2PX3A

Crystal structure of flhf complexed with gtp/mg(2+)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
258
structure length
256
Chain Sequence
PEPLRKAEKLLQETGIKESTKTNTLKKLLRFSVEAGGLTEENVVGKLQEILCDMLPSADKWQEPIHSKYIVLFGSTGAGKTTTLAKLAAISMLEKHKKIAFITTDTYAAVEQLKTYAELLQAPLEVCYTKEEFQQAKELFSEYDHVFVDTAGRNFKDPQYIDELKETIPFESSIQSFLVLSATAKYEDMKHIVKRFSSVPVNQYIFTKIDETTSLGSVFNILAESKIGVGFMTNGQNVPEDIQTVSPLGFVRMLCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagellar biosynthesis protein flhF
publication title The crystal structure of the third signal-recognition particle GTPase FlhF reveals a homodimer with bound GTP.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Biosynthetic protein
total genus 72
structure length 256
sequence length 258
ec nomenclature
pdb deposition date 2007-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1380 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2px3A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2px3A02
4LV5B 5FPHA 1S8FA 2XB2A 3IEVA 2QE7A 1N6RA 3K0AB 1CR2A 3EPKA 2IF0A 2RKOA 2O8BB 3BXZA 1FQJA 4C4PA 4HAVA 2JCSA 2J0VA 4LZZA 2FX3A 1OFIA 2RGXA 1XNJA 1IQPA 2ZE5A 1XCPA 2FSFA 3QQ5A 5H1YA 1Q57A 4ARZB 3Q85A 2KBEA 1CRQA 5E95A 1TX4B 3EG5A 1NJGA 2IHYA 4WVFA 1X8LA 121PA 2V54A 2ZYWX 2ANBA 3MWJA 4NYIR 4LV8B 1N25A 4ASUD 4PC1A 2Q0HA 4MKFA 4OK3A 4BEBA 4UKDA 4YXWD 4V0LA 2GHIA 2GBLC 2OAQ1 2WMOB 3W34A 4G5RA 4IEIA 4RCZA 1UEIA 2ZSBA 3E5HA 3GLHA 4CVNA 3NBZC 3U3OA 3FMOB 1E9CA 3QKTA 4DUGD 1VIYA 3R7WB 3B2EA 2FSIA 2G3YA 4IJMA 2G9NA 3FFBA 4RD6A 2ZUCA 4P31A 3A4LA 1GL7A 1WCV1 3A37A 2BWJA 1II8B 3T5DA 4QKQA 4BFVA 3DO6A 3RYTC 2CHVA 3RANA 4QOSA 3IPYA 1R5OA 2O8EB 2Q9CA 4GDFA 2QMUA 2ATVA 2ZRMA 4LY6A 1KK2A 2IT1A 3J81k 1E6CA 4Q4JA 3L0PA 1GP2A 3C16C 4P4SB 3KJEA 4Q02A 2DWQA 3I8SA 1DAKA 1CF4A 1UAAA 1YVDA 3TBKA 3QE0A 2GCPA 1VTKA 1TF5A 4GT1A 4IXMA 3UWKA 3HU1A 3OHMA 2RGDA 2CHQA 4LYFA 2YC4C 5CK4A 1CR4A 1E0JA 1JJVA 1U90A 3GLFA 1TU3A 4B75A 2FN4A 2MSEB 3TGPA 4A6XA 1MABB 2C2HA 1MKYA 4YDSA 4TYYA 5FR1A 4TYPA 3UWOA 4AKIA 3B1YA 1UKVY 3NEYA 1ZC3A 2VLIA 4MH0R 1NVXQ 2XITA 1T3HA 4EQ6B 2PJRA 2IYYA 1RZ3A 3AVYA 1KJZA 4DWJA 1C9KA 1V43A 3AQ4A 4NCJA 4URZR 2FFAA 4O2RA 2A5DA 5AJVB 4D82A 4E07A 4IRUB 2CL7X 1FMJA 3QNUA 5DE3A 3SE0A 3FDIA 3GMTA 3GPLA 3QSYA 3FKSD 2AFHE 2DWPA 1SXJA 4H9GA 2QBYA 2YWGA 1D5CA 1OF1A 2HDNB 2P65A 2HYDA 1CJKC 3CNLA 4CEHA 4PR0A 3AF1A 1A1VA 4HUQA 3RRMA 4GFDA 2V9PA 2QI9C 1DEKA 3GFPA 3AVTA 2GXSA 1Z6TA 2FEOA 2W6JD 5AUNB 4MKIA 4TLAA 3ZS8A 3MLEA 2QT0A 2A3RA 3QEJA 1NIJA 2FMXA 1YRAA 1XU4A 3QXXA 1IY0A 3QENA 4LJ4A 2NTYC 1A2KC 1X1RA 2FF7A 4L16A 1CIPA 4WBSA 1YR8A 4A92A 4RD1A 2FE4A 2FJUA 4Q9LA 2IYXA 2Q3HA 5BQ5A 4JMPA 4LK2A 4DB2A 3LX5A 1YZNA 4EKDA 4KLNA 3VR5A 1UJ2A 1N6LA 4ZV4A 4CDGA 2YJTD 3M4YA 4OJKA 1D2NA 3C15C 2WPDD 4ZCMA 2O8EA 4B74A 1E1RA 1E9BA 1DADA 4M1TA 5KSOA 2IUTA 2BMDA 1IN4A 2JASA 1S96A 3CB4A 1XMIA 3ZVRA 2PEZA 2CEAA 3ZZTA 4D25A 1IXZA 1N5LA 1W36C 4YMVA 4PQYA 2VP4A 3CRMA 1I4LD 1G8GA 2FG5A 2BMFA 1G5RA 4LJ6A 4BLSA 3OEED 1SVWA 1RJ9B 2CBZA 4US0R 2D2FA 4LOAA 1Z28A 5KDLA 1N6NA 4R71A 2DR3A 3I32A 4B2PA 3LVQE 3WP0A 3LY5A 2WJHA 1OV4A 1OXTA 3LQRA 2ZROA 5IDVA 1T6NA 3RC3A 2CJWB 2VBCA 2W2XA 4K46A 2JLRA 2FV8A 3IQWA 3UKDA 3BH6A 2AKAB 4W5WA 4V0MA 3WYFA 4B48A 5HPYB 2CLDX 2JLZA 4NPHA 1CXZA 1KIMA 3CRW1 3PUZA 4ZCLA 1EFRD 4A8JA 3PUYA 4A15A 4P4UA 4OBEA 1EWQA 3Q7PA 4C9BA 3RABA 2IUSA 3I92A 2QPOA 2ZS9A 2CDNA 3TK1A 3FTQA 1JEDA 3H84A 3FFAA 1FQKA 4DCSA 2CLCX 1MO5A 2ZRGA 1AGPA 3UMRA 5D3MA 5FH9A 4B32A 4A36A 2ZM5A 1N5JA 4YMUA 2GCOB 5HZKA 4QHSA 1E2FA 4F38A 1QHXA 3ND9A 1IOZA 3PR1A 2UVQA 1G5PA 1XCGB 1MR3F 1Z06A 4L5BA 2QRZA 4PC2A 2MSCB 1HT2E 2KWIA 1JECA 2LWIA 1OSNA 2B8TA 2QGNA 4MUBA 2O8FB 4TQAA 3EWSA 1Q1QA 4A0RA 2VIIA 1YKSA 1NL3A 4OQFA 1CR1A 5EE9A 1G21E 4FWIB 1W2GA 2HLDA 1W1WA 3U3RA 1NJFA 1MO6A 3QF7A 3WMEA 2CNWD 4TMKA 4QJ4A 1OXSC 4MKGA 5EJEA 5CYPA 2GVZC 1XD2B 4Z1MA 2QQ0A 4JBWA 2QP3A 2FNAA 5C18A 3W6PA 5JMTA 3QUSA 4G5SA 4W7SA 5BN4A 5ELXA 4TYNA 4E09A 5GJCA 4NZYA 2OLKA 4JL5A 3L0OA 2R62A 1NLFA 5CM8B 1S3GA 1IXSB 2IS1A 2C04A 5JSZB 4ZKDA 1IN5A 4M1SA 4GRAA 3QIAA 2MMCA 3RWOA 1BMFD 3BH0A 1NLZA 3GJXC 1CR0A 3PEUA 2BM1A 3MGCA 3K0SA 3CX7A 2PZEA 4MRVA 4D0NA 2CJWA 4IOLA 1BH2A 3K70D 2Z83A 4PZYA 1OLOA 4MDFA 2OEPA 3RSLA 5C4MA 3PITA 1M7GA 4JVSB 4KAXA 2VF7A 3NBYC 1GDDA 4US2R 2ZEJA 3WMGA 3T1VA 3BB3A 1FUUA 2CVHA 2KI5A 1AQYA 1CEEA 2QZ4A 3GJ6A 4MQBA 5IF9A 3EW9A 1G3QA 3LA6A 3FGNA 3NH9A 2PBRA 3VFDA 5IK2D 2PZFA 2G77B 3L8ZA 3U7EB 5J4KA 3R9XA 3OE7A 4WAUA 4DCNA 1KI7A 5DN6A 1KNXA 2HJVA 2IWRA 1VECA 4ZDJA 3EA0A 3P4YA 3X1YA 2YNMA 2NG1A 2QMOA 3CX6A 5BW8A 3K0FB 3GJ0A 3AVPA 3C4JA 4PO8A 1JR3D 1L8QA 3TLXA 1FW6A 1NSFA 2GCOA 3AVOA 2MSDB 3ECCA 2GEVA 3EARA 3QPVA 2E87A 2LKDA 3W3AA 3RDPA 4AKGA 1DO2A 4BPBA 1I2MA 3AV0B 5KDDA 3V9PA 4JLKA 4RFVA 2WWHA 4X8OA 2R6DA 5EE3A 4AYTA 3GLIB 4AI6A 1GVNB 1KI2A 1KMHA 5EE0A 2C96A 1XD8A 2FGKA 2W83A 1RYHA 1VIAA 2EWWA 5FPKA 3THYA 1ZUHA 4ZDWA 4A82A 3NTUA 3B5JA 3Q7QA 4EAQA 2GEDA 4JLNA 3LLMA 5JWOA 2JLXA 1T3SA 3BIFA 2ZIAA 1P2UA 2HYIC 1DELA 1ZD9A 2NOAA 3LXXA 3QPWA 3HPRA 5UKDA 2V1XA 2PH1A 3B78A 6Q21A 2NZ8A 1SVOA 3MWKA 4I1OA 4O3MA 4P0TA 1UDWA 1S3SA 1HUQA 4NP6A 2NO6A 1US8B 1KDRA 1NBMD 3CRQA 3SZRA 2VQSA 5CIWA 2YC2C 4KFRA 2WKQA 2ZRDA 5TMPA 1KY2A 4Q4HB 3OIVA 1WF3A 4XOIA 2W6IA 2Z5FA 3NH6A 4A0FA 1J2JA 3W90A 3DM5A 2R44A 4LJ7A 1KK3A 2E1RA 5C4GB 3PUVA 4QRHA 4A2PA 3CF6R 3N70A 1DS6A 2YKGA 2CXXA 4KVAA 2F55A 2R9VA 1Y63A 2ODEA 2DFLA 2GJ9A 1XB2A 3R20A 4HSEA 2GXUA 2OCAA 2A5JA 1R0ZA 4KU4A 2OE2A 5GJVC 3U2QA 2IYWA 3BH7A 1G7SA 3BGWA 1KI4A 3T61A 4BZXA 4Q7JB 3SQXA 1KSFX 4Q47A 1NVWQ 5DIFA 4BLQA 4G1UC 3GLFE 5DYIA 2IYRA 3OAAD 4HB0A 3UXMA 2RB4A 5HCIA 1W4BA 3T34A 4HATA 4LPSA 2Z6VA 4Z8XA 3VU9A 4BFWA 5FTLA 2MMGA 4B43A 1WDTA 2WJYA 2WBLC 3DM9B 3AVWA 2CL6X 3O8BA 1PZNA 1KSGA 2XOKA 3D7MA 3BORA 4S35A 1QG4A 2X2FA 4V03A 1KNQA 4DDTA 1Q1ZA 2VYFA 3U44B 2OCBA 1FTNA 1N3BA 3CO5A 5TXGA 4BZPA 1Q1BA 3KZ1E 3PJRA 4DLSA 4XJXA 1ZNZA 4GP7A 2DCUA 2WTUA 2HF9A 2XTMA 3JVVA 4HDQB 4RFSB 5DHAA 5LBIA 1KO4A 2FOLA 2JDIA 4X8MA 3QF4B 4OI0A 1QBKC 3IO5A 4E03A 3TNFA 1KI6B 2ZE8A 4KXFB 2ZJ8A 4XTRA 1S9HA 3AGQA 3GCGA 2VL7A 1II0A 4URUR 3KQUA 3AUYA 1NVVQ 4IOKA 4OQLA 1BOFA 1FP7A 4IXNA 4NCHA 5AUQA 3RS4A 2YINC 3ZS9A 4A2WA 1XPUA 3KFVA 3KX2A 2J7PA 2WOJA 5LPNA 1ESMA 4LJ9A 4RJLA 3SYNA 2CE7A 3IHWA 4LC0A 4EPXA 1UEJA 3ZIAA 4EPTA 3CR7A 2Y8EA 4EJSA 1IN8A 4QNMA 5H70A 4AYXA 1G8FA 3LW8A 4DT1B 4Q1AA 1OH8A 4BFZA 2D4HA 2FZLA 2GF9A 1KK0A 3B6EA 3QY0A 1COWD 2AL7A 4UNNA 4AYWA 3KB1A 2QTHA 1GSIA 2Q3FA 2QP9X 3NDPA 3ZZ0A 1E2NA 1DPFA 2EFDB 4PQRA 3S1AB 4D4KA 2ZRPA 1F5NA 4JBXA 4FMBB 5IHPA 4ZIRA 1AGRA 4ZDIA 3OFND 4OK5A 2ZSAA 3FOZA 1Z0KA 3CF2A 4NTZA 4JVMA 4FN5A 3KUDA 5A0FA 4L4UA 5JEEA 4MGZR 4IDHA 3GD7A 4R9UC 1GNRA 3MWYW 4U02A 1EXMA 3B60A 2A5FA 3KTAB 5FL7A 2P0EA 3SEAA 5HTKA 3B85A 4HAYA 4KYIB 4DEXA 5FFMA 2VF8A 2JIZA 3OEHD 1G20E 1WP9A 2XTZA 3K0EA 2Q6TA 4ZDKA 2XXAA 2FGJA 3AKCA 4LBWA 1IY1A 2ECKA 1Q44A 1G7RA 5CK5A 1XMJA 4LHWA 1A7JA 1KAGA 3TAUA 1WXQA 2D7DA 4LRWA 3TR5A 4NYJR 3HU3A 2ONKA 4FXPA 2VPPA 3SBDA 3ZLJA 2R6AA 1XF9A 2PX3A 3MJHA 3QPUA 2PX0A 3CNOA 1R7RA 3QOFA 1U8AA 1ZVQA 1SKYE 2NO9A 2VSFA 3E2IA 1AS3A 4NKRA 3UK6A 5KNDA 3U4QA 3QVUA 4PC7A 4YMSA 1KGDA 1KY3A 2EFEB 3PVSA 4D2IA 5JWRA 3LAWA 2AN9A 4M1KA 1NN5A 4YONB 1GNQA 2AWOA 3CONA 4V0ME 4F4JA 3A1TA 1GL9B 2BJWA 2NO0A 3L2OB 5FBLB 2F3RA 3GQBA 3B1XA 4RFSA 1U0HC 5J47A 1WA5A 1QZXA 2BCJQ 3TW8B 1G3RA 2YWFA 1OXXK 3C14C 1TQ6A 2ZRFA 1KI6A 4YMTA 3ZDQA 1QRAA 4LC1A 3CLVA 2C99A 3EIHA 1E79D 4NE2A 3TRFA 3ZD7A 1CJMA 1VMAA 3T1QA 3FMPB 2ZJOA 1U0LA 1VG0B 4URYR 4ACBA 1E9RA 3TQCA 2J46A 4B6FA 2QNRA 3C5HA 1AA9A 1SHKA 2EFCB 2HT6A 4HB3A 4OHYA 2GA8A 3LH5A 1KO8A 4OYHA 5DGXA 2F3TA 5HKKA 3JZAA 1M8PA 2ZI7A 1Z2AA 4HLUA 4B71A 3KQHA 3OF5A 1OFUX 4JVLA 3TSOA 4E5UA 4KO8A 1Z63A 2XGJA 2G83A 1JR6A 3CPJB 1K5DA 3S1AA 1LY1A 4BFYA 1TQ4A 3ND8A 5FTNA 3TVTA 5CB6A 4Q1FA 2XZOA 1FFHA 1W36D 4AURA 1OPXA 4LUCA 2QSYA 3VKGA 2GJAA 4Q4JB 3TIFA 1Z6YA 1XJCA 3OIYA 5DYGA 3B1ZA 3H2YA 1OIVA 1YQTA 2IEZA 2ZPTX 4QG7A 1ZAKA 3KKMA 2BBTA 4Q9IA 1XX6A 1Q21A 1IJEA 1ZD1A 2ZJ2A 2BM0A 4B2IA 5F9HA 2X1VA 2ZI9A 3A1VA 4XVUA 2F7SA 3GLFB 1W48A 3FPAA 1E1QD 2VP9A 3G5UA 2CK3D 2FU5C 3QJYA 1NG1A 4FI3C 3L8YA 5AJYA 2GKSA 1J8YF 1YE8A 5K8IA 4UJ3A 3L82B 1OB2A 2NO1A 4FD2A 4E22A 1JNYA 4KITB 1GRQA 4K8OA 1P4SA 4BWYA 4DDUA 3LFUA 1R5NA 1AKEA 3AEZA 1G5TA 2ZVQX 3ONWA 3U5ZB 1PLJA 4KLZA 5EXTA 2J0UA 2EYUA 1M2OB 1IN7A 4RZXA 4PSVA 3A4NA 1SXJB 4Q21A 2QBYB 3L0IB 4G5GA 4KSBA 4I4LA 4N0DA 4XSHA 2IYVA 2VEDA 3CH4B 4HLQB 4QJ3A 2QGZA 1FNNA 4CEHB 2J5XA 2NO7A 4ILEA 4Q00A 4DLUA 1N6IA 1GM5A 2QT1A 4CW7A 2B7CA 4HUQB 3U7FB 4C7OA 2G6BA 4W5JA 4A6PA 4CRWB 4DSTA 3KQKA 3IBYA 2GK6A 2NMVA 1FZQA 2ZU6A 4A0HA 5L3SA 1QHNA 2V7QA 2PCJA 3DL0A 4BLTA 3KKQA 4JS0A 3N2IA 2LCFA 3VX4A 3B1VA 1FL9A 1GTVA 1M7BA 4XVQA 2XZLA 1RRGA 4UNRA 2YV5A 1PVOA 4OI2A 4NONA 4DLXA 4D81A 2ZI3A 4HZUA 1K5GA 4FMDF 5LDDC 2IS2A 2V8OA 1N6OA 1P9RA 3NXSA 1VCOA 4GMDA 1JAHA 3KJIA 1H8EA 1GKUB 5FI0B 1NSTA 1YR7A 3PG5A 3K0CA 1HE1C 1QHHA 4FCVA 5AWFC 4FINA 1CRPA 4TLCA 1XTRA 1YZGA 2C8VA 1D8TA 1TQ2A 5C2JB 2FA9A 1NKTA 1OKKA 3BOSA 1GZSA 1WRBA 2P67A 4EDHA 4C2TA 4KBGA 1R4AA 1VYVA 3QKSA 4EPRA 3T35A 4B76A 1UKZA 1FPMA 5KOYA 2R6CA 5FBRB 2G1JA 4DKXA 5E3HA 4KHZA 1KYIA 2O52A 3A36A 1E2MA 1RRPA 2ZRBA 3EIQA 2JAQA 2ZAOA 3AF4A 2FH5B 3TJZA 2WWFA 2QY9A 1IBRA 1KI1A 1P9WA 1SKYB 1TQDA 2RAPA 2IXEA 3TSZA 4TLDA 1I4DD 1U9IA 4N0EA 2YOFA 3ADKA 1MH1A 1XEWX 2WHXA 5AR1A 4D4JA 4FMDB 3OIUA 2F43A 1E4YA 2CK3A 4RVCA 2XAUA 3AVUA 3EC1A 5TV2A 4NYMR 2QORA 1R0YA 2BBSA 1W4CA 4A8JB 2GRJA 4GOKA 1Z07A 3GLGE 2X2EA 2JJ1D 4DDVA 3W6OA 3WYAA 4PQFA 4DRZA 2LKCA 3U61B 2BVNA 3U3JA 1CU1A 2OCPA 1E69A 3AP1A 1ZM3A 1G4UR 2RGNA 5JFGA 3VTKA 1RFLA 4U7DA 4PHHA 2IK8A 2PMKA 2ZE6A 4Q1EA 2ZAMA 2C9CA 2ZETA 3LW7A 1NY6A 5D3MB 4ACAA 3PENA 4NYIQ 1ZUIA 1AKYA 1BO6A 1XXHA 2AXNA 5EXPA 3W5JA 4C0HA 4HUTA 1J90A 3CM0A 1P72A 3MRSA 3PEVA 4JZKA 3UANA 3F3YA 4B3GA 4Q03A 1EFUA 3I4LA 4Q66C 4PAQA 1PLKA 2RHDA 2ZYUX 1NY5A 2IW3A 3PUXA 4C30A 3TVDA 421PA 1NRJB 2ZVPX 3CH5A 3THOA 4HAXA 3AF3A 2ZANA 4D26A 4ASUA 1OH5A 3Q5EA 3Q5DA 4YXWA 5KPDA 3B13B 1X86B 1W7AA 5DO9A 1JR3E 2WWIA 2ZRAA 2ASEA 2C03A 3DDCA 3ICQB 1F2UA 1CJUC 1HTWA 3MSXA 3AKEA 2DYKA 3LX8A 3GEHA 4BGDA 4DUGA 5FOTA 1CS4C 2QEQA 3ZVMA 2HV8A 1AS0A 1P3JA 3GEIA 1KK1A 4MGKR 3HWSA 4CEIA 3IKJA 3F8TA 4NBSA 2QAGA 2AR7A 4V0OA 1XRJA 1ETUA 2FPLA 4POAA 1NNEA 2W2VA 2FFHA 1F3OA 4WZBE 2FPKA 3OIWA 3RLFA 1GL6A 3VR6A 1G291 4TL7A 3NHAA 5DLQC 2P3SA 3AB3A 4IHQA 4UNSA 2ZE7A 1Q3TA 2ZYVX 2VH5R 5FUWA 2VA8A 1NBME 5KO2A 4PPNA 4HAUA 5KSPA 3KDSE 1Z8FA 4WW0A 1UM8A 4AK9A 3I61A 3AKDA 3NEJA 1VG1A 1XTQA 3JZMA 3LRPA 3K09A 2RGBA 1QG2A 4B3CA 1RYFA 2IL1A 2GWHA 4F91B 1CKEA 1D2MA 5AJZA 1X3SA 3UATA 1X1SA 2QROA 1JPJA 4C2UA 4GSYA 2ZR9A 1E9SA 2VHCA 1MV5A 3A58B 2F9MA 4QBIA 3REGA 1UDXA 1J70A 3AP2A 3IBGA 4F4CA 4R2HA 3KKNA 1TNDA 4KBFA 4O2LA 1EESA 3REFA 4JT2A 4LYJA 2YOGA 2RGCA 1PJRA 5AJXA 1XP8A 1KAOA 3ADCA 4AD8A 2OV2A 4MITA 5G3YA 4JSYA 4PC3A 3FKSA 3TR0A 1UBFA 1SXJC 1A5TA 3G0HA 1NMYA 2I1VB 1ZYUA 2RGNC 4PPQA 1KMHB 4MYCA 3CF0A 4PTLA 2EU8A 1ZNYA 1FP6A 1ZNWA 3F5FA 3QXHA 4DCTA 3THYB 4QHYA 1MRNA 2QRNA 3GEEA 2W6JA 5BYKA 2HJGA 3BJIC 2OAP1 4TYWA 1VG8A 1VYTA 3CKLA 1SQ5A 4XTCS 4PPFA 2ZRNA 1TEXA 3SS8A 4IW3B 4KFTA 1IHUA 3RRZA 4CIDA 1UBCA 3C5CA 1YR9A 3K9LA 1G17A 1W47A 3D8BA 4M8NE 2IS6A 2WWYA 2FSGA 5FOVA 4Q19A 1NP6A 3RAPR 3NVAA 4X8HA 2KBFA 1KI3A 3ZYCA 3QBVA 1PUJA 2AHOA 2DFNA 5DHFA 3Q72A 4L15A 3AUXA 2P6RA 4NU0A 3ASZA 2WPDA 1EFCA 3E1SA 4YLGA 3SR0A 3IQXA 4V0NA 5KDOA 1E0SA 3FMFA 4M9QA 4MGIR 4CZ2A 3D6TB 3DKVA 5FI1B 1ZW6A 1LF5A 2KSQA 1UKYA 3F0TA 1W49A 2HCBA 1GUAA 2WJJA 4HLCA 4CEJA 3VNVA 2D2EA 3GJ3A 2H1LA 3T1OA 1EK0A 4KCGA 1VDZA 3B82A 3OEEA 2EQBA 1BYIA 1L2TA 3CWZA 4WXPA 3MG9A 4PO1A 4JLJA 4LJ8A 1E0KA 1E2KA 2GTPA 4CGZA 2GZHA 3DZ8A 1TADA 3AVQA 1S4QA 4D0LB 2IEYA 3GLGB 1E2PA 4OHVA 4PZLA 4Z54A 1P6XA 5AUPB 1LS6A 1YZUA 4I99A 2QENA 3VR4A 1HQCA 3VU9B 1X8KA 4Q18A 2O8CB 4TSFD 4WIAA 3BB1A 4C3ZA 4ESVA 4GZMA 3I5YA 2O8DA 3B8HA 2ODWA 1F60A 1Z83A 2O0JA 3IPXA 2GAOA 4RD0A 2BBOA 3OZXA 2BEJA 1JAIA 4AWXA 4HDOB 3KXLA 1EFRA 5CB8A 3M0EA 4R2IA 4A8JC 2P2LA 3A1UA 1HA3A 1OW3B 2BCGY 1S1CA 2QPAA 3SHWA 3WRYC 2ZS7A 1MRSA 2C77A 4P3YA 1MO4A 2CHGA 2OT3B 2XTNA 2EFHB 1ZRHA 4QC2A 2OUKA 1IY2A 3IO3A 4XWAA 4JJZA 5EP1A 5B57C 2BJVA 2ZSFA 1ZJ6A 3Q9LA 1MOZA 4AG5A 4BRWA 4AKHA 1N6HA 3PV0A 1VG9B 1Z0JA 3M1IA 4MGYR 2ZRKA 1NKSA 1TEVA 1W0JD 4KVGA 4W5HA 2BC9A 2HT1A 1W0KD 1XMVA 4CT5A 4BRUA 2OILA 4A9AA 1KO5A 4EJSB 3WNDA 4CF7A 1ZNXA 3GP8A 1YZKA 1XMSA 5FTJA 4I1VA 3X1DA 2XNDD 4O0MA 3AVVA 1A82A 1IAQA 3IEUA 4GOJA 1J7KA 3ZZUA 2H16A 4QL3A 4ZIRB 3HPQA 1H8HD 1KDOA 1I2DA 1HQYE 3K9HA 5A4JA 3R8CA 3ZVNA 1RPZA 1DAIA 2CNWA 3WYGA 2Q9AA 721PA 5L8VA 3SHFA 3IILA 4XD7D 4XVRA 1KDPA 4WA7A 2OO7A 1NN3A 1Z0DA 5DNYB 3THXA 4I81A 4LI0A 2HXYA 4UNQA 5F9FA 1XCMA 3SFZA 1V5WA 4PHGA 3U60B 4B33A 1ZC4A 3BK7A 2AX4A 2Z43A 2AK2A 1ZCAA 1TF2A 3MCAA 2JJ8A 4MYTA 5G40A 5LD2B 2XXAB 5FBQB 4A1FA 5JECA 5J4HA 4US1R 2JLQA 2QN6A 3B1WA 4IVPA 4PHTA 4OHZA 4QM7A 3GLGA 4UXHA 3W5IA 2WSSD 1BMFA 5KYKA 3CX8A 5IT5A 4A2QA 4Q1CA 5DI3B 1NMZA 2AKYA 4BFXA 1BS1A 4BFUA 3RHFA 2C95A 5JEDA 2ZUBA 1XTKA 5TVKA 2O8CA 1E96A 2KJQA 1AZTA 1JBKA 3CR8A 2N1BA 3U4QB 1SVSA 3R9IA 2WAYA 3SJAA 4MUAA 4M1WA 1DG3A 1G19A 4RZ2A 2HF8A 3OESA 1BIFA 1RW4A 4W9MC 2QG6A 4QHTA 1OFHA 5JJLA 5BN5A 1OYYA 2B21A 2NPIA 4NDZA 2BMEA 5IK2A 4JBYA 4C0JA 1T4GA 4B3DA 4LDJA 3AF2A 2AXPA 3UMFA 1PUIA 3KQLA 3T12A 1RC8A 3VKHA 4DLWA 1TAGA 3BS4A 3A4MA 2HXSA 5C46F 1JR3A 1D9XA 2IYUA 2RHMA 3CPEA 5CYOA 1ZMXA 5FUYA 3TQFA 4B47A 3LLUA 2OBNA 2ZUDA 1FNMA 5EZ6B 2PT5A 1XXHE 2XSZD 3EZ7A 4IDNA 1IONA 4JSTA 2H8KA 1X8JA 4PPGA 4UNPA 3H86A 1DVRA 1G1MA 5LB4A 1EFHA 1E0AA 2ORWA 1R5BA 3D31A 4J0QA 3BB4A 4TMXA 4YC7A 3FHCB 3THWA 2GXQA 3W9YA 3EPLA 1Z5ZA 4F92B 5FBVB 4JYBA 1R6BX 1M7HA 3E70C 4XH9B 2R8RA 4CYMA 3FHOA 4YDHB 3QVVA 4RZUA 1L4YA 1JALA 4DLYA 3HJNA 4CT4B 1VCMA 1U99A 4LCBA 2QU8A 4AIIA 1FMLA 3KKPA 4U5XA 4P33A 3RNLA 2OFOA 1NBMA 2AD1A 4D0GA 2VP2A 1KZGB 2NIPA 3QI2A 1KOFA 2JJ2D 4RCYA 5L3QA 1E32A 1SULA 3C41J 3ETLA 4PC6A 4EPYA 5DSZA 4BQSA 5E7MA 5FPTA 4MRNA 5E4FA 1N5IA 1Q20A 1KSHA 1KJYA 5P21A 3UG6A 1AN0A 1G7TA 2ZI6A 1RRCA 4TQ9A 3ZVLA 4C0LA 5HCNA 4Q01A 5C1BA 1DARA 2H5EA 3BFVA 2Q3MA 1N2CE 2CCGA 3RRYA 1O3YA 3NC1C 2YWEA 4JLOA 2ODBA 521PA 5SZIA 4KI0A 4B6EA 3G82C 3CZPA 1YZQA 3QG5A 4RD2A 1OHHD 2REOA 2W0MA 5DI3A 2GXAA 3VR2A 4BASA 4EPWA 5AK0A 4LPKA 3I5XA 1ZP6A 2D74A 2V3CC 3IDQA 2H57A 2EWVA 3U7GA 2IYLD 2O5VA 2ZSDA 1E2LA 1DAGA 2J0UB 1G6HA 4XSGA 3OAAA 3QXCA 5EXSA 4FIDA 2C78A 2V4ZA 1J8MF 3FYHA 3K53A 4GI7A 4LX0A 5FPYA 4F93B 2XB4A 2XJ9A 1G3IA 2B8WA 4WXRA 3GJ5A 1EX6A 5CJ2A 2QSZA 2WVJA 5CITA 2RGGA 1F2TA 1E2DA 1VPLA 2QE7D 4TMTA 1LF0A 1TUIA 3IHLA 5JRZA 5A5GA 3NDBB 1Q1EA 3PEWA 1LTQA 3WBJA 1JQJC 1P73A 4C7OB 3H0KA 2G0TA 4NMMA 4LGMA 1IN6A 2OSBA 2H17A 1NLYA 3HYRA 3TH5A 5L3SB 2BEKA 5H8WA 1ZM9A 2DHRA 1N0UA 4Q4LA 4PANA 1B0UA 1LNZA 1E94E 4B34A 3KB2A 2GBLA 4QFMA 1Z22A 2WZQA 5EQTA 4IDQA 2J3EA 3RWMB 2VP5A 3H4MA 3GJ8A 4RKEA 4KYUA 4JLMA 2QM7A 4HZUB 3RS5A 4DDWA 4H1UA 4EPVA 2SHKA 2E9SA 1R0WA 1HY3A 2AK3A 3T06B 4ABYA 5BN3A 4JJKA 2AD5A 3KJHA 3HR8A 1QHHB 1QF9A 3W6NA 4TYQA 2IYQA 1T5IA 4G01B 4EJSC 1E2EA 4TMVA 2OBLA 2FDCA 3O47A 2P5SA 4TL6A 1COWA 1QHSA 3NBXX 1P75A 4RD3A 2OXRA 2WV9A 1VCIA 3FKQA 1E4VA 1ZCBA 3BFXA 2B7BA 4O25A 3QKSB 2IHBA 4IDPA 3OFNA 3BC1A 3EWAA 3TUIC 4K81B 5CJPA 1NF3A 4H1VA 2ZJAA 3FHTA 2J87A 5GJWC 4NCKA 4LBVA 4WOPA 1OIWA 1UKEA 3DKPA 3Q3JB 3ADDA 4M2LA 4ERNA 3TUZC 2WJGA 4NYJQ 5SZHB 3B9QA 4GMXA 4V0KA 5FOUA 3AP3A 4URWR 2ZJZA 4GL2A 2GVDC 2O0KA 4G3XA 3ZQ6A 3RVBA 4TWZA 2WJIA 2WWGA 3OEHA 2CVFA 3C8UA 2C5LA 2ERYA 3HU2A 2F43B 3PCRB 5LD2C 3NC0C 1A4RA 2NZJA 3IUYA 1GITA 3L43A 1K6MA 1GRNA 1TMKA 2ZJYA 4DJTA 5GVSA 4I1SA 4M1OA 1FX0A 1KKMA 4DCUA 2DPXA 2GZDA 5EXXA 2QL6A 1QDEA 4S2EA 3WHKA 3P4XA 3PXGA 3PEYA 4DIDA 4BLRA 1Q22A 4RZ3A 4KSCA 1SXJD 1M1YE 2GILA 1SVMA 3A1SA 1C4OA 1VHTA 2W0SA 3PIRA 5FOWA 1YU9A 1KKLA 1QHYA 1KSJA 5EP3A 1XXHB 2GDJA 4A4DA 4FMCF 1Z29A 4DCVA 1GFIA 2RGEA 4LHZA 2WKPA 2GCNA 1L7VC 4KFUA 3K9NA 4BE7B 1JB1A 4JLVA 5E7JA 3I72A 1E79A 2DFTA 1D6JA 2QP4A 4JT4A 4BFSA 2GESA 3EAQA 1XTSA 3WY9A 3LBNA 1G9XA 1GKIA 3P32A 4L9WA 3WBKA 1CJTC 1RE0A 2JLYA 4PHFA 5E7IA 2VHUA 1G3MA 3N2EA 1ZU4A 2NQ2C 3NKVA 1F2UB 2BKEA 1KTVA 4FCTA 2UZIR 3EX7C 3MMPA 2KE5A 2IYZA 4TTQA 4F7WA 4HLUC 1EX7A 3SN6A 4URVR 1E9DA 221PA 2RCNA 1VKJA 2C9YA 4YQFA 1E1RD 4CEIB 1FTSA 1W4RA 3P1JA 5BWMA 1DE0A 4EFMA 2QAGB 4ZI3A 3W8RA 2JGNA 1DAMA 4IEEA 4OQXA 2QTVB 4HEJA 4DSNA 2RGAA 2ZITA 4P32A 2DY1A 4Q1DA 5KPJA 2IX3A 1W46A 4FMCB 4C0BA 4D80A 1KI8A 2QTFA 2X19A 4F4IA 3AGPA 4ZO4A 4PAMA 4PO9A 1ANKA 4XIGS 2GETA 1AK2A 1Z6XA 4TN1A 2CCKA 1Z0AA 5SZJA 3X1XA 5KU1A 2IC5A 3PQCA 1E9AA 1N6PA 4ON9A 3SJCA 4MRSA 1Z47A 1P7CA 4WZ6A 1D2EA 1R8QA 1UBGA 4DLZA 3EPHA 5FTKA 3WNBA 3CW2A 1E1QA 4OHWA 2YOHA 4AC9A 4LBZA 4B44A 2A30A 3ZH9B 2ORIA 2WIAA 3CPHA 4M9SA 5B30A 2IXFA 2CCJA 3Q8XB 4N3NA 4KJZA 2UZ3A 1P60A 1NVUQ 1XPOA 4M1MA 2QA5A 4LWZA 1HEIA 1GNPA 1DG1G 4QGAA 3SYLA 4QBHA 4PSAA 3K1JA 3QKRA 2VP0A 2ORVA 3P27A 1WB9A 4RKFA 2V1UA 3BFKA 2ZQ5A 1ZIPA 5FR2A 3V4RA 4Q4AA 5EP4A 3QEOA 1U8ZA 5JCPA 4PFSA 4LHYA 1PLLA 5JHHB 4AKEA 1WQ1R 1XEXB 4MA4A 1CULC 1G64A 4HAZA 1S1MA 3T1TA 2JLVA 4RSGA 3K0AA 2O8BA 1OH7A 2EW1A 1DAEA 3FMIA 4FWTA 3NG1A 2GAAA 1DAFA 2BBWA 3MUFA 4II7A 2IS4A 2J41A 3V00A 5FL3A 2VHTA 1DO0A 2PT7A 4BFTA 1ZD8A 3SYKA 1NMXA 2J9RA 4ARZA 4JYCA 3L0SA 4M9ZA 1E2HA 2WSMA 1GAJA 3QXSA 1WBBA 3X1ZA 2PJZA 4M21A 3T5GA 1CLUA 4OK6A 2CMKA 4IOMA 3GLIE 2BV3A 5HE9A 1T5LA 2V6JA 2XJ4A 4HDCA 4IFBA 4B3XA 1OE0A 4DBLC 3MWLA 2HLDD 4Q7MB 3R7WA 1ZM2A 1P2TA 2WKRA 1U94A 4OQNA 2D3WA 1P5ZB 1LW7A 3K0CC 4GNKA 2ZS8A 2YWHA 3EA5A 1II8A 4M0LA 5DI9A 1XD9A 4DZZA 3HR7A 2TMKA 1SZPA 2XEXA 4Z1MD 1J99A 2Z4RA 1E9FA 1D9ZA 3B7GA 1T91A 4UXIA 2I3BA 3DVLA 4ZI2A 4CEJB 3A8TA 2PLRA 5TY0A 2F1JA 1QVAA 4OHXA 4C0KA 5TARA 1AIPA 1KMQA 1OFTA 5CLLA 4DSOA 4UJ5A 2EVWX 2V55B 3ADBA 4LYAA 2O0HA 4JL8A 4P4SA 1AZSC 2IF2A 4R7ZA 1GWNA 3W8NA 5KSYA 1DTSA 2EFGA 3I8XA 5J40A 1LFDB 2CLSA 2FPMA 4NYMQ 1TUEA 5KNCA 1ELOA 1YZLA 4Q9JA 2XZPA 4ZPXA 4G0NA 1Z3IX 1TF7A 3LWNA 1MABA 1CTQA 1U9IC 1LVGA 3AKYA 2WICA 3DHWC 5CIQA 3DMNA 3P26A 4UQOA 2O8DB 4EQ6A 2P5TB 4TZ6A 3SQWA 2GJ8A 3DMDA 2R65A 1NN1A 2JLWA 1U81A 2PL3A 3GJ7A 2JJ1A 3OE7D 5DN6D 5KUTA 3NBFA 1Q3HA 4EFLA 3RC8A 1JI0A 4I1UA 1OXVA 2YHSA 1E2GA 1XEXA 5DISB 5CDFA 4MYUA 2L0XA 1CP2A 1T8TA 1EG7A 1ZINA 3SU8A 2Q9BA 3PFIA 3VQTA 3SOPA 2GZAA 2A5YB 3VHLB 4HB4A 3DZDA 2A2ZA 1LB1B 2F1IA 3BE4A 1R2QA 4KODA 2I1QA 2VHQA 1G7CA 1KJWA 4DLVA 3CZQA 4PSKA 2HUPA 1XEFA 1H65A 2R2AA 3TE6A 5BYJA 1E2JA 1JEEA 1U2RA 3ZQJA 1G3UA 1HE8B 1KO7A 1QVRA 2H92A 2OLJA 3SDZA 5BXQC 1F48A 2C9OA 2NGRA 3C7KA 5FOSA 1OIXA 2WIBA 1Q0UA 4LYHA 1L4UA 3EZ2A 2A78A 3U3KA 5JRJA 4TMZA 1OJLA 1SVLA 1M6NA 3KJGA 1RKBA 5J4VA 2OFWA 1ODFA 4XWKA 2N46A 4B2LA 5JJKA 2IYSA 3AM1A 2FFBA 3VR1A 1IXRC 3KL4A 3X2SA 2FSHA 5B64A 4DVGA 2GNOA 3H1TA 2VTKA 1SVIA 5FTMA 4YMWA 1VYUA 5CM9C 1EFTA 2JLSA 3TAHA 4HB2A 2J0SA 4HAWA 1OT3A 4HYYA 1U98A 3B9PA 1T3LA 2W6ID 2FWRA 3THXB 4NHOA 1G8HA 1U0JA 2ATXA 4KV9A 4B3FX 1T0JB 2QAGC 1P61B 3CUEF 1W5SA 2A7QA 2XX3A 5TB5A 2J59A 4LHXA 3UIEA 1S2MA 4C0AC 2IWHA 1LS1A 3NHBA 3EC2A 1AQUA 3EZFA 3I73A 5JZVA 2F1RA 5JJIA 1MT0A 1A2BA 2VSXA 2WM9B 2B6HA 3I3SR 4BUJA 4Q7LA 1ONBA 4L8GA 1RJ9A 2R6FA 3SC3A 3O8DA 4TQUS 2DWOA 2BKUA 1TU4A 5JLJA 4LHVA 1RRFA 3M6AA 4EUNA 4QGGA 3K70B 2GEUA 4V02A 3BRWD 3EZ9A 2UKDA 1GRRA 5FUVA 3K09C 1ZBDA 3U6KA 3MD0A 1ZUNB 1YR6A 4OQMA 5K8UA 2C98A 2PLFA 4DIEA 1ZU5A 2XOKD 2OM2A 5M04A 2YZ2A 3TUJC 1E2IA 4PXAA 1KZ7B 2XNSA 3CNNA 1I4TD 3AVXA 1G41A 1U8YA 2F6RA 5FUXA 1YRBA 4TLEA 1ESNA 3RS7A 1R0XA 3GFOA 1KDTA 5EZ5A 2D62A 3X1WA 4OL0A 4LSGA 3A6PC 2JDID 1XJQA 2GJSA 2ZI4A 5GVRA 3KFXA 2J7KA 4IOJA 4EIWA 2D06A 3R9WA 2ZR7A 3MFYA 4Q9KA 3LQQA 5SZKB 4MRPA 1Z6GA 2YVUA 1HURA 5F3WB 4JLAA 4MYHA 1JJ7A 4Z8YA 2RMKA 1T0HB 3CRRA 4BZQA 3LBIA 1MO3A 3DEFA 3EPJA 3GFTA 4JLDA 5HZHA 3DPUA 3JVUA 4C0SA 3BERA 8OHMA 1E3MA 1B23P 2YYZA 3RRNA 2J7PD 1XWIA 4DEYA 3THWB 1G8YA 4X8LA 2J0QA 5AUOB 3EXAA 4TLBA 3ZIAD 3LD9A 1IJFA 3QBTA 1NVVR 4L9SA 2ZRJA 1SVKA 3BWDD 1AS2A 2PZGA 3LVRE 1JPNA 4GOXA 3BD9A 4U00A 4TT3D 2ZR0A 4BECA 2O8FA 5JHGB 2G1KA 2J45A 1G4AE 1W5TA 3KKOA 4NH0A 3FE2A 4MKHA 4TL9A 5K8TA 4QJ5A 2BOVA 5J5CA 2WJVA 5L3QB 3V4FA 1GKYA 1UFQA 3GLHE 1HYQA 2ZRCA 2ODNA 1NIPA 1AM4D 4QBGB 1XDBA 2QPTA 2K5UA 3BBPA 1JQLB 1GILA 4MRRA 4RY2A 3HP1A 1HT1E 1XD2A 2WAXA 1G6OA 3NWJA 4ITRC 5FL7D 2IUUA 2ZXUA 2FFQA 1UPTA 2QMEA 2D7CA 2JIZD 4LJ5A 4PZZA 2DFKB 1R8SA 1T8UA 1JXMA 3CRVA 4TTRA 1C1YA 5JSZA 4OI4A 3K9GA 3T15A 2HEIA 2GK7A 5J4LA 5FBWB 1T9HA 3U7HB 3KXIA 1CBUA 4WZAE 4OKSA 4EFNA 4M9XA 4G5OA 2VO1A 1XTIA 2OBMA 3CIOA 3MAAC 4QGFA 5GADl 1E98A 1QHGA 2ERXA 3EIEA 1X6VA 2AWNA 1GIAA 3D3QA 3LXRA 1OB5A 2W58A 1WE2A 4TSFA 5G3ZA 3TSWA 3O8RA 1YJ5A 2REBA 1Z0FA 1OYWA 1F2TB 5K8LA 4DXAA 1CJVC 2RH5A 2VSOA 1Z2CA 3FB4A 2Z0MA 4C0QC 3R8FA 2DBYA 1OH6A 3RSOA 5FPSA 1K8RA 4FW9A 821PA 1HV8A 4Z51A 1VHLA 3DOEA 1HH4A 4TZ0A 4DLTA 2X8AA 4Y0AA 3VX3A 4KFSA 4PX9A 2N42A 3SFVA 5G41A 3IIJA 1FOEB 1UBEA 3BAFA 1UADA 4OI1A 4Q5IA 5JI2E 4LV6A 4P4TA 1DBSA 3K0FA 3VAAA 5KTYA 2ZJ5A 1EGAA 1XJ0A 1W2HA 3AH8A 4TL8A 1XPRA 4FCWA 5HE8A 2ZYTX 1SXJE 3GLIA 4Q1BA 1Q12A 3ASYA 1TTTA 5H68A 4URXR 4AY2A 1XFAA 1Z0IA 1IM2A 4JKIA 2V6IA 5FOXA 2VHJA 1RIFA 1XZPA 3PUWA 2FZ4A 1F6BA 2OXCA 4N1AA 4A0GA 5HKKD 1FUKA 1PV4A 1BKDR 3W3ZB 1W0JA 3HYTA 5F98A 1W0KA 4HLDA 2CL0X 4B35A 1XBTA 3LNCA 1E2QA 4Y0VA 4JVNA 4NCNA 2DB3A 1TL7C 5ANRB 1N6KA 2XNDA 3UMSA 1TPZA 5EUQB 3VR3A 4DC9A 3NIBA 4LJAA 1AJEA 2IBMA 1N5KA 4G5QA 3O8CA 2ZSEA 3AF0A 4R98A 4TT3A 2BMJA 2JATA 1WBDA 1H8HA 1US8A 3QKUA 2W2TA 2F1HA 4QNRA 1M74A 3TW4A 3IIMA 5JI3E 2QQEA 3IIKA 1YHNA 4XD7A 3RS3A 4Q4HA 4AG6A 4NCIA 2ZI5A 2P6UA 4GZLA 3FWYA 3EZ6A 2FEMA 2WWWA 4QGHA 4IDOA 3ICEA 4JIMA 2F9LA 2EYQA 5EE1A 2WMNB 2IA5A 3QXJA 5IRCD 3SJBA 5TDHA 2ZRLA 4BLPA 3DOFA 5KNBA 1S9DA 2WSSA 5KHOC 4BLOA 5EP2A 3I62A 5JS7A 3KQNA 1FX0B 3IGFA 1O87A 3LBHA 4D6PA 1JXOA 1UF9A 1G18A 5D3QA 2OESA 2A9KA 1W44A 3K8YA 3ZGXA 4B3BA 4BEJA 3K70C 1NG9A 3LO5A 3SBEA 2J1LA 2A5GA 1P2SA 1Y3AA 5B2ZA 3VMFA 3WNCA 3WMFA 4D4MA 3A1WA 2CE2X 5JWHA 3WP1B 4B73A 1DOAA 4JL6A 5GJBA 3I1FA 3U44A 3RS0A 3EASA 1Z6AA 4QM6A 2H7VA 2AFIE 1DAHA 1G8PA 2KB0A 3VNUA 2G0NA 5EUMA 1KHTA 5CDFE 1XTJA 2VP6A 1NI3A 4IFEA 3QF4A 2V7QD 4JLPA 2WWXA 5JCZA 2ZRHA 2JEOA 1SKQA 2B92A 2BDTA 1M34E 1XEWY 1KO1A 1VCNA 3N5CA 1N0WA 2IXGA 2Q21A 4DLRA 3FVQA 4DSUA 4GBMA 2QMHA 3WHLA 621PA 3U6BA 4QXAA 2XSZA 4NL4H 1EWRA 4D4LA 3SNHA 4ZCIA 2OFXA 4M1YA 2BIFA 2PCLA 1BYUA 2OCYC 1E9EA 1XZQA 2GJKA 2ZU0C 5AJWA 4Q7KA 2HCJB 1GG2A 5HR5A 1H8ED 3GLHB 5CLQA 4Q48A 5L3VA 4HI0E 3SJZA 1P2VA 4DT1A 5EE5B 5KSZA 1NN0A 4OJQA 2QM8A 1OKKD 2OZEA 2P6NA 2ZJBA 4ZKEA 2REXB 1W36B 2W00A 5L3RA 2BHRA 5DH9A 1P9NA 1ZM4A 1QHIA 2JLUA 3VKWA 4PAOA 4TTPA 2PMDA 4IVQA 4UXJA 5LB2A 5B58C 2JJ2A 2ONJA 4GPTA 3TKLA 3UG7A 4GP6A 3LDAA 1RVDA 3RS2A 4ESHA 3UPUA 1G16A 3MJRA 1WMSA 2NPFA 4M53A 4M4SA 2ZREA 5F2EA 3ZD6A 2X77A 3WRXC 2OG2A 1ZM7A 3KTAA 5G53C 5JS8A 2PEYA 4DB4A 1W4AA 3SI7A 4QBFA 1N0VC 2R6GA 2JA1A 1OXUA 4MDEA 1II9A 1OHHA 4HZIA 4M22A 2G88A 4DHEA 2QAJA 2ZTSA 4LBYA 1ZIOA 2VRWA 3ZJYA 3CWQA 4XWOA 1E99A 2OHFA 4RD4A 3KUCA 1Z08A 4JKYA 2ANCA 3CBQA 3WXMA 2ZRIA 2Z4SA 3QG1A 1R10A 1GOTA 1S0UA 4IKEA 3VHXA 3QKRB 3P20A 5J4YA 4LJYA 1KI9A 4IVRA 1SGWA 2I4IA 4JLBA 4Q4AB 3U3MA 1LV7A 2WOOA 3KXKA 1SHZA 3LV8A 2IYTA 4Q9HA 4TMWA 3TMKA 1P62B 2H18A 1YZTA 2GF0A 2QUZA 3HDTA 3GJ4A 5JBQA
chains in the Genus database with same CATH superfamily
1S8FA 3WLTA 4AZWA 1CR2A 5G1PA 3VTFA 3IQDB 4MW8A 2ANBA 1TT5B 2Q0HA 1C8BA 4TMFA 1DZIA 1MNAA 5GAJA 3NBZC 2C3YA 4UQLA 4DUGD 4IJMA 4ZJPA 2G9NA 3UMIA 1H2AS 3HKBA 2G1UA 3V2GA 1WZIA 1R5OA 1Y8QA 1NJ1A 4FHGA 4MI3A 5KYXB 3KJEA 2Q1UA 2P91A 1SVUA 4F4UA 2EP8A 1EE2A 5EJGA 5FJIA 3L6RA 3SXPA 2C3UA 3ERCA 2JHPA 5JADA 4E5YA 3LHIA 3KT3A 2HWYA 4EGJA 4KPEC 4Q34A 1PW7A 1FMJA 3QNUA 4L5YA 3QITA 1N2JA 1TE2A 4V0RA 1FDOA 5LUAA 3SX4A 2VPYA 3U4CA 1BC5A 2QT0A 4CV1A 1YRAA 2P4UA 2Y05A 4ITUA 5IKOA 3D7KA 1CIPA 2EZUA 4IIXA 5DM1A 2FE4A 3TQOA 1FFCA 2IE0A 4CN8A 1PFUA 3ABKC 2ZK7A 1TWCA 2O8EA 1ZICA 2IXNA 1PDOA 2FZGA 1C9JA 3HHEA 1NSGB 1QPZA 1G8GA 1G5RA 2W7TA 4C78A 1Y8RA 4R71A 5DX8A 1RXUA 1S2OA 1M33A 5FD8A 2I2AA 1EM8B 2C4UA 3ZD9A 4B48A 4UBJA 4A8JA 1YK1A 4A8HA 1A97A 3FTQA 4AZTA 3DAFA 4Y30A 1XQWA 3ASOC 4ZFNA 1NE7A 2PQ2A 5KX5B 1F17A 1Y5LA 2GCOB 2BUBA 3WVNA 1KEEA 1Z5NA 3A9WA 3Q7EA 3MVEA 1P7ZA 4BVGA 1Z06A 1HLPA 4PC2A 2BMAA 2X13A 3K7DA 4IG4A 4AX8A 4A0RA 1XRLA 3QI7A 5A0TA 1GLVA 5KYVA 5AQEA 5JP7A 1SJ9A 3JS5A 1EHIA 4BMCA 1QH8B 5BN4A 2H4FA 5DHTA 1L7RA 4QUKA 4FIZA 3FFTA 3L0OA 3IQ5A 1ZJ5A 1O0SA 2IDMA 4BOYA 1CC1S 3UQYS 3BH0A 5FI3A 4D0NA 2WF8A 2R5WA 4MDFA 3P94A 1M7GA 3KKBA 1FVFA 1CEEA 3ZTYA 1LLDA 1R0LA 4ZQHA 3L8ZA 3QE9Y 3OE7A 4DCNA 5DN6A 4RX1A 2PZJA 3SHQA 2XHZA 4XQCA 5JZ9A 3T3EA 3QPVA 3C0KA 1E1NA 4AXXA 3DPIA 5KTMA 2ETSA 2XNHA 4EARA 3MPOA 4B8WA 3ZW8A 3OLCX 5JAZA 2ZD9A 3N7UA 2JLXA 1ZD9A 3G9TA 3TQHA 3ZYZA 2PH1A 5IXSA 3CURA 2XBUA 1SA0A 2WZDA 4KHPB 4TS3A 4P8RA 4DN6A 3GB9A 3CRQA 2O7SA 4D7AA 2G67A 3NP9A 3GPCA 2ZCVA 4XOIA 2Z5FA 4HVTA 3W90A 4DVYP 4X0EA 2OUIA 2RJNA 3RRBA 4KVAA 2R9VA 2GZSA 2C5SA 5SY6A 1GT6A 2A5JA 4BJ5A 5GJVC 2IYWA 2FPGB 4Q7JB 1KSFX 4BUZA 4H27A 4R68A 4C1BA 2B2XA 2AA3A 3B6MA 3LC2O 4UCFA 2RH4A 1T6XA 4GP7A 2WTUA 2PZMA 1H6AA 5DS5A 2FMIA 3KNZA 2RHOA 4TX1A 1UJCA 2ZB2A 3PQDA 4FYMA 2H7CA 4MI9A 3KQUA 4IOKA 1FDSA 3RS4A 5B36A 4BQFA 3FNQA 4IJVA 3SYNA 1LGYA 2XQIA 3AF5A 3CR7A 5H70A 1J97A 4JBNA 5BY2A 3KB1A 3NDPA 4CKWA 3S1AB 3QLVA 4WEOA 1K4KA 2AJDA 3UWMA 2R8PA 3CTMA 4DMGA 1GZ5A 2Z3WA 4YTEA 1JT2A 2QZPA 5H3CA 4DILA 2WE8A 1AO3A 4DADA 4DBQA 5IJ0A 5G4KB 3T94A 1U8AA 2VAWA 1LQTA 1QS0A 4YONB 1E58A 1EWYA 2YWFA 4CMEA 3OTWA 1ODSA 4JJFA 4WGFA 3VTZA 3T1QA 5DMHA 1JSCA 3FCOA 2GA8A 3PGXA 4HLUA 4DYDA 4DIUA 2IITA 2G4CA 2D4AA 3DKRA 3ICCA 1MGOA 1W36D 2X0RA 3D6AA 2UAGA 3B3FA 1A69A 1Y1RA 3A1FA 2DYSC 4TSRA 4J0GA 4XEUA 1PG5A 5DLJA 5CFRA 3EGOA 5IVHA 2ST1A 1V11A 3FI9A 2ZBDA 2P7HA 1R6UA 4KQ9A 4ESEA 1CQPA 3ZHCA 3IV9A 3RVQA 5TGTA 4HXYA 5LQKA 3B3GA 3EDOA 2I3GA 1AHIA 1SXJB 1E60A 4XPWA 4HLQB 3WAKA 1T2AA 4ILEA 2WQ6A 1GM5A 1N6IA 3OWOA 3BFJA 5FFNA 2QUIA 2GK6A 4A0HA 4KQFA 3OU2A 4PWZA 4JS0A 3WQRA 4NS4A 1EGMB 2OCKA 3VX4A 3FHDA 4CR6A 3LYHA 5HJEA 2DETA 3RQFA 1J33A 4M99A 4D81A 4RIFA 3WGGA 7AT1A 1JBEA 3FNBA 4AQYB 1NMSA 2OHGA 1GU7A 5LQMA 2I7DA 1GZSA 2J48A 5CA0F 2Z08A 2IKQA 4UULA 2IV2X 4RKQA 1O0BA 5FP0A 2O52A 1MOPA 1JH9A 3LPLA 2FH5B 4ZRMA 3TD7A 5GPBA 4TLDA 1I4DD 4BV9A 3PHBE 4EB3A 2OQMA 4RVCA 1R0YA 3HH8A 1IHXA 3QYAA 3JRWA 1CU1A 3TI7A 2OCPA 1ZM3A 3U1BA 4OLJA 2NYVA 3F1KA 3LW7A 3L9XA 1EDDA 2AJCA 1BO6A 1P7WA 1JHDA 3CM0A 3HJUA 4JZKA 2H2WA 3LWDA 5IKEA 1UWVA 4FLFA 3PFBA 2ECPA 3LQ2A 2AG5A 4JC5A 3K0BA 3ICQB 5BNIA 3INNA 4FN4A 2DYKA 3MUNA 1KMMA 3IQTA 4J91A 2EX4A 3T6GB 3RIXA 2NUPB 4NAUA 3TCNA 1DFGA 1RQXA 3IKJA 2QAGA 3NTLA 3DJUB 1G291 3MWDA 1OLSA 3FOOA 1OROA 4BO2A 1C7EA 2CXNA 3QA3E 4B5KA 1SIBE 1UM8A 3JZMA 4OGGA 4Q3AA 4A0SA 2BFNA 2IL1A 1YWGO 4GVXA 2EJVA 1D2MA 5AJZA 3UATA 2P2DA 5IJXA 3KL2A 2ZR9A 3GA0A 3HUTA 1UBJS 4R2HA 3EQ2A 2GR9A 4MRMA 3VO9A 1OLUB 4C6RA 2QU7A 5G3YA 3FKSA 1U8EA 1A5TA 3DCNA 3G8CA 1M2WA 3QTTA 1WAMA 5LOVA 1XC7A 2LTAA 2F3UA 2J9GA 4G1CA 3JQ7A 4J43A 1WQ3A 4I1OB 1R4MA 5FOVA 1KZ1A 1JQ3A 4L73A 3F2IA 3DAOA 5JD5A 2JFFA 2WPDA 1JQBA 1BR1A 1IZZA 5E2IA 5JT1A 3L6CA 8ADHA 3CWZA 1WWPA 2VYVA 5ER9A 5JTTA 1H93A 2GHTA 3SE7A 3VU8A 4M88A 2QENA 5TNXA 4ESVA 4YL0A 2I2BA 1EFRA 1TEHA 3FJOA 5HBRA 4F6LA 4J76A 3DBLA 2ZKLA 4JHXA 2WTMA 1RWNA 2OOCA 2Q4TA 4BGUA 4XUEA 2O3UA 1U2DA 1ZRHA 3X1JA 5DTJA 5ITVA 1ODJA 5AW9A 4ENRA 3UA4A 1PQWA 2Q5IA 3CXUA 2FLVA 1RJWA 3DHNA 3X1DA 3BL8A 3F67A 3J81A 3AILA 4C14A 2XL4A 5A4JA 1L5OA 1DAIA 5IABA 3WLLA 4FFNA 3DT9A 3AEUA 3IILA 1TM2A 2OO7A 1A50B 1V5WA 1H2YA 2Z43A 2AK2A 2B98A 2OU6A 2F48A 5G40A 3U31A 2QN6A 4BMZA 5KNBD 2HO4A 2WSSD 4DYHA 5BSUA 3PNKA 4Q1CA 1CQJA 2C2OA 3NAGA 3W4YA 2CLFB 4IZOA 5KVAA 4J16A 4YMGA 4MUAA 1E63A 2GN4A 2A6PA 2HF8A 2NAFA 3PX3A 1BVRA 3L6EA 2WAAA 5DGTA 4IS3A 4P1ZA 4B3DA 3AF2A 3FZNA 1PUIA 1GZDA 5C46F 1JG6A 5AI0A 5CVUA 5DSTA 5BYAA 3EZ7A 1UP4A 1C0EA 3K35A 1XKTA 3BZBA 1O0CA 2ORWA 3B6ZA 1WJGA 5IYZB 1HE9A 1HY5A 3ZWXA 2AOUB 1VE3A 1PT6A 3KYIB 3NYIA 2HSJA 4DLYA 5A3JA 3ROTA 1Y3DE 1E4OA 3B9RA 2AD1A 3AM3A 4I9HA 3IVMA 4HX5A 2W4IA 4XFJA 3IAS1 1AK1A 5E7MA 5FPTA 2R4TA 5JMPA 5C80A 5CVVA 1FJGB 3LK6A 1V4BA 5B3LA 2EIXA 2VDOB 4LVOA 3RARA 3I5XA 5AK0A 3HCPA 2GVNA 4YUZA 5E2AA 1D4AA 3U7GA 2IYLD 2M1XA 1RZRA 4FIDA 1JWLA 2PQ6A 4CKEB 4GX1A 1OW8A 3IP3A 4Z53A 1MIHA 3QUAA 5B4TA 3CGGA 1EHCA 4EUKA 2PLAA 4MZDA 4O2AB 1FSFA 2J3EA 4D43A 2JFQA 2PLWA 2SHKA 3ASUA 3T06B 2P2NA 4UOZA 2JW5A 2OBLA 3O47A 4ULVA 1K4YA 3IBSA 3N75A 3GN1A 4IEFB 1M1XB 1SBQA 3OFNA 1HORA 4K81B 4KI7A 1HE5A 4E12A 1Y82A 4HQOA 4YGYA 4RMHA 3A0UA 4YYEA 3WV5A 3NKDA 3OCCA 4DY4A 4ED9A 1V48A 2RFLA 2ZJYA 1DDGA 2BFWA 1GKLA 2WJAA 4Y6PA 2DPXA 4E30A 1TZ2A 2GH1A 1ORJA 4II2A 3PXGA 4AKSA 3S68A 1VHTA 2PS3A 1U8FO 4TVKA 1XXHB 1ZN9A 2WM2A 1GFIA 5TS2A 2EIJC 5ALSA 6ADHA 2YL0A 3E5NA 4PYQA 4PG6A 2DFTA 3R3VA 3UB3A 4A6EA 3V34A 3RGWS 3B12A 2WD7A 1LRJA 4FCTA 4G86A 4RDAA 4HEHA 3VPXA 5AVJA 4L7QA 1CDZA 1SMYF 4MVJG 3VR4H 1UOEA 3GLUA 5SYMA 2ZITA 4R8MA 4E51A 4FS8A 5CGQB 5JNRA 3OKPA 4TN1A 3V5NA 4H7HA 3ICWA 4MRSA 1D2EA 3IPRA 5L6LB 2I15A 3GY0A 2O2CA 2J3DA 5EWJB 2XLHA 4IX1A 2P61A 3IB3A 3EULA 5ILGA 1ID8A 2OJED 3H2UA 4XE5A 2H51A 2C1ZA 3GQVA 5JHHB 3DH0A 3B6IA 3WB0A 1AGNA 4I9NA 3CZ5A 4RKWA 1GQRA 2Y1OA 4F60A 4CCAA 5FL3A 4BFTA 1MORA 1REQB 3KPHA 3RQGA 3X1ZA 1YA4A 3T5GA 1JTEA 4BYGA 3E3MA 2BV3A 4DBLC 2LUOA 2VZ0A 1LW7A 2F1KA 4ARAA 1J0CA 3CMMA 5DI9A 1SZPA 2Z4RA 4K1OA 3IHUA 1VE1A 3V1TC 1NFNA 5TARA 3DD5A 3FWKA 4UAVA 5EMLA 1DFHA 1ZONA 3KO8A 4NBVA 1BMDA 1YULA 3W8NA 3OA1A 3RS9A 3BG5A 4NYMQ 2BDEA 5F5NA 2NUTB 4BX0A 2CKMA 4CKZA 1Y4DE 4S1VA 4ZPXA 3OZTA 1GFWA 1A5SB 4YCDA 1D2RA 1Y81A 5KQMA 1EFDN 1Q0FA 3KEGA 3PNVA 1WV0A 2HH9A 1Z6PA 1NRIA 1T0PA 4IQ4A 3RV3A 2X4DA 2JJYA 2GZAA 1J5PA 1BKSB 3ENWA 5B58T 5BYJA 1HDOA 4LE2A 3IUJA 5G0WA 1ODFA 1YRLA 3KL4A 2FSHA 4AWBA 3GPIA 1JDSA 5MF6A 4CUJA 3THXB 2B82A 2AOXA 1VPTA 2A7QA 1S2MA 3LK7A 3NHBA 4CI9A 2I8LA 1Z18A 5K4HA 5JJIA 5JZVA 2F1RA 4Y2XA 4MTCA 3LGSA 4C07A 4TQUS 2WF6A 2YLDA 4MJXA 1CYEA 4J8PA 4DV4B 4RF2A 3U6KA 1NUHA 3NCTA 4HH4A 3HA2A 4CM8B 2JFHA 5BSHA 2XNSA 1AX9A 5KHLB 1KDTA 1NP7A 3O39A 3EPPA 3R3ZA 1XJQA 3MFYA 4M46A 4MRPA 1HE3A 4LQDA 3C18A 1UM9A 3WYNA 1T0HB 2WFMA 4XDGA 1MIOA 1VE9A 4NHEA 2YYZA 4I9GA 2I6QA 4JBGA 5GIOE 1XLWA 3ZV7A 2FDRA 5FT9A 3LD9A 1GGFA 2WMYA 4BECA 4GOXA 2FRVA 1UBTS 4CMIB 1GS9A 1R4NA 4R0NA 3W1VA 4LDNA 2YASA 4IV5A 3RSCA 3GLHE 3ID6C 1DKQA 1A96A 1BDJB 3ZCTA 1XDBA 1NQVA 2QXUA 3DDOA 3HP1A 1O57A 3EW7A 1XZMA 2I6UA 2MHCA 4NZNA 3BHMA 2J32A 3CRVA 1GFZA 1QONA 2RONA 1TJYA 1C7RA 5FBWB 3U7HB 4EWCA 1XTIA 3CIOA 1OFGA 1LBSA 2AF3C 5IU6A 3SWWA 4HQKA 2ERXA 2AWNA 2B5VA 5KNDD 1J0XO 1ZHOA 1F2TB 4YPOA 2DBYA 1EXWA 1GZ6A 3QKIA 1HV8A 4Z51A 4L75A 1N9GB 3JASA 3GWGA 5ISMA 5DN9A 1R9JA 4FCWA 2QRQA 1Z4NA 1FDUA 4G1FA 5BSKA 2G5GX 1NV9A 2DC1A 3CR3C 1EDZA 2DB3A 1VL1A 4AB1A 1OD6A 1N5KA 2BMJA 1H8HA 1US8A 2XVMA 1M74A 1SUFA 3WJ7A 4EZBA 3OBIA 4GI5A 4AG6A 3ZWCA 1QIDA 1M9NA 5BV1A 5HS6A 3EJ6A 4L6IA 3E9VA 4XGRA 1NVTA 2YVQA 4O6MA 1GXSB 1L3PA 1W44A 1EGQA 4GGMX 3CZCA 5LQUA 2GA9A 4OU4A 2IYOA 1W30A 3WMFA 2CE2X 1WX1A 5JC8A 5TGZA 2G0AA 5AHXA 1G8PA 2CDCA 1KU6A 2XCIA 1SKQA 1M34E 1VCNA 5BV7A 4B40A 3NFRA 1R3DA 2YICA 1ECJA 2H1SA 4E0IA 1DQZA 1FZTA 4I4IA 5AVZA 4O29A 1WXXA 3PFHA 3ZLBA 3EC7A 5JAMA 1T0UA 5IVPA 3NWOA 3Q88A 4UZFA 2PMDA 3ZXYA 2JFNA 3UG7A 3CT4A 1RVDA 4ZZ3A 4G5HA 4EHIA 2OG2A 1ZM7A 3SI7A 4KWCA 3K73O 5TF4A 3W04A 3KQWA 1ZIOA 3ZJYA 3CWQA 2OHFA 1EU1A 2XKBA 1YS6A 3AIOA 5J4YA 2WOOA 3LV8A 1YZTA 3HDTA 2VYNA 4BL5A 4D8TA 3A27A 2RBGA 3SZUA 1Z0UA 5E0KB 5KWIA 1Q57A 3KQQA 3Q6IA 4O4LB 1JJFA 4LV8B 2W43A 3FXAA 2GBLC 3L8FA 4RA6A 1Y3CE 2DHDA 2ZSBA 4HPJB 2UZ1A 4X7BA 3A4LA 1Z75A 3OD5A 3DO6A 2PWPA 3D64A 5KYWA 3PDWA 1G6Q1 4YGXB 4I50A 4Q4JA 3VC7A 2WG1A 2XF8A 4ENPA 3UFXB 4L78A 1F51E 1ZJZA 1CR4A 1UXKA 3OP4A 2BF7A 1RMVA 5J63A 1Q84A 4MH0R 4EQ6B 3B3AA 3LKDA 3U4AA 3S40A 1NTRA 4NCJA 4E07A 3L7MA 5EEHA 4BVKA 2CL7X 5DE3A 1IATA 1MGPA 2XQKA 1U6IA 2VJDA 5E1OA 5H5JA 4IFTA 1YDFA 2AZTA 2WT8A 4OAPA 1H42A 2RIRA 3QEJA 2C5FA 1NIJA 3ZJVA 1MQAA 4FB4A 3CO0S 1T2CA 4L16A 2MSLA 4IMRA 2J07A 2P7VA 4JA2A 1UJ2A 1V54C 4CDGA 4ZU3A 2XXBA 3IS3A 3QKWA 1O4WA 3CB4A 2C07A 2YMLA 4LRXA 1DIBA 1MN6A 4U5QA 4BKMA 2IOFA 3WLKX 4U5GA 3TMAA 2FI1A 3EQ7A 3WK5A 1G8JA 4AMBA 6LDHA 5B1EA 3B0VC 3GJYA 3PICA 2XYRA 2HDOA 3FFXA 2AKAB 3N76A 4MINA 4ZRDA 3A06A 4IWBA 2YMQA 5JAHA 4PRZA 3RABA 3VGPA 4GQAA 4RE6A 3TK1A 5ABPA 2X0CA 2N1MA 1S01A 4DPKA 2DT5A 5CURA 1GN8A 3EZIA 4ZQBA 2XYHA 2Y4NA 4BEMJ 3D8NA 4IMJB 3AIKA 4L5BA 3BZWA 2SECE 4ZYLA 3CFYA 1FRVA 1KRXA 1LSOA 2XZTA 5EJEA 4JR0A 2GVZC 4BY9E 3SXUB 4X7PA 3RVMA 4I55F 3HYSA 5EJ8A 5ELXA 2IS1A 5T3YA 3K30A 2L18A 5LQAA 3GAAA 2BM1A 5ULLA 4D9JA 4GI2A 5C7LO 3PITA 3JRNA 4KX5A 1GGHA 3ISVA 4O1HA 5JZBA 3RW0A 1AQ6A 1QFSA 1S7ZA 1IUOA 3LE8A 2D0PB 2F90A 1ZVZA 3U9SA 4DFDA 4CMBA 4J29A 4BQQA 3MLAA 2I7CA 3ZGVA 5ITZB 3MYYA 4ER5A 1GPJA 2H7XA 3WI7A 1GA6A 5BMVF 2NZVG 4Z0TA 1C7QA 1ZUHA 1UXIA 2I99A 3MBOA 3Q7QA 3DXZA 2V6GA 3LLMA 1UDBA 3H75A 3DQZA 1G1AA 3WWOA 4PSCA 3AJ8A 1SVOA 4Z4IA 1KDRA 4EW3A 5F35A 4YCSA 1Y42X 4Z2YA 4KFRA 2Y0DA 1BFUA 3H9JA 4YB8A 4Q4HB 1RJEA 2NM0A 3H19A 1Z7YA 2J6BA 1YGPA 2XYQA 3PUVA 3QFSA 1Z5VA 1YMQA 4YV1A 4MEAA 3VZCA 3G68A 4RE5A 3E9RA 1ZJYA 1P9OA 4G63A 4LPSA 3LS1A 1NZDA 2MSNA 1L1FA 1Q1BA 2DCUA 2HF9A 2XTMA 3ANNA 1QBKC 2PH3A 2QTCA 3KSRA 4URUR 1NVVQ 3DZBA 4QJBA 3AF6A 2WOJA 5DASA 1WXEA 1UEJA 2G8NA 2I6SA 4RQBA 2FQ1A 2Y77A 3NO4A 1AV7A 1DC3A 5BQFA 3PZBA 1E2NA 1F5NA 3NC4A 4ZIRA 4P0PB 3ON5A 2PO7A 4IGEA 1KPHA 2AIRA 3FR8A 1U0BB 3KWJA 4CMGA 5A6BD 1RCUA 5ERGB 1GPWB 1I94B 3SEAA 3KB6A 5D86A 2H11A 4ZDKA 1PS8A 3GHHA 2VC9A 4LRWA 1RXIA 5F3DA 1ZVQA 3GVPA 3NT4A 4MTFA 4TZTA 5CAEB 4RFSA 1F6DA 4BNDA 2YH2A 4MAAA 4L9RA 4R6WA 4J0KA 4UW9A 3PT9A 2NYRA 4OUKX 4YI5A 1GTG1 1I7DA 3FSEA 4U5DE 4W7HA 4ME6A 3HO8A 4IXWA 1SIWA 1LY1A 1DX6A 4ZT7A 5FTNA 2ACKA 5I9LA 4IHAA 4W1PA 3L0YA 1P0CA 4AURA 3VKGA 3TIFA 1R74A 3U7QA 3PB3A 2OC9A 4FK8A 3OOEA 1YQTA 1P31A 1Y4CA 5BQIA 2RBEA 4DDKA 5DEOA 4GPBA 2BM0A 5F9HA 3ORQA 3AU8A 2VP9A 5GOZA 3QJYA 4PAWA 3SIXA 1PJCA 4FD2A 2HSZA 1XAGA 1ISJA 3OVMA 4I5DA 1YR2A 2B34A 2OYCA 5FX2A 2X4GA 4KSBA 4X41A 1NMEA 1AEPA 2I7XA 4FJ2A 3FVRA 1JHAA 4COKA 4N4AA 3K9QO 1FMTA 4UTPA 2ZU6A 1PTKA 1WEKA 1UQUA 4FDAA 3RTGA 1RQNA 2J8ZA 2ZI3A 2IS2A 3GV0A 3LFHA 3ZDLA 5FI0B 3PG5A 3K0CA 3IQGX 5ALXA 4KSYA 1MJFA 3T35A 4DRIB 3EISA 3SM3A 4IO1A 1I33A 4EG4A 1I8TA 1CRLA 3KJXA 1FYFA 2F43A 3UAWA 4AE4A 1EA5A 3OSZA 1GTMA 2ZWMA 4DRZA 2I0FA 5CA0B 2PMKA 3OG9A 1RP7A 2PFKA 2IPOA 1USKA 1KAEA 2HKIA 2PD3A 2RHDA 3IUPA 1OAAA 3CH5A 4YIKA 1R27A 2HBQA 1JR3E 3GEHA 1A8PA 4ZHQF 2ZIXB 4P4NA 3POVA 2AR0A 2HA6A 3THRA 2P9ZA 3UKOA 2KX7A 3R6GA 4TVBA 3LUAA 4MEJA 3OH8A 5AI4A 1I9CA 1IUNA 3NHAA 2GTIA 5DK6A 2B7LA 1W4ZA 4HAUA 3K09A 1BQ4A 4B3CA 1B7GO 1G2OA 1IW7F 4A2NB 4MS1A 3GORA 3WWDA 2G08A 2QW8A 5DT2A 1TNDA 1WB4A 1VGRA 3KZOA 5K0SA 1TK3A 5AJXA 2WB7A 3UJDA 4AD8A 3ROZA 4OP3A 4ZN6A 3T3GA 3D5EA 3DTVA 1ORDA 2B35A 1XFDA 4NRDA 4DPMA 3OHPA 1CUVA 2IEDA 4NBRA 2X14A 2IBSA 3K9LA 3UJHA 2DAPA 2TS1A 2DKOA 4NBWA 3LQ4A 1YJAA 5IFLA 3NR2A 3Q72A 1POXA 1MX1A 4IS2A 4J0DA 2J9XB 4QA9A 4YLGA 3SIWA 3CZRA 5J2TA 4DSAA 2XB8A 3T3OA 4KQMA 1V45E 5AIBA 3PDHA 4BVFA 2R8ZA 2OV3A 4LJ8A 2FSVA 5ALUA 1YZAA 1AUPA 4Z54A 1PL0A 1VHDA 1TKBA 1WZNA 1EBBA 2HC9A 1K98A 2B4YA 4GR5A 1ISGA 1YIAA 1T4DA 3C3MA 1F60A 1UC9A 4PJMA 4HGPA 3EY9A 1DC7A 4L76A 4MK4A 2ZS7A 2R9RB 4G9BA 4CLXA 1U7OA 4P22A 2B0HA 5CEEA 3HWRA 1RYDA 5B57C 1VLJA 1W88A 4AG5A 4BRWA 4N9QA 4AKHA 5AC5A 5BSTA 4EUHA 4EKEA 2VF4X 3TW0A 2EFYA 4JNCA 4J1SA 3G3EA 3L7BA 4EJSB 4CF7A 4ALLA 1RM5A 1EH5A 4C7JA 1DQYA 1S05A 5IXJA 3HPQA 1J7JA 2Q45A 3ZVNA 3WYGA 4WKGA 4PCVA 2HJ3A 3SHFA 4L4XA 2FWIA 2YCBA 1J2YA 2GX6A 4EHAA 4ZI5A 3ZWAA 3D8RA 2ADFA 2XA9A 1O6ZA 4GWLA 2EARA 5GTDA 4OXRA 3W5IA 4LFCB 3MQFA 4UOQA 4QU9A 4YRQA 4P5EA 1I3LA 2IOFK 3CNHA 3CR8A 4NQFA 1RW4A 1NWCA 1ODLA 2QG6A 3F3MA 1P18A 2I6TA 1WMEA 3T12A 1J00A 3WB9A 3WZ2A 4B3RB 1TAGA 2WA1A 1Q0ZA 1WZCA 4FT4A 2L6FA 5CYOA 1X1QA 3QX9A 5L0HA 1NOKA 4XGNA 2XSZD 1LPPA 1NQTA 3OWXA 5LB4A 2VEOA 5FNVA 2P6PA 3UM9A 3KH2A 4F92B 4BLUA 3A32A 4WZBA 3NUQA 2FUG1 1RCPA 3K6RA 1KZGB 5A4KA 3NQ41 1E32A 1MVNA 4NS1A 4A5OA 3ZKWB 4V1CA 4F9GA 2VQ3A 3PDMP 2XUHA 3SXKA 1DARA 5DLPA 1N2CE 1O3YA 3NYJA 3NC1C 1UMDB 1JFSA 1H94A 4QASA 3LAYA 1BR2A 1CE8A 2A0YA 1L0BA 2IIPA 2D74A 2UUAB 3C3XA 2EWVA 4LVCA 5JRAA 3OJLA 5EGSA 1E5DA 4OAOA 5ARDA 5CITA 4M7PA 1O3UA 3PRYA 4ETWA 2CNDA 4CQNA 4FDUA 4UPVA 1WMAA 2G0TA 4NMMA 3LLKA 3HYRA 3DNFA 2YXLA 1IBSA 4G89A 1P74A 1LNZA 3NYQA 2VP5A 1FDIA 1P8AA 1Y98A 1HNWB 3KZNA 4H1UA 2E9SA 1T1IA 4YRPA 2XDYA 3GRZA 3UUWA 4WQMA 1CUYA 3FY4A 1SQSA 4PY2A 3RF6A 4FFVA 1I3NA 4H1VA 1P0MA 3DKPA 3N8DA 2YIJA 3D2BA 4X9XA 4JI6B 1PFKA 3ROXA 4FWBA 1CQIA 4CGYA 4UTXA 4F5DA 2NSHA 1GRNA 5KWEA 3WRWA 3EUWA 5L53A 1DTWA 4UVIA 3BE6A 1U1DA 1IJKA 3STUA 1PR9A 1OXBB 4HJRA 2FWPA 3ZI4A 3P0FA 4DJFC 4QXRA 4BFSA 3WRVA 5CI9A 3LIIA 1T4BA 4OH1A 4JV5B 4CR7A 5B6PA 4M0DA 1XQVA 4FOPA 2IYFA 3BKXA 3VVMA 2IYZA 3SN6A 4HNUA 1IZ0A 1V4AA 3HEAA 2BFDA 4JIOA 4JOBA 2D8AA 1E1RD 1SR8A 3H11B 4MVJF 2BZ0A 2HJHA 1C3XA 4D80A 5FWAA 3S2IA 3M83A 1W1UA 3QLJA 2RD9A 3FYCA 2GETA 1AK2A 4YRSA 1S5PA 1MAVA 3TJ6A 3HMQA 5BWLA 2A30A 4YUVA 1QCCA 2ZBRA 3H5LA 3UCFA 1TGYA 4JTAB 4QGAA 2E7ZA 3AYXB 1BJRE 4ZCRA 2FPUA 2BTQB 2B1IA 1R16A 2RHLA 2JLVA 2DHCA 3FCCA 4LDKA 4JEIA 1HDYA 2BE9A 3V00A 1NATA 2YW2A 5I7VA 4LFBB 5CB4F 2BI7A 2JS7A 3NBKA 1B76A 5J1TB 1MPXA 3SEQA 3MWLA 2HLDD 5HRCA 5A4IS 1JR8A 1M6VA 3TRKA 2XOEA 3WYCA 2J3IA 3NT5A 3DL7A 3R7BA 1ZCZA 1HEYA 4UXIA 2I3BA 3ES9A 2PLRA 2F1JA 2BR3A 5BWOA 2H07A 4Z1OA 1TC1A 4R7ZA 4MV7A 4R2MA 1W8DA 4ZOBA 2XCSB 3LCUA 3GJ7A 2ZRQA 3FOFC 3FF4A 1J42A 4KACA 1SKBA 1R2QA 4PF1A 4EW2A 5F7OA 2HUPA 5JCJD 2VTBA 5BXQC 5AKEA 1XAHA 5D92A 5B7QA 3MIZA 3F5QA 2NTEA 3PE4A 1VYUA 1BWSA 6YASA 4O4JF 4KV9A 1IMJA 4ZREA 3VC3A 4HOYA 1W5SA 2XX3A 4KZKA 5CLIA 3JQBA 3VI4B 1ZD5A 2BKUA 5JLJA 1RQPA 1KIFA 1YJQA 4AJEA 4LYYA 3OF3A 1WBJB 2DERA 2OM2A 2YZ2A 3C5EA 1U8YA 1J0EA 1AUVA 4JC0A 5HF8A 4XUCA 4L8YA 4DR4B 2NYAA 1DQPA 3H5TA 4EY3A 2ZR7A 3ZE6A 4XLNF 3ZDBA 2PT6A 5TPZD 3CRRA 4CIPA 1B23P 2H1IA 3W4IA 2J7PD 1FXWA 4DEYA 3ITDA 1VSVA 3FYUC 1L4BA 3LVRE 4N4WA 2J45A 4IV0A 4EYKA 2P77A 2R7WA 4QJ5A 1BH6A 4D3FA 3S27A 2G9UA 2QUAA 4YRGA 3G2JA 4D4XA 3QVMA 2QPTA 3EBPA 1G6OA 2IUUA 2C84A 4PICA 3DZGA 5LJLA 1QGUB 1KYQA 1M0SA 2X6TA 2VK8A 4OKSA 4EFNA 3REQA 3HB1A 5GADl 4KRFA 1PWEA 3NOOA 4RELA 1BWRA 4OJMX 2W58A 4CCYA 4PIVA 2QTGA 2CD9A 2RH5A 4FSHA 1JBQA 5EIWA 1VHLA 4NMWA 1Y3HA 2JI6A 2CN1A 3EDMA 3C1TA 5B3KA 4C4XA 3NNSA 1UADA 4C88A 4HNQA 1VSQA 1W2HA 1X38A 4KBLA 1DBRA 4KWHA 1NMQA 3GLIA 2ARKA 5FOXA 1YACA 2V6IA 1XZPA 2FZ4A 5CVDA 1IHDA 1W0KA 4D9KA 4YYZA 2Z8XA 4DNFA 4Q9DA 4CG2A 2B4RO 1X0XA 3R2PA 2Q0XA 3QU4A 4G6ZA 1A9XB 3DE6X 3ILHA 3L7KA 4D4IA 3ZWMA 3UJ6A 5K0EA 4NCIA 3RAEC 2CBGA 3WL4A 3FNHA 3R7CA 1Q3KA 3CINA 1ZGCA 3IOCA 3MELA 5EE1A 3PJGA 1YQXA 4IGKA 1QRUA 3KQNA 4R9VA 4B1FA 1M73E 2OESA 2C4NA 4EY8A 1TA4A 3SBEA 2QLJA 1CUFA 1SBNE 5B2ZA 1JIXA 2Y27A 5CX1A 1JLKA 2QIOA 2G40A 1DOAA 3W8IA 3SC2A 3EASA 2GM3A 4B6IA 3PGA1 2H7VA 1M2KA 4JUBA 5HIKA 4KJXA 4G24A 1AD2A 1R8YA 3MK31 4MUYA 4OXKA 1ICIA 4RTSA 4C6HA 2PRSA 3LPNA 2CLEB 1CUHA 3KHSA 1FUEA 1XQ9A 2RJOA 3MGGA 5DH9A 4Z7JA 2DLDA 3DS8A 1QX4A 4UXJA 1Z39A 2HV6A 4CIHA 4BQOA 1IHOA 4FSDA 4LZNA 3NHRA 4DB4A 1II9A 4PYKA 3UWSA 1WSDA 2O2IA 3WLPA 2WVNA 4HEA6 1P5HA 4Q9HA 1E3QA 2H18A 4NJMA 3USES 1XRPA 5FPHA 3IEVA 3K0AB 4FZ5A 3PLNA 1WWKA 2QL5A 4IWNA 5EKXA 2ZE5A 1JG7A 1XCPA 1CY2A 1MQVA 3U9MA 1RHRA 3VSAA 2ZAGA 4PC1A 4OK3A 4GEGA 5EXDA 4IEIA 3UC9A 4F7DA 3CW8X 4CVNA 2X5XA 2VWGA 4H1HA 3IB6A 1P1JA 1X19A 2D1TA 1UBSB 2BEVA 1EQUA 1PZXA 1CB7A 2FOXA 2LPMA 3CX3A 1FNTc 1UAAA 4P58A 3TBKA 1VGQA 1TF5A 4GT1A 3EB9A 1TU3A 2MSEB 4X00A 1ZC3A 1QC5A 5DYNA 4ZYXA 2VNSA 1FU8A 4F3NA 4Y9UA 2AG1A 3L79A 1M2JA 4U3JA 3UUFA 1XNGA 4GHWA 1QRTA 3CNLA 2PKRA 4WJLA 3F9IA 5GIPE 5IH3A 2EJUA 3VGJA 5F7ZA 3OF2A 2W6JD 1ZXBA 2C2ZA 3DE4X 2HMZA 3AI7A 3COJA 4HXFB 2D13A 4H2DA 5IZCA 4J0FA 3OZIA 2QJRA 4LK2A 4RIEA 4LC9A 2YEVA 3STXA 1PVDA 4MUXA 1XMIA 4YN0B 3L0CA 2EPKX 4O7GA 1TWHA 2FG5A 3TOCA 4OMDA 4PYMA 2D2FA 4G7HF 2YJ4A 3ESYA 3DDZX 1NUUA 2WJHA 3GROA 1OXTA 3RC3A 4ID3A 4K46A 2H4XA 2JLRA 5JQGA 5HPYB 1U2ZA 2X7XA 1KIMA 5HKAA 1TU0A 2VSYA 5AW1A 4RLFA 3WRYA 1JPUA 2ZTMA 3JYPA 3PR2B 1MBZA 3T1YB 4QQNA 4QHSA 2H4HA 4H7IA 1KMIY 5A3RA 2P68A 1Q7CA 1H2BA 3QNWA 1ZW3A 5L0CA 1O5HA 4C3VA 3W5HA 1JU4A 1H2ZA 2HK6A 2J6CA 2QRPA 3CVXA 5CP8A 4GXRA 5KQGA 3W9SA 1U0NA 3E9QA 3I4FA 5EIBC 1ZK3A 2YVKA 5GJCA 2OLKA 2C7RA 4DIFA 4K1LA 3EGDA 1EXDA 3EDQA 4P81A 2R5FA 2QJWA 4JQZA 4X92A 3O55A 3GVHA 1EVKA 4RWEA 4FC7A 3IAM1 4US2R 4FZVA 2AFHB 3A3NA 2BGJA 1Z0SA 4WAUA 1SQFA 5FF9A 4I55B 3ILYA 1JQDA 3AVOA 4WRRA 2P9YA 2WYVA 1I1QB 1TO1E 1BR4A 1K0FA 5I7HA 5FPKA 3ML1A 2VFAA 3NTUA 5FCDA 3V9AA 2EBUA 3EZXA 4NP6A 1V5GA 1QGYA 3C98A 1C50A 3QEMB 3NH6A 1YT5A 4CM9D 1SC9A 5BMVB 4QRHA 3N70A 1Y63A 2H1FA 1TB4A 1ONPA 4KLCA 4WH0A 1EAMA 2BMWA 4Y7CA 4D99A 3VR2D 3IAUA 5L4NA 5ADVA 3GLFE 1T6BY 3O4RA 5G0UA 3M6LA 4I0WB 4X1IA 4Q5SF 1KS2A 3DONA 2X2FA 2RJ3A 1O9HA 3U44B 1Y4UA 4DLSA 4X65B 2QVCA 4FR2A 4HBGA 2YL3A 3IP8A 5K0IA 1JYSA 1PU2A 1KE2A 1RSZA 4DS3A 2M6SA 2DKNA 3AUYA 3ZQVA 4YUWA 4OQLA 4D4HA 2ZT6A 2IX9A 1AQJA