3B7GA 5J4KA 1QHYA 4IOMA 3B9PA 1E1RA 3S1AA 1BH2A 4OQLA 2HT6A 3EIHA 3SQXA 2O8BB 2ZVPX 1DARA 2QQEA 3HWSA 1O87A 2AKYA 3ADCA 1T91A 3EXAA 1U94A 1E9CA 2CEAA 3KX2A 2ZYTX 2E1RA 4BRWA 2A2ZA 4PHGA 5FOVA 2QAGA 1E9FA 1T3LA 1OIWA 3THYA 3B1WA 4IHQA 4OHZA 2XTNA 4A2QA 3QBVA 2H18A 4RCYA 4BLSA 3LRPA 3X1DA 5JJLA 3WMFA 4HAZA 4A0HA 2FZ4A 1NLFA 4M9SA 2EYQA 1IN8A 1G7TA 1LVGA 3NXSA 2PCJA 1LFDB 3GMTA 3CKLA 4QJ4A 5CDFA 1F6BA 4A0RA 1MO3A 3PITA 4I1VA 1G8HA 2AR7A 3U3JA 2QQ0A 5JHGB 4DSUA 1LB1B 5FPYA 1ZU4A 2VHUA 2ZRPA 5EUQB 4ACAA 3FFAA 4RY2A 1DG1G 1N5LA 2W6JD 2Z5FA 2ZPTX 2P0EA 3FWYA 1CJKC 1ZM4A 4IVPA 1QZXA 1W0JD 1KKLA 3UWOA 5BXQC 3KFVA 4HAUA 4JBYA 3NBXX 3L0IB 1E1RD 1EWQA 2QBYB 3MJRA 3TNFA 4B3BA 2OT3B 3BOSA 1ZBDA 2BHRA 3BH7A 3C14C 1XBTA 4QC2A 4CW7A 4A8JC 3Q9LA 1BS1A 1UBCA 4LRWA 4TMWA 4TZ0A 4W5JA 1XX6A 3A58B 3QEOA 4RD6A 2ASEA 2NTYC 3A4NA 2FH5B 4TYWA 2A5JA 5CLQA 1NG1A 1XEWX 2ZYVX 4QNMA 3AKCA 3CRW1 1PVOA 5FBVB 2CMKA 5FUXA 1F2TB 2QORA 4BECA 4DT1B 3GCGA 2ZRBA 3KJEA 1Q22A 2EWVA 3W6OA 1XJ0A 1R0WA 2QPOA 4Q9IA 3AVPA 3T06B 2REBA 4OK5A 5KNBA 3SU8A 3WBKA 4D0LB 3KQUA 1M7HA 1S9HA 3U7GA 4IRUB 4JZKA 1HH4A 1ZUNB 4YXWA 3THOA 1DPFA 1M6NA 1XB2A 1Z0DA 2OHFA 4M1KA 5FOSA 2R6FA 3WHLA 2F7SA 2XZLA 2XEXA 4MYUA 3OFND 4Z8YA 2FOLA 4ILEA 1WF3A 3PUYA 5BN3A 4UKDA 1E2EA 1G6HA 1Q44A 3HR8A 5FPSA 1G5PA 1AS0A 1R6BX 5EE1A 4MQBA 1II9A 1ZC4A 3DM9B 1HA3A 3MUFA 2EFCB 3G0HA 1QDEA 4GPTA 2V7QD 1FP7A 4LHYA 2WWGA 1ZYUA 2O0HA 2WJYA 3K9NA 3NDPA 5CYOA 2OFOA 2YOHA 3CR7A 1LV7A 4HB0A 2BEJA 2EW1A 4QHSA 3R8FA 1QHIA 4M2LA 3I3SR 1EX7A 2N42A 2PT7A 2G88A 2A78A 2C77A 5EZ6B 3FMPB 3LA6A 3V9PA 3QBTA 3ONWA 4MYTA 1NIJA 4JL6A 4ITRC 5JCPA 3WP1B 3CX7A 1Z28A 3PEWA 2GXAA 1VTKA 1GL7A 2YNMA 4B33A 2OSBA 3GPLA 1JR3E 4BFWA 2H16A 2HUPA 1US8B 1ETUA 4XTRA 1TUEA 4P3YA 2IYUA 3NWJA 1B23P 2XITA 3B1VA 2P65A 4MKGA 3CF2A 3SFVA 1Z0JA 2GCPA 4EPTA 1M7GA 5E7JA 3P27A 3U3OA 3KKNA 1BYIA 3RHFA 4D4MA 1C4OA 3AF0A 3TSZA 4A4DA 1N2CE 1DAIA 2ZSBA 4Q03A 4BLOA 4MA4A 3A1UA 2F43A 3AUYA 4CGZA 2FU5C 4KVAA 2CCGA 3IIMA 1Z63A 4PO8A 3GLHA 3K0CA 3OIVA 2RGGA 1SKQA 3AEZA 3AGQA 5DN6D 4XOIA 4TMVA 3B8HA 1NN5A 1FOEB 3ZQ6A 4QBFA 1Z0FA 2IEYA 2LKDA 4LBWA 3NHAA 5J4VA 1YZQA 1OB5A 4A0FA 2HYDA 3RWMB 2WZQA 4QJ3A 1FNMA 4LC1A 1SULA 1KY2A 1FL9A 3A4LA 4FMBB 5JCZA 4QL3A 4MDFA 4DLSA 2YWGA 1S96A 1Z6XA 1E0JA 4GOKA 1GUAA 2GTPA 2P6UA 2QRNA 3EWSA 5E95A 4BZPA 3DDCA 4MGIR 2H17A 2XZPA 3TAUA 3VR6A 4HAXA 1RC8A 2CCJA 2EWWA 2WSSD 4J0QA 5DI9A 2QE7A 5FUWA 4TL9A 4B2LA 5KDDA 2HLDA 1ZMXA 2ZRFA 4PZYA 4YMWA 3FKQA 1YKSA 2VHCA 5IDVA 3V4RA 4PC7A 1E9SA 5J4YA 1SGWA 3RWOA 3K0SA 3R9WA 1N0WA 2J3EA 5E3HA 3VR4A 4D82A 4BLPA 1PJRA 1S8FA 3BH0A 3KTAB 4M22A 1TQ6A 3V00A 1E2HA 1NMXA 5EXPA 4XJXA 4AYXA 2CL6X 2WJJA 3AP2A 2PH1A 3BB3A 3D31A 3PUWA 4PSAA 1NY5A 2IHYA 2FEMA 4NYJQ 1VHLA 3THWA 4Q48A 1OV4A 1G6OA 1N3BA 1RYFA 1H8HD 4R9UC 1M7BA 1XNJA 1XXHA 3BE4A 4C4PA 2JAQA 2QG6A 2IEZA 2ANCA 3QPVA 4KFTA 4LWZA 3KKQA 4G0NA 1TMKA 3KKOA 4F92B 1VG1A 4KODA 1L8QA 4HZUA 2CHVA 3AVUA 1OF1A 4EUNA 4QGAA 4KFSA 1EWRA 4TQUS 1RJ9A 1Z47A 1SXJB 3K09C 4LJAA 3IPYA 2JJ1A 4LHWA 4RZXA 1G8GA 2W6ID 3LXRA 3OEEA 4CEIB 5AJWA 5JBQA 4OHWA 1T4GA 4CYMA 2O8BA 2WKPA 3P4XA 3THXB 1N6IA 3TUIC 1AN0A 1F2UB 1YZGA 3Q7PA 4IOJA 3Q5DA 1ZCBA 3WYAA 3WYFA 2C96A 3RVBA 5HCIA 4Q9HA 4HAWA 5JRJA 3IILA 1G7RA 4POAA 4GDFA 1FPMA 3EC1A 1A2KC 1RFLA 2ORIA 1CR4A 2J7PD 2DFLA 1S3SA 5HCNA 1KI3A 4M9XA 2QU8A 2ZRKA 2BBOA 1QHHB 1YZNA 1Q57A 4Q4HB 3T1TA 1XPRA 1W36D 2AD5A 3QG1A 3UIEA 2F1RA 2FV8A 4PPNA 3RABA 1O3YA 1I2MA 3U3KA 3NHBA 1KAGA 1J90A 1MABA 5EE0A 3PVSA 1G3UA 1G7CA 2BMJA 1S1MA 4DB4A 3TMKA 5JS7A 3K0EA 3BGWA 2FPMA 4P4TA 2KWIA 3VX3A 3WNBA 1DAHA 4D25A 1FTSA 4DB2A 2ZRGA 2MMGA 4IDHA 4Q66C 2OAQ1 4OYHA 4A0GA 3FKSA 4URWR 2HJVA 1SHZA 3LLUA 1S4QA 2BEKA 2BCGY 3GJ8A 4F38A 4JVSB 3DO6A 1IJFA 2WVJA 1KI1A 1E2LA 1P9NA 3R20A 3TLXA 3ZVRA 1IJEA 1W0KD 1W5TA 2IT1A 4JYBA 1TPZA 2CXXA 2PZFA 1Z6TA 1OW3B 4ZPXA 2QN6A 2JATA 2NO9A 2WJVA 4YMSA 2A5YB 4B3XA 1UFQA 2SHKA 1G64A 3GJ0A 2PZEA 3WBJA 2ZE7A 2XTMA 2NPFA 1GP2A 1F2TA 1ZM7A 3QKUA 1LNZA 1LS1A 3LDAA 4DT1A 3FFBA 4HZIA 4B32A 4G01B 2IUUA 3OF5A 4Q19A 2C5LA 2XSZA 4TYQA 3ZZ0A 5KNCA 4IVQA 4II7A 1COWA 2OUKA 4RFSB 2FWRA 5DH9A 2O8FA 1UKEA 3AH8A 1HE1C 2BBSA 1HTWA 1R5NA 1Q21A 4WW0A 4Z1MA 1ANKA 3GLGB 1ZD8A 4LBYA 4AIIA 4Q1CA 3IGFA 4S35A 4JSYA 3I1FA 3SR0A 1D9XA 2V6JA 3GJXC 2VP2A 1VHTA 2FFBA 4RD4A 2JLXA 1P2UA 2GKSA 3PV0A 1YZUA 3AGPA 2CNWA 4DLUA 1N0VC 1W7AA 1QBKC 1FZQA 1TF5A 3AVXA 5DHAA 1AS2A 2J9RA 3EZ9A 4JLPA 1Z3IX 4P32A 2AHOA 2X2FA 1G291 4PPGA 4BPBA 3SZRA 3EASA 5FFMA 4LJ6A 2DFKB 2VQSA 3NH6A 3CPEA 4TZ6A 4Q1FA 4IJMA 1AGRA 1Z6GA 4OJKA 2QI9C 4QNRA 5L3VA 1A82A 4RCZA 3EPKA 3TUJC 2C99A 2R6DA 5KDOA 1FW6A 1US8A 521PA 2GCOB 4M9QA 4PQFA 4DXAA 1NBMA 4NCIA 4KO8A 4WIAA 1G4UR 1IN7A 2IK8A 1CJMA 3EAQA 5KO2A 1TX4B 5IRCD 4B74A 5C46F 3EIQA 1D2NA 5L3RA 3A8TA 2XGJA 5IF9A 4C7OB 421PA 2VEDA 1DVRA 1CR1A 2ZJ2A 1VECA 3W3AA 4AKGA 2WMNB 4X8OA 3G5UA 1XCPA 4AY2A 4HUQB 3QEJA 3G82C 4HLCA 5CDFE 2YV5A 2PJRA 2EFEB 5EQTA 1JR3D 2ZSDA 1U9IA 3IQXA 2OAP1 4PFSA 3LW7A 5KHOC 3SNHA 2WPDD 5IK2D 1PUJA 1JEDA 4Q1EA 2HV8A 1IXRC 1E9RA 4MKFA 3PUXA 2WBLC 2W2TA 4EDHA 2QGNA 4G5GA 4DCUA 1TUIA 1NMYA 1IONA 2I1QA 2WAXA 3CF6R 2Y8EA 4LYJA 5UKDA 2ORVA 4M1TA 4US1R 1ZAKA 4Q9KA 3KB1A 3UPUA 2CDNA 2DWPA 3ZD6A 4BLRA 2RGCA 1JXOA 4C0AC 4IXMA 2F6RA 2GILA 2R65A 1G8FA 4QHTA 5JWHA 5KSZA 3IIKA 4C3ZA 1BMFD 4I1OA 1UKZA 4HLDA 3CR8A 5A4JA 4TSFA 4OHYA 1UKVY 4OQNA 3ZVNA 2JLQA 1WB9A 1UDXA 2MSDB 2HEIA 4JLAA 1A7JA 1P7CA 1N6LA 3T35A 4WAUA 2GWHA 2O8CA 1BOFA 3IPXA 3KUDA 3QQ5A 3SFZA 5EE3A 3K8YA 1UBFA 3SI7A 4IFBA 4XIGS 4ASUD 3KTAA 5JWRA 3ZVLA 3AP1A 4WZBE 1FFHA 2IXGA 4OL0A 1WBBA 1KY3A 4HLUA 5DI3B 2ZI5A 2OESA 5H68A 3SHFA 3NBYC 4C0KA 4JMPA 1JQJC 1OXSC 4I1UA 5EP3A 3MG9A 4GP7A 3RRYA 2F3RA 3I32A 5JS8A 2YHSA 2RHMA 3NBFA 1B0UA 1W49A 2GF0A 3HPRA 1ZNYA 1ZW6A 1KSJA 4MRRA 3T1QA 1D8TA 1QVRA 1T0JB 2FN4A 5DLQC 5L3SA 1MO5A 2XOKD 2A5FA 1HT1E 3C7KA 4GI7A 3QKRB 4KAXA 1SXJA 4Q7LA 1KZGB 3ECCA 4B3GA 3NG1A 4RZ2A 3GP8A 4CEIA 3CH4B 3GFPA 4DIEA 2VYFA 5FBRB 4I1SA 3OIWA 1BYUA 3T1VA 5K8UA 2I3BA 3THXA 2PEZA 3ZVMA 2W83A 4JKIA 5KOYA 2JASA 3BS4A 1F2UA 2R6AA 2OFWA 2R62A 4EFMA 1DAKA 5EP4A 4X8LA 2ZI4A 1M34E 1U98A 3LVQE 5CITA 2CHGA 1GVNB 4Q00A 1RRCA 3AF2A 2YC4C 2AFHE 4TTRA 4UQOA 4IDNA 3M6AA 4TT3D 5BQ5A 2BVNA 4D26A 4H1UA 1TQ2A 1QHHA 2CLSA 3N5CA 4V0NA 1C9KA 3U7EB 4QG7A 4Q4HA 1SVOA 2ZITA 3ZZTA 2UKDA 2VP0A 2W2XA 3B1YA 2ZRDA 4R2HA 3I8XA 4AYTA 4JLBA 1LY1A 2MSEB 2RGAA 1SQ5A 2RGBA 4S2EA 2A7QA 1TF7A 3FMOB 4RSGA 3RDPA 1UF9A 3QIAA 4EQ6B 2Z4SA 2O8EB 4NYJR 1XTRA 3RAPR 3U7HB 4NYIR 1RE0A 2DFTA 3IQWA 3LBHA 4CIDA 1SKYE 3WMGA 5JJIA 4HATA 2FNAA 1XD2A 3KQNA 3EA5A 4JVNA 5CK5A 4KSBA 2JIZD 3ZYCA 2DB3A 1G8YA 3QY0A 4HAYA 3GEIA 3DOEA 3T34A 1VPLA 1GL6A 3MLEA 3TW4A 2CJWB 3IO5A 5LB2A 1WDTA 3NBZC 1G20E 4L16A 4ZO4A 3VAAA 1I4LD 1ZM3A 2ZRAA 2IXFA 3HDTA 3H2YA 3ADDA 3LX5A 1NSFA 4JSTA 1TU4A 3LD9A 4E09A 3BFVA 2KB0A 5BN5A 3GFTA 2NOAA 2IYSA 3RLFA 1KHTA 2GAAA 1VMAA 5F9HA 1W44A 2W6JA 3E5HA 2C04A 3A36A 3EC2A 3PQCA 2XJ9A 4W7SA 1W0JA 1YRBA 4RZUA 1ODFA 4YDHB 1G3RA 1QHGA 1KO4A 1UBEA 2ANBA 2C95A 3LH5A 4FW9A 4I4LA 4P4SB 4QBHA 2ERYA 4BZXA 1D9ZA 2DPXA 3GLGA 2NZ8A 2QP4A 1II8B 4N1AA 4HDCA 2XB2A 2QMOA 4H9GA 4ZV4A 1NMZA 4B3CA 3GJ4A 1GRQA 2XJ4A 3AUXA 2P5TB 1QG2A 4PC1A 1XCMA 1JPNA 3I62A 3CB4A 4DLZA 1E2JA 3LQRA 1BIFA 2GBLC 4CZ2A 1MR3F 4BFYA 2RH5A 3QXHA 1NN0A 1XXHE 5CJ2A 3Q7QA 3K0FB 3KFXA 5BW8A 3KZ1E 2HXYA 1KDOA 2OCAA 1EFRD 1XJQA 2R6CA 2NPIA 3O47A 4DBLC 3LAWA 1UM8A 4IVRA 3L43A 2AWNA 3EX7C 1X6VA 4BE7B 4PC6A 2QGZA 2KJQA 4AWXA 1Q1EA 3SBDA 2RKOA 2AXNA 2HYIC 1IN5A 3GLIB 4UJ5A 2QAGC 2B21A 2BWJA 3B78A 2GEDA 3OFNA 3U6KA 1U8AA 2Z0MA 5GJBA 1NRJB 4KCGA 4JT2A 1FQKA 4LOAA 4RVCA 4MH0R 4URUR 2GCOA 2ATVA 2H8KA 2J0VA 3ZIAD 4AURA 1Z83A 3TRFA 3HR7A 1T0HB 2GDJA 2V7QA 2IYWA 4A6XA 5B58C 3VNVA 5CB6A 1XEFA 2Q6TA 3K1JA 2YC2C 1EX6A 2ZJ5A 1KDTA 1P2VA 3LW8A 3TKLA 2V4ZA 1X1SA 2CL7X 4XWAA 4B3FX 2F1IA 4NH0A 1TF2A 3D8BA 4HUQA 2VTKA 5AJVB 5JEEA 2JLVA 1E2GA 4P31A 1K8RA 1CJVC 1WE2A 1HT2E 2EFGA 2FFQA 2ORWA 3TSOA 3B5JA 4HDOB 1YR6A 4N3NA 2B8WA 2ZE6A 5EZ5A 2G6BA 3SE0A 2DWQA 1E2NA 2QEQA 2VSFA 3TUZC 3K70C 2P3SA 4TMKA 4X8MA 2WOJA 4D6PA 1NJGA 2QROA 1X86B 2D3WA 4P4UA 5FH9A 1N5JA 2H1LA 1G3MA 1GKUB 1J8YF 1RIFA 2AD1A 4RD1A 1U90A 3T1OA 2QTHA 5AJYA 1G5TA 4M9ZA 2WJGA 4PO9A 5FPTA 3F0TA 5GADl 3OAAD 1DADA 4CEJA 1OH5A 3UG7A 3WNDA 3K0AB 1SVWA 2QT0A 2ZJBA 1YQTA 3W90A 2J7KA 4LSGA 3X1XA 3VKHA 2ZEJA 3E70C 3GFOA 5FTKA 2OLJA 1YR8A 4WBSA 2L0XA 1W47A 1E4VA 4TLBA 1N6KA 4LJ9A 3KXLA 4EIWA 3SYKA 1L4YA 1DTSA 1I2DA 1R7RA 1YJ5A 1G16A 3OIYA 4XH9B 4Q1BA 3VNUA 4QGFA 2WAYA 2B6HA 2ZAOA 3PCRB 2AN9A 1F3OA 2I1VB 2JJ8A 5DN6A 4TLCA 2Q3MA 2WIBA 1P2SA 3AF1A 4NCHA 1DO0A 5EXSA 1EESA 4LCBA 3MGCA 4JL8A 1JB1A 1J70A 3NC0C 1GWNA 3NEJA 2UVQA 5JSZB 2KSQA 4JLVA 1NKTA 1CEEA 2AK2A 2QSZA 4XVQA 4HYYA 3CWQA 1ZNWA 5DI3A 3RS3A 3TR5A 4ZI2A 4JBXA 2NO7A 1KYIA 1R2QA 3CONA 4EPWA 1GTVA 1XMVA 1ZJ6A 2YWEA 4DDUA 1KO1A 4CEHB 5FOXA 3EW9A 2WOOA 1TEVA 1D2EA 1CS4C 1U81A 1KTVA 2WIAA 4V02A 4BLTA 5HKKD 1A1VA 3AQ4A 3MRSA 1G17A 3FTQA 3PIRA 1MKYA 1YR9A 1KSGA 4TWZA 2J5XA 5JI3E 2G83A 4KI0A 2JEOA 1KDPA 2FSGA 2WSSA 1UADA 2WSMA 4TQ9A 1V43A 1KJWA 1XTQA 2O5VA 4PO1A 6Q21A 3QF4A 5FTNA 1G41A 2VSXA 3I72A 3I92A 3DZDA 3IDQA 2H5EA 4QHYA 1JXMA 4L9SA 1AS3A 4KFUA 5K8IA 3IKJA 4RKEA 4UNNA 2EYUA 2CCKA 4WZAE 3VFDA 4NHOA 4PANA 2HJGA 3BERA 4MGZR 4BEJA 1ELOA 1GRRA 5DHFA 2NIPA 4DLRA 3KXIA 5LD2C 4Y0VA 3U5ZB 1W4RA 4TQAA 1KI2A 1H8HA 3SYLA 3B82A 3A1WA 1TTTA 3ICQB 4NU0A 2QT1A 1P2TA 2RGDA 4B73A 2EVWX 1CTQA 1NBME 3PUZA 1E6CA 4OK6A 2QMUA 3L8ZA 3T5DA 5GJWC 4CF7A 4LHVA 3BXZA 3MFYA 1AGPA 4OBEA 4OI4A 1GSIA 3F8TA 5F2EA 1Q1BA 2VHJA 3K0CC 2W6IA 2ZRCA 3MWJA 3GLFB 2WWIA 2C2HA 2ZR7A 4EQ6A 2V3CC 3X1WA 1YZTA 2PZGA 3FHOA 5C4MA 2O8EA 1XFAA 2NO1A 1NLZA 4AG5A 2MMCA 2KBEA 5C2JB 1AZSC 3CNOA 1XF9A 3RS5A 2JCSA 1Q3TA 3KKMA 4A2WA 2D2EA 4YQFA 1MRNA 1OFTA 2PX0A 5P21A 2G0NA 4N0EA 5FTMA 2O8DB 2ZJOA 2Q9BA 3VR2A 3TJZA 4IEEA 4KLZA 4C2TA 2ZJZA 1CU1A 3FMFA 3CLVA 4ZI3A 1W1WA 2J7PA 3FB4A 3HU2A 3P4YA 2GCNA 4AYWA 4DDVA 5FBWB 3DM5A 4M8NE 2CJWA 1S0UA 5FUYA 1N6HA 1PUIA 2ZRHA 3B1XA 821PA 4F7WA 1OJLA 1A5TA 3B85A 2CLCX 4C0LA 2PLFA 3SS8A 2QY9A 1NP6A 3KQHA 5KPDA 4NYIQ 3ZQJA 1XRJA 4OI2A 2DYKA 5SZJA 4BASA 5L3QB 4QBIA 1RZ3A 1IOZA 2ZANA 4Q02A 2NG1A 1XTJA 3U44B 3D6TB 2CK3D 1ZD9A 3EARA 2QMHA 5TV2A 4K8OA 3R8CA 1AK2A 1HQCA 2GJAA 3AKDA 4V0KA 4HAVA 1E0AA 2WJIA 1RYHA 1Z6AA 4E07A 3I5YA 4A92A 3WRXC 3DKVA 3M1IA 2QNRA 1UEIA 4WZ6A 2BBWA 1DAMA 4P4SA 2BC9A
chains in the Genus database with same CATH superfamily
3CRRA 1QF7A 1AV6A 3A4MA 3DC7A 4LF4B 4Y2HA 3SG0A 2R7RA 4MYRA 4U7DA 4IDPA 4ZEWA 3F78A 3VGJA 2Y1XA 1L7PA 3TPCA 2LD6A 4PZZA 1XRMA 1EJ2A 1DV2A 4QGGA 4JROA 4BX0A 3SZGA 2FK8A 4L15A 3UHOA 1TZCA 3K96A 3A14A 3T61A 2P6VA 3OE4A 1DT3A 1EK0A 3ILVA 5C8VA 4JLDA 3TCNA 4NYMR 1ONBA 5M5BA 3U5TA 4M36A 4HX2A 4L08A 4M60A 1EGAA 2PWYA 2Q9CA 1ZM2A 2C7PA 4E5YA 2NU8A 4FESA 2I4RA 3UJBA 1EEHA 4PX9A 4RD2A 4EF6A 4IWBA 5A0FA 2WTBA 4G81A 2OB2A 2C2KA 3NTRA 1HQYE 1XLUA 3ZE8A 4JAVC 4NG4A 4WESB 5DCYA 2OBMA 4ZOCA 1JEOA 2G4CA 5LA6F 2G70A 1WXXA 2AH5A 1FFCA 1NF3A 4V3CA 5A7HA 2QJFA 4E0HA 4JI2B 4K86A 4PPFA 3DS8A 3GLGE 1KI6B 3CV3A 1RTTA 1FP6A 1KAOA 2JLBA 4E21A 1TRHA 2R8EA 5BOSB 4NQFA 1CZHA 2XUFA 3EPLA 5LR6A 5TQVA 1IXYA 5GIOE 2CBZA 3LOPA 3W5BA 3QFTA 1ZCZA 5G41A 1N1DA 3OWTA 4YASA 3VMFA 2JIRA 3LPAA 2C31A 4XD7D 1P6XA 3LF2A 1TKRA 5K8LA 4IDQA 4UD2A 5DGTA 1ZCJA 4DMKA 3OHSX 4OVKA 4OTZA 2J33A 5EHNA 1GZUA 4WZBB 2P9ZA 1KP9A 4S1PA 3BZUA 4PF1A 5B5SA 2N9UA 4MYHA 4B2PA 2P11A 4XX1A 1NFOA 2F3QA 4XQ1A 4WA8A 3W2FA 3IODA 4GPD1 4A1FA 1R8SA 4EDFA 1DX9A 3CT4A 4BQPA 5ALFA 1U3DA 3A3PA 2CLOB 3SIPA 2YXBA 3N70A 4TTJA 4DC9A 2GPAA 2ZP1A 4Y9TA 1Z0UA 1RC1A 3JZ0A 4HNRA 4OIOF 2XLOA 1MO4A 1V1JA 5M04A 3ZTWA 2EZ9A 2FFHA 2NZJA 3RASA 4DIDA 1HURA 4HADA 1XIVA 3W7VA 2J1LA 3K1IA 1UWKA 3J81A 4P7FA 4FJ1A 3PZBA 1KAEA 1M67A 1O4VA 4NDZA 1ZISA 1VRVA 3OQVA 3CAXA 3KQWA 3TOZA 1E2BA 2VPTA 4R9RA 1IN6A 1CX9B 1LM3B 2UYQA 2C92A 4JK3A 3PD7A 2YZNA 2VRBA 2G4VA 3GR6A 2F1JA 3N0TA 1M1YE 3AV3A 1ZHWA 4BNDB 4JLSA 2IXDA 1EAYA 3DL4A 2QX6A 4PPYA 1DDOA 5CVEA 3AUUA 4WESA 1IK4A 2YOFA 4ZEOA 2I3AA 5ERGB 3OX3A 1JXAA 4GHWA 1JG2A 1PUXA 5KIAA 5SY4A 2H0QA 2JD2A 1RTKA 3IUMA 2CVOA 2QYSA 4MWEA 2Y1DA 1G18A 1KI6A 3QVUA 4PXSA 4RGVA 2NPUA 1P5JA 5KJEA 2IA5A 5BOSA 3H99A 4DTIA 1NR1A 2C9YA 5B55A 3BBPA 3OF3A 4HGRA 3WAGA 3IT3A 2JK1A 3I64A 3UV3A 3I9V6 5JZSA 3NKDA 4KNYA 4C0JA 2R7SA 3VZBA 4MJ7A 1YFZA 4WZBA 1ORIA 3ASOC 3L3BA 3STXA 3G4XA 3L1IA 3COPA 4GC5A 5F76A 4V0ME 4Z99A 4FKBA 1G5IA 1FS6A 1YHYA 4PYKA 4KPFC 3VNSA 4OX9B 4ZA2A 5D85A 3T6KA 5ALKA 1T5TA 1XMQB 3ZI7A 1XVLA 2ZCUA 1AGYA 4YCBA 3DFZA 1PSWA 4MV6A 3A6ZA 4QPNA 1XZNA 4GMXA 2ZUCA 4M55A 2WG0A 4R98A 1DFHA 3H7IA 3PXEA 1I8TA 3NTLA 3CT6A 2WJ3A 2P69A 1CGOA 2X4LA 2ZDGA 1SU7A 3EEQA 4CIXA 4ZK6A 3LCJA 1AUVA 3L8YA 4GMDA 2PTHA 1Y3DE 5L0FA 1QH0A 2XUKA 3NYWA 4OHCA 3OU6A 1IZ8A 4Q39A 2YNMD 3TCXB 3WL3A 4BNUA 1G8SA 1UBHS 1ZIDA 3HGTA 5AHXA 4F60A 4F4IA 1TUGA 3ZZUA 1B16A 5K3EA 2O8CB 4AJPA 1KVUA 2FUG1 6REQB 4PG8A 3OBBA 1O6GA 4JGBA 1RPZA 4Q24A 4BNDA 2JCVA 3OD1A 4C0HA 3U62A 2IWRA 2YN0A 1GDDA 2VNIA 4MW9A 2IXNA 1JP7A 3RSLA 1OW7A 1L5QA 5CH5A 3QPWA 3VR6D 2HXSA 2AJTA 1MLDA 3OCWA 4MJLA 5IBCA 4IEIA 2AI3A 3GFQA 5DNDA 2V6BA 1DMSA 2GETA 2O3QA 1CUCA 1I4WA 2XMPA 4L3OA 1JFTA 1BA3A 4HFMA 5G02A 5AGFA 4KMSA 4OD5A 4CN9A 1I7SB 1ULUA 4N7BA 5LMUB 3CPJB 1JA1A 4Z4CA 2TSYB 2NNWB 3JTEA 1WZUA 3AFNA 4PZ0A 1IZ9A 5LPNA 2OVFA 3D0RA 2WSLA 1ZJ5A 1DCTA 1WEHA 2BZSA 4R8KA 1QGUB 4JL5A 1JTFA 4G9BA 4OP3A 4GP6A 3D64A 4OQZA 3R3JA 4FKZA 3CC8A 3TLKA 3OHMA 4EO9A 4O63O 4ZO8A 5B7NA 1OZ0A 4PWZA 4CF4A 2EG5A 4AW9A 5EG5A 1M83A 3SIXA 2YL3A 1I2ZA 4XD7A 3M6FA 2I7VA 1NQWA 2M2IA 2X51A 2WSIA 4MWGA 4Y0AA 1XR3A 2GK7A 2G04A 2FAPB 1JKXA 1IUPA 2QLLA 1H6BA 3W4JA 2H5LA 5DQZA 3AM4A 1FDTA 1UDAA 4E11A 2V8OA 4YP7A 4HS9A 5FA6A 2ODBA 5A6BD 3M33A 5M34A 3TPFA 1UANA 3B60A 3FWPA 1JH8A 1KBOA 1EDBA 4ZCMA 1X80B 1LDYA 1OW6A 4DADA 2O5EA 4MUYA 5HBRA 5C7YA 3IHUA 1A76A 2J6HA 3SKXA 4QIHA 1UPAA 4AL4A 1E6KA 1A69A 3WSVA 2XX3A 1QO0D 2A9VA 4HWGA 3CZMA 4ML3A 4S05A 1H7IA 4J9UE 1F8UA 4D9JA 4Z4FA 1UBLS 4YL3A 1NBMD 5B57C 3CYFA 2WF5A 3IEMA 1OLUB 1B6TA 3LF1A 2C9OA 5K99A 3RJ9A 3K05A 5AXAA 4DLTA 6REQA 3HDQA 1XTZA 1Y9EA 4C6TA 2EHDA 3NEAA 1EAMA 1WPGA 2X3UA 1NN1A 4FEEA 1S6YA 4BHTA 5LD2B 1J39A 1P0QA 4RTOA 4PPQA 4BO9A 2IVFA 2IYOA 2NSFA 4YUAA 4RK6A 9LDBA 4H7DA 5A6KA 1F5NA 4JP5A 4TMTA 2IPOA 1QORA 4RQUA 4AP6A 4LJ4A 3ZY5A 1OXKB 5BSEA 1XVAA 2QD4A 1Z2AA 1FTYA 1KYYA 1N3IA 4NXNB 5C5CA 3DAHA 1LPSA 3SC6A 2VPPA 4QELA 2HSGA 4UARA 4OX9Y 2DGDA 4S0ZA 4G6ZA 3ET5A 3EY4A 5CA0F 3HNOA 2IQIA 1S7CA 3EZFA 1K6MA 1M2OB 2V3VA 2AG1A 4MTOA 3A06A 3TIFA 1X1AA 1QGUA 2XVAA 2OYSA 3O31A 2D74A 2EPOA 3G2QA 3QEAZ 2WWHA 1YZHA 1NHGA 1XZ8A 2Z98A 5AW8A 3HZOA 3KDSE 1FRNA 5EFZA 3DL2A 1H4TA 1A2OA 1PK7A 5FV7A 4J91A 2RC5A 1T3LA 1RYMA 4FS8A 2BFEB 3HV2A 4IHQA 3WMFA 3DYBA 3MW8A 3ESBA 1IN8A 3Q1LA 3SXUB 1HNXB 2PSHA 3CKLA 1GAWA 1PJ3A 4NJOA 3UGJA 3WMWA 5J3JA 3MC1A 2HQBA 1XZMA 1X38A 4OATA 1N7GA 1GZ7A 4N18A 3V8RA 1FLVA 3A9VA 5COBA 3CRW1 4NY3A 3GCGA 3ONDA 1R0WA 4F97A 3EVAA 5AW1A 3T9FA 3AERB 2REBA 4IRUB 1Z0DA 1XB2A 3I9OA 2OHFA 3TM5A 3MJSA 5PGMA 1L9XA 1ZD3A 1BDIA 1G6HA 1RZRD 3DM9B 4TTIA 4D9BA 3FROA 1KA9H 2AJCA 3SGLA 1OLUA 3RVJA 3EBLA 4FAPB 1NVEA 2C77A 1KHHA 3FMPB 2AG0A 2YDXA 3F1KA 2VTBA 3PMRA 4OJYA 3VV3A 1HOTA 2YNMA 3AM5A 4JMLA 4C4XA 1Y6GA 4GYTA 1ETUA 3I1JA 4HJRA 2ADOA 4MRMB 2PX8A 3B1VA 4F04A 5AOCA 4IZHA 2VNJA 3LP5A 4FSDA 3K0KA 1OASA 3TRKA 2CNBA 4J2TA 2QR2A 1Z63A 3KXDA 2NWQA 2RGGA 2O1EA 3MAGA 5ELMA 1FOEB 2NZUG 4RMJA 3NHAA 5J4VA 1PHPA 4IIBA 4B7UA 4A0FA 2HYDA 1N9GB 3A4LA 7ADHA 1USUA 4H4KC 1GUAA 1GQQA 1ZL0A 1A9TA 3DAYA 3VR6A 4HAXA 1WXEA 4TYMA 4JUBA 3DEAA 4N82A 3GFRA 1Y1LA 2XUJA 2EKZA 2H4XA 1NMXA 3AP2A 4LSWA 2CMDA 2Z2YA 4DA8A 2HRRA 5WRFA 2VJYA 4LWZA 3KKOA 4QGAA 4TRMA 2P2NA 2XHZA 5JYDA 3UT5B 2ECOA 1ZCFA 3NNDA 2WKPA 3E05A 1V9CA 2X0RA 4KE7A 4IOJA 2YIJA 4Q9HA 4QLBA 4GOLD 2BFEA 1FPMA 2PHZA 3I3OA 2V5AA 1YZNA 1Q57A 2E18A 4F9TA 3SXUA 1PNRA 1QP0A 4HOYA 2FV8A 2CLLB 3SS7X 1H2FA 1T2FA 1XZIA 1OAOA 5ALMA 4WNIA 4K6CA 3SHVA 4F38A 3KDAA 1P9NA 4ZTUB 1P2DA 3ZVRA 4UBMA 5JAHA 1Z6TA 2HHHB 4WXYB 1ZMOA 4JNCA 3LNRA 1TECE 1OU0A 1OR3A 4B32A 4MPTA 5F5LA 4BDSA 1QAQA 1CPRA 4GZ6A 2L7AA 2FEXA 4IRUA 4UUPA 1X1BA 1FU7A 2BF7A 5A6BA 5CH8A 1HTWA 4X93A 4UEWA 2RJNA 5FKJA 3GLGB 3D6JA 4DV3B 4CG1A 1RKQA 4NEQA 5GONF 3RCBA 3A6LA 3VAYA 4XPZA 1AXGA 2PZBA 1DBPA 1U3TA 3TINA 3ZDLA 1LDEA 3NAQA 4IB4A 1S7ZA 4ZRNA 4NVRA 4LVNA 1SZCA 1QO0A 2JZNA 2QUPA 5K3BA 1XAJA 4FD3A 4QD3A 1X87A 2WZLA 3DJNB 1NBMA 4MRMA 3EAQA 4Q1VA 5EQDA 1U7OA 4C7OB 3UMJA 421PA 3CHYA 4HUQB 3CGWA 1LK7A 2HKVA 2JFYA 4Q1EA 1FFDA 1Q84A 1QRRA 4LW8A 2XCUA 4GM1A 4TLMB 1Q1AA 2XKBA 2YJNA 2PBLA 4OD0A 2E37A 3STHA 2YZGA 1JVSA 1QOZA 3S2ZA 2HHCA 3CR8A 1D1BA 3UH1A 4OQNA 3GLQA 3WXBA 2I7TA 2XCRB 2G25A 3TSYA 3WHNA 1RJEA 1YQUA 1CEYA 2B8EA 3MT8A 3RW0A 3U37A 1EVJA 4UZEA 1SUWA 5HKOA 1BOOA 1UMBB 3JY6A 5J43A 1W49A 1V48A 4BFLA 3CEXA 4GI7A 2KX7A 3D7KA 2Z1DA 3UT5A 1YL5A 3NG1A 3VOSA 2QY6A 1TD1A 3O4HA 1SIWA 2WB2A 3WQRA 4AN0A 2EGUA 1P0IA 1XSEA 1PT9A 5BQ5A 4N3CA 2UKDA 3C3YA 4P93A 4WINA 1I5OA 5KVAA 3TEJA 4JLBA 2RGBA 3IVMA 2X5NA 3KZOA 4LVCA 1UF9A 1R18A 1HZZC 2IEGA 4EEZA 1M1YB 1RE0A 4QT0A 4QRIA 5EIAA 1I94B 3NWBA 1QFYA 1G8YA 4HAYA 5THXA 4YCLA 1R0KA 3AG5A 4OAPA 9MHTA 1G20E 2X40A 1W96A 1IUOA 1EG2A 2GZMA 2XT6A 5JATA 3F49S 4CQMD 5JD5A 3DWEX 1ODFA 1FK8A 4FW9A 4CF5A 5EZSA 1WUKS 4O4HB 3GLGA 2DBVO 3WS7A 4PG4A 1ECFA 3SF0A 2QR3A 3PFHA 4ND7A 3GJ4A 3WVNA 2QTCA 5BRAA 3VOTA 1XNRB 3IBCA 3J7AC 4GX1A 4LJSA 3QMKA 3BVPA 3L6OO 4PN3A 2R6CA 1XJQA 2NPIA 5T4EA 4D3XA 3EX7C 3TQHA 5E2IA 4AWXA 4RYLA 1RZRA 4BMSA 3FB1A 3ZIAD 3WSTA 2C54A 4ENVA 3IALA 4ITUA 5LXTB 1XEFA 3ZE0B 4CQLB 4HUQA 1E2GA 2X2PA 1WE2A 3W9SA 2GHQA 2FFQA 4JEUA 3ESXA 5G4LA 1AG9A 4EMSA 3IP7A 5HKLA 1ZMBA 3UWPA 1ZRNA 3COYA 4NENB 1XDUA 1KWKA 3GFOA 2ASVA 1R7RA 4PM4A 1I0LA 2ZAOA 3TLYA 4RK5A 3B36A 3QEBZ 1OQAA 2G9VA 2VWHA 4JBXA 1KJIA 4J43A 3OPYI 3TULA 1PFWA 2NZ2A 3EGIA 3PKZA 2D6FA 1UMBA 1NQ5A 3KK0A 3KJNA 3QFCA 3TD6A 4DL9A 3DZDA 4LF5B 2H5IA 1TYEB 3ED5A 2WZBA 2MSLA 3GUHA 3BERA 2JHFA 4WCDA 4N3GA 4PAWA 4NU0A 5LLTA 2PLWA 3ES9A 4CF7A 1DHRA 3HJGA 1JQEA 4LRTB 3F8TA 1IZYA 2JHCA 1GZ4A 3GMIA 4ZMRA 2E6KA 4O4LF 4UW9A 1YZTA 1XFAA 4OKIA 3HEMA 5AYVA 1FMWA 1M1YA 4PS1A 1G2QA 1GQFA 1Z12A 3EHEA 3EK2A 1S0UA 5SICE 1GU0A 3B85A 1NP6A 3SHQA 2YS6A 2EIJC 2Q45A 3DLHA 1FYEA 1W6RA 4ALNA 1TPYA 4JJFA 5AVYA 2ZIGA 4V0KA 1UBTS 3B0VC 4HAVA 1XZKA 4DPMA 3O93A 3DKVA 1UEIA 4YAUA 1Q0MA 1DJOA 2Q50A 1DOVA 5KTNA 1TLLA 1HMYA 1U0TA 1DC6A 1BVYF 4LZWA 4PXAA 4RVUA 2OHVA 4YRNA 4E17A 2ZJ1A 1MOPA 4CQMB 1LS6A 2HI0A 1UCFA 4ZLDA 3H0KA 1N2IA 2WB7A 5KNDD 4YK5A 3SEZA 4Q7JB 2QBYA 3LPDA 4EPXA 5LXTA 1H1TA 4IPTA 1JMKC 2Y3HA 4CQLA 2BM0A 4GOXA 3K9LA 3E53A 4AQDA 4Y1RA 4FU0A 4NTZA 2FSPA 4W7IA 4GMGA 3MXTA 1A9QA 1MORA 3B6KA 4X0EA 3VF0A 3HYLA 2A5DA 5TEVA 3WLHA 4F12A 4V0MA 3NCTA 3U3FA 1F4PA 4TTPA 3M4YA 3ND8A 2DBRA 2DPMA 4NENA 3ZDFA 4G1EB 5BYBA 4OHXA 1E79D 4D0GA 3EVTA 1BDJA 4UU1A 4BNHA 5CCEA 4DCJA 2GZSA 4Y6SA 2GASA 1T6BY 3T9EA 3K15A 4HBGA 1N5IA 1WDMA 4FZ5A 4MV9A 3F9CA 3FJYA 1FJHA 1EVYA 3OUUA 1MO2A 3OTGA 4QA9A 4I6GA 2OCKA 3RFCA 2ZU0C 2Q1UA 1T4MA 3F96A 4BUZA 5I7RA 2BE9A 3M4ZA 4FGWA 5B1YA 4IS2A 4MQ4A 5CEFA 2RHJA 3KLNA 3BIJA 4RZIA 3QMPA 1Z2NX 3LC0A 5F7JA 3QZUA 4KR0A 3QKTA 3ABRB 1UP6A 4ZT3A 3D7RA 3KOMA 5L9AA 5DGDA 3NKEA 4L50A 5JE8A 3RLIA 1RPTA 5JMPA 2VJAA 1G2IA 1H9AA 4Q4JB 2O1XA 3RQGA 4G8BA 4GQIA 4DMUB 2BGIA 3WADA 4XM0A 1J20A 1VLVA 1BKDR 4GRIA 3DEJA 5HXAA 5HDBB 4C5BA 2DX7A 3H2IA 2GD2A 2Q3BA 4RPJA 4JR0A 4JJ4A 4EI9A 2M9MA 3VU1A 2ZVDA 2QRZA 4QJBA 3O8BA 3A1TA 1RQ2A 2X8JB 1C0LA 2XE4A 3G1TA 1GXSB 3SHTA 3EGEA 3L1JA 4GR9A 4O2AB 3AVVA 2ERXA 1JWBB 1AQ6A 3UB3A 4MW2A 5KCMA 4ZVMA 4TMZA 1GG5A 2PH7A 1ESNA 1YULA 3ICOA 1V3TA 2BH2A 4P2BA 4XRRA 3L1VA 5TVGA 5FQOA 3QMWA 1FYDA 4CQMA 2ZROA 4XWOA 3L46A 2YJ6A 5K20A 4B40A 3MYIA 4LC9A 2C5AA 3QPBA 2OXRA 1EX9A 3UBTA 1MO6A 3L8IA 3F73A 1IXSB 1XMJA 4IKPA 3OP1A 3EMBA 1XFDA 4GEKA 1I2AA 4JQCA 4EHBA 3ETCA 2QZSA 2OR3A 2PGLA 2WF9A 2XQIA 3ZIAA 1VHJA 3AF3A 1TO2E 3ZI0A 4A3SA 3IQ5A 3OU2A 4LERA 1K1EA 1Y9ZA 1IHUA 1NVGA 2VCBA 3EA0A 1XYVA 3N2LA 4F86A 4MS3A 4FWBA 1T1JA 1J0EA 2FN9A 4RORA 4RJTA 3V4FA 4XPYA 3IEEA 1LTQA 1SN7A 2Y3DA 4C04A 3Q11A 1UQUA 2X1MA 3WC4A 4ESVA 1W48A 4N0MA 1JGTA 2JEZA 1ITZA 3PKIA 3H4MA 1F0KA 1RQXA 1BQ3A 2JGNA 5TDHA 2QAJA 4ARSA 4FN4A 1D4AA 4IHKA 3ZY3A 3BTOA 4XM2A 5CNMA 2FX5A 1KVSA 1M2WA 2RBEA 2NSGA 3EEIA 3PCTA 2WG2A 3UMRA 1OFUA 2YKGA 2XL8A 3OKAA 4Q4JA 4XA8A 2W0MA 3MELA 4JEMA 1KJQA 3HYTA 5CP8A 2UZIR 3SDBA 4UMDA 4LPKA 3SQWA 2O0JA 2XQGA 2YW2A 4KOAA 2HA0A 5AJZA 2IYYA 1NLYA 3ITFA 3O39A 5GVRA 2X8LA 4I6JA 1NX9A 2VK1A 3O1HB 1YMQA 1LGYA 1P29A 4N0DA 3CJQA 2Q4OA 3CX8A 1XZBA 4WZAB 3QKRA 3UJHA 4BG0A 2X8JA 4YXWD 3E8SA 1GXSA 1FTQA 4NOMA 4O2AA 4O1IA 1CIPA 4I8XA 1VE9A 1TUBB 3MQFA 2P27A 4FCTA 4LJKA 3VSCA 4WFQA 2JI6A 1O0SA 2JFPA 3PPYA 1LVHA 4XASA 1U3GA 3RU7A 4Z7JA 4XDYA 1JYSA 4FMCF 2D54A 1VCNA 1CULC 3IAM1 3R3SA 3N7AA 1Y1SA 1FAPB 4TS3A 1KDVA 3OT1A 2X13A 2JGAA 1TCUA 1HETA 5ICEA 1EE1A 1E0DA 1AUXA 3UMYA 2IHTA 1QNFA 4MI3A 5DBFA 4PEVA 3GEDA 2X9GA 3FR7A 4DA9A 1H6AA 5A5EA 4BRZA 3MT7A 1WP9A 3PC8A 1BTOA 3T7IA 4FZJA 3H8SA 2NZVG 5KNDA 4LGCA 1SU8A 5LDDC 3GXBA 3KNZA 4QUHA 4BO6A 1V7CA 2JKYA 3ITKA 3R5XA 2A69F 4KHZA 4NAUA 4KRGA 1ZEMA 4F71A 3R3VA 1W5EA 1W46A 4RGQA 4KGXA 4KNWA 4PYNA 2P9HA 1O95C 1WVGA 1E79A 2PT5A 2WJHA 3LX6A 1WW2A 2OYCA 2FSVA 2VUUA 4RM2A 1BKYA 3OCYA 4CFSA 4JKOA 2AC7A 1PWHA 1H2ZA 3EXFA 1WBDA 3N24A 1EK6A 1QG4A 5LYJF 1FUIA 3EEFA 4L22A 2QVXX 2PQ2A 3ABQB 1NVMB 1Z7BA 5LM3A 1E8MA 3Q7TA 2O2JA 4EG4A 4NARA 3AQIA 3V4OA 1TTHA 1VE5A 1UAAA 3LLKA 2QAGB 2CYDA 5KUTA 2EBUA 3KEOA 3C15C 4LY9A 4AICA 3Q6NA 4F8YA 2IYXA 1QP7A 1RRMA 4J7YA 3LJKA 1JG6A 5ARDA 4WZAA 2QRQA 4H7EA 3QJYA 5DPMA 2BEVA 3NHKA 4UATA 3OSZA 3DFIA 3WI7A 4XVCA 4FWTA 4AWBA 1LV8A 1WW8A 2FSIA 3DH0A 1IATA 1ZHXA 5JAUA 4Z1MD 4EKYA 1TVKB 3PXUA 4OQ4A 1XCLA 4F4JA 2OXEA 4G4JA 1TUBA 4U9EA 5K8CA 4E3WA 3OUTA 2G08A 2VXOA 3ND5A 3G2JA 3RIEA 2H8GA 1DO8A 4U5BE 4FMDB 4O33A 4HH1A 1OH6A 3BXGA 1T5BA 2QZZA 4L4SA 1E1LA 4KIWA 1MN6A 2ZQ5A 3Q3VA 4C05A 1EQ2A 4K9OA 2AVNA 4WJZA 2AFIB 1P7WA 3EPJA 4H16A 4WSOA 1MJGA 5EI5A 2GERA 1MPXA 3PUIA 2PS1A 3P9CA 1NVUQ 1E18A 5I48A 3OQ1A 3ASYA 3W8DA 1CY6A 1U2DC 3VTZA 1NU8A 4BFXA 3MUEA 3DL7A 4R0MA 5I9IA 4HLQB 1TMGE 2BI7A 2JLWA 4ENTA 1A7KA 1ACMA 4NAHA 1SOWA 1J8VA 1Z5VA 3G2OA 2J8ZA 4K3VA 4NEGA 4AY3A 4MS2A 2J5RA 1R88A 4YAKA 1VHQA 1Q0PA 4ZYTA 1JIJA 3ZZNA 4BVHA 5CA0B 3N28A 4J3NA 4W5RA 4M1OA 2QD5A 4ZQHA 2PZKA 1Y1RA 4CX9A 1K5DA 3F7OA 4BBZA 1AU9A 1P91A 1DIHA 3PR2B 3W5DA 4JB2A 1XDDA 2ISCA 3E35A 1YDHA 2DKNA 4O2BA 3C48A 5ETJA 1U28C 2JA2A 1VXOA 3PI7A 3H6KA 4N7JA 2AA3A 3ZLJA 3HO1A 2BV3A 1N2SA 3WIBA 4RZHA 1G4HA 3DZCA 1N2GA 3GEEA 3FCOA 2FB9A 2WYVA 4JYCA 4U2DA 2B92A 3FXHA 1B1CA 4I99A 4JVOA 4H3HB 3T5MA 1MNQA 4TV8F 3GOQA 3NMUF 2ZIEA 4XCXA 2QAGA 3PRHA 2ADFA 3CUTA 4QVIA 1B6SA 4PG5A 3H9EO 4H0FA 4BLSA 4K9KA 3W5HA 4FJ0A 5JJLA 3L0CA 1NLFA 5E9QA 2BE5F 2PCJA 2I4TA 5JJCA 4A0RA 1K0FA 4QLOA 2ZRPA 4RX1A 2ZPTX 4OXKA 4JBYA 3SDSA 3NBAA 3W9BA 3C14C 4TMFA 1YBFA 1TVKA 1C7EA 4PLFA 5EKXA 3PHHA 2JH8A 2I4MA 5BV7A 3MGGA 3DKAA 1LC0A 1JG4A 4JI7B 2O0LA 3M1AA 4DOZA 3AVPA 1U63A 4RZQA 1ZUNB 4YXWA 4AULA 2HBQA 4W9RA 2AFIA 2HGZA 1W29A 5LXTF 3DYVA 1OR2A 3N8KA 1E61A 2Z8ZA 4P34A 4FZRA 3QH4A 4QE3A 1VRWA 3NM6B 1EB9A 2OFFA 4HB0A 1LV7A 2BEJA 4HX9A 4L74A 5CVDA 4Y6QA 3V9PA 1YNOA 3U16A 3I4FA 4IQGA 3NWJA 4C7KA 4CNBA 1MZPA 5DRTA 1KZHA 4LMAA 1ILEA 1N2CE 3A1UA 3AUYA 1W4ZA 2CCGA 2E4XA 3OIVA 4J1QA 5GP1A 1BX0A 3ZWDA 3GG2A 5KKAA 3WFZA 1RNLA 1VOTA 1A5BB 4JD5A 3ONNA 1DBWA 2Z1MA 1G20A 2I7DA 1WCYA 2WZQA 4MROA 4QL3A 2Z2IA 1E0JA 4NU8X 3G49A 2ID9A 5ENZA 2H07A 3COSA 1IUNA 3HCEA 3AEYA 5CFZA 1E9SA 1QIJA 4PICA 1RHMA 4HAIA 5A02A 1XC7A 3KTAB 3I5PA 4I7EA 2WJJA 5AVUA 2PH1A 1QCDA 4NYJQ 5KQPA 1G6OA 1XNJA 5GV7A 4OIQF 4LI3X 2RG7A 3H8JA 4RXUA 1W87A 4XOUA 3IQFA 1ACLA 2R86A 3O2QB 3THXB 3OJLA 1F2UB 4X91A 2H2WA 3Q5DA 4N6OA 4R9SA 4POAA 1GRVA 2DFLA 5HCNA 4Q4HB 3ST7A 2BR4A 5JXWA 4LCJA 3P2JA 3A4IA 3GWLA 1JQ3A 5LZ7A 3WQSB 2HSQA 3NHBA 1V3UA 2XMCA 4ONSA 3VC3A 4V0RA 3HZRA 1GV1A 4ZYVA 4QTZA 3PE4A 5IJZA 5JAMA 1S4QA 1QG6A 2OORA 3UNXA 3FWNA 3DO6A 4YT4A 5GONB 1R6XA 1EH5A 3DCJA 3CW9A 1T36A 4YECA 3RC1A 1GP2A 1LS1A 4KDFA 2IHKA 2IUUA 3PRYA 1ZUNA 5HSWA 3IDFA 1L5OA 1YCFA 4GEHA 1R5NA 4CMBA 2P68A 2R1UA 4PLWA 4Z1MA 4R31A 1O8BA 2FPPB 1ZGCA 1QYWA 1FTGA 3T5BA 2ZYRA 3ZGLA 2JLXA 1LK0A 3LUTB 4RELA 3DBIA 1XN4A 2R00C 1Z3IX 1PG2A 4BPBA 2WI8A 4XGIA 3RF7A 1ECLA 3NLLA 4MKZA 3WK7A 1QV9A 4UU8A 3CWCA 4MV3A 1RADA 1THTA 2IGTA 1S2IA 4L3VA 2IK8A 1TX4B 5EJGA 1B8UA 5JYCA 2OP0A 4OJNA 3P9QA 3I01M 5CXQA 4OOFA 2WF7A 3E23A 3MBIA 1U9IA 4PFSA 2WPDD 4RPIA 1V9LA 3AYXB 4JI0B 3IJ5A 3OQMA 4B17A 3W8IA 3QWFA 2JAWA 1JAZA 4C0AC 3E0XA 3RGWS 1XK7A 5F4BA 4C3UA 3ZE7A 4HLDA 3U7IA 1Z2PX 2ZCVA 5JZMA 2MSDB 4PYJA 1SOUA 5HSGA 2C4TA 3KUDA 2WF8A 3SI7A 4WFIA 3KTAA 5FBHA 3A6JA 3ZY6A 1Z7WA 2F00A 1YD7A 1X15A 4K6FA 3DMTA 1JQJC 2GCGA 2GB4A 2RHWA 3MLGA 3CNHA 2UVDA 3RRYA 3C3DA 4K9PA 3PQ5A 1KSJA 2ZUTA 3DE3X 3R3XA 3TI9A 1X7XB 4B3GA 2VYFA 5A3JA 5ESRA 3THXA 3OFSA 1AUEA 3ZDXB 1K88A 1F2UA 3CLKA 3HKBB 3O03A 4Y6GB 3QPCA 4ALKA 4E5SA 4O08A 3NUGA 1DQYA 4GLOA 3L4JA 1D04A 2F1OA 2PU5A 4PYRA 1LWNA 1GLVA 1WHSA 4Q4HA 4QFDA 3R6WA 3I6ZA 3DCYA 3PHBE 3SJ7A 5EJIA 1YT5A 4N39A 1PJCA 3IQWA 3C7AA 4U5CE 2FNAA 4O2AF 4TKLA 1MB0A 3D8TA 2Y77A 2R6JA 1ARZA 5GONA 2CXHA 4DF3A 3EQ9A 4UBLA 1ZM3A 5T3WA 1A1SA 5ER9A 3KSMA 3HHPA 4JSTA 4E09A 2QVGA 5CMLA 3OZGA 5HNKA 2K7FA 4HQFA 4FGZA 2C04A 2R8XA 4ETWA 1AHIA 4I4LA 3OQNA 1F8GA 1D9ZA 1YH3A 1DZIA 2QP4A 4AP9A 2FPPA 1CJSA 4Z9AA 3HN6A 1GRQA 4WN9A 4V24A 4HXGA 7MDHA 1BIFA 3MTIA 2EW8A 4FOOA 3U2MA 1QS0B 2XWPA 2E0IA 4LXXA 1QC5B 3B51X 3O47A 1GVHA 3L43A 1S01A 2BFFB 4PC6A 2QGZA 3SBDA 1IN5A 3U4AA 3CVWA 3WB9A 4RACA 4KCGA 1BGXT 2HAEA 3AGUA 5B1IA 3B20A 4MMZB 5LCXA 1N2OA 2E89A 1QJ4A 4L5IA 3AG2C 1EX6A 3LW8A 4P35A 2WD8A 4B3FX 4ER3A 3EOBI 4YAEA 2IQ5A 2I7XA 4RK7A 4UUMA 1ORJA 4P31A 3V1UA 3V8EA 2D3TA 3BGDA 3UMMA 2VSFA 2WQZA 1GKUB 4XE5A 3GRPA 1TJ3A 4IYRA 3F0TA 3EPRA 4CEJA 1RWBA 2CY0A 4OF4A 4Y1EA 3UAWA 5HCUA 1PD1A 1FFSA 3SYKA 2HHLA 1JFSA 2DETA 3N3AC 2XVXA 1LBTA 4YCAA 1RCFA 4PLYA 1WDLA 1B0AA 2KYHA 1J70A 1ZGJA 5TPWB 1CEEA 3QU5A 2XCLA 2C7QA 5FOXA 3I12A 3EW9A 4GKKB 1YR9A 3UUFA 4KI0A 4O4LB 3HUFA 1X7XA 3GT3A 2J4DA 3HCCA 3OCUA 4EHNA 4WLVA 1L4LA 2ICAA 3VFDA 4NHOA 3HKBA 5FP0A 4V1CB 1ELOA 1S2GA 4RY8A 3SYLA 1LK5A 4E3ZA 2EINC 5EZYF 2O48X 3CVYA 2Q4TA 5JXHA 4WE3A 3TL3A 3K0CC 1UJ4A 5TQ0B 1EKYA 4L9RA 1R12A 2PZGA 4U7TB 1A7AA 2NO1A 2MMCA 4GYYA 4JCZA 4QASA 4Y2JA 4A2WA 2R8BA 3P9KA 2XLEA 1OFTA 3BN3A 4G4SP 5P21A 4RNDB 4KYVA 2VT6A 3CLVA 1QB8A 1C0EA 1MC4A 2H0AA 4F7WA 1C0IA 2CLCX 3PUHA 3IP6A 4KV7A 2PX5A 2WWTA 4MMYB 2R1TB 3FF4A 4XFJA 3PL5A 5A05A 1O5TA 4X6YA 3ERCA 2QNRA 2DR2A 3OY7A 2BC9A 3PGMA 4J4HA 3LVFO 3JQ9C 3TM4A 4C6TB 4O6VA 3SLRA 2GESA 1I13A 4NZYA 2XQJA 1FJ2A 3BMOA 2XPCA 2EPKX 1QS0A 1QC5A 3UJPA 3IEUA 4DIKA 2NM0A 2BFFA 1T6NA 2O7SA 2J4CA 5DWVA 4N5MA 4OFBA 2UUIA 3DKKA 4UAVA 1AM4D 5KYKA 3OT4A 1UR5A 1K92A 3TNJA 1U1EA 4KFRA 4FYWA 3ZQKA 3N86A 4B6FA 1K4YA 4U2EA 2W0SA 2VQFB 4MRSA 1DO2A 1DAOA 5L40A 1KO8A 1VKOA 2Z43A 2EFDB 2ZRLA 3IS3A 3T38A 3GLUA 2XS1A 1IYZA 1T8TA 4ZT6A 1NI3A 4MR9A 2DHCA 1SELA 4PR9A 5AM2A 1RCTE 3AKEA 3SZMA 1C3JA 4KXMA 3BD7A 4O2BF 4P4GA 4TS9A 2XYPA 2N46A 1TGYA 3AIIA 2QTTA 4KXWA 2GAFA 2PJZA 1ZOSA 4DSNA 4UMVA 2WPDA 4B7XA 4BNZA 2YWDA 1SIBE 4BGUA 5JANA 5TPWA 2NZWA 2IS2A 1P19A 1VK5A 5DYWA 5GJCA 3KPUA 4B8WA 2QTNA 2I9KA 2JI7A 1F20A 2IH5A 4ESOA 4O4LA 4ZDIA 5DISB 2P2CA 4EB8A 4N6HA 1YZYA 3OLVA 1QAOA 3OJFA 3EIUA 4V1CA 3C8ZA 1J2TA 1U7UA 3V80A 1Q3HA 4BMVA 2X5XA 4JYZA 4KXNA 4MVYA 3CNLA 3S8YA 4QPDA 3EIWA 4BCDA 1JYFA 4MWBA 3H5WA 4WK4B 5LNK1 3ANLA 5TQ0A 2D1TA 4OXIA 5EJMA 1N57A 1HF3A 3TZQA 3HY3A 4DA4A 1U9ZA 5EWJA 4CDGA 2OB1A 5HYVA 2ZXFA 4MKRA 3W6ZA 3K1ZA 5J23A 2H9YA 4WA7A 1T9GR 1VG8A 2ZUWA 2HADA 4ARBA 4FMDF 2Y1LA 2R1TA 1EB8A 3E7DA 2VTBB 4DSZA 1M34B 1T15A 2Y4OA 1N5RA 2A3RA 3FPKA 4HE8D 4URHA 2O8VA 4AZSA 1QYVA 4K05A 4DC1A 2JGIA 3OZXA 5JTTA 3OTQA 4QTYA 3U4QB 2I99A 1XVTA 1RQLA 1E99A 4AK9A 5C0OE 4LISA 5HRUA 1V7ZA 4GL4A 1YS9A 3NHRA 4YYEA 1OYOA 3F8WA 2RKWA 1VLQA 4OIPF 2RGWA 1IZ0A 1V8DA 1P61B 1H3NA 3ECAA 3LC1O 3DLCA 2OM6A 2J48A 1YDWA 3U1TA 5E4JA 3O7MA 3DOIA 1GZSA 4CKZA 3SK0A 3QHPA 2G8NA 1CC1S 4KIGA 5DYYA 1HX7A 1RRFA 2GEJA 3EXHB 2ZJ6A<