2PX9A

The intrinsic affinity between e2 and the cys domain of e1 in ubiquitin-like modifications
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
217
structure length
217
Chain Sequence
TQRTFPGCTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVSPDRADPEAAWEPTEAEARARASNEDGDIKRISTKEWAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRKRKPPVPLDWAEVQSQGEETNASDQQNEPQLGLKDQQVLDVKSYARLFSKSIETLRVHLAEKGDGAELIWDKDDPSAMDFVTSAANLRMHIFSMNMKSRFDIKSMAGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUMO-activating enzyme subunit 2
publication title The intrinsic affinity between E2 and the Cys domain of E1 in ubiquitin-like modifications.
pubmed doi rcsb
molecule tags Protein binding
total genus 62
structure length 217
sequence length 217
ec nomenclature ec 6.3.2.-:
pdb deposition date 2007-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.520 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ubiquitin activating enzymes (Uba3). Chain: B, domain 2 2px9A01
3DBLB 3GZNB 1TT5B 3DBRB 1Y8QB 1R4MB 1Y8RB 3KYDB 1YOVB 2NVUB 2PX9A 3DBHB 3KYCB 1R4NB
chains in the Genus database with same CATH superfamily
2ETHA 4CYCA 5HNHA 5D6FA 3MKWB 1XMXA 2CYYA 1W36D 1Y1VJ 3GZ6A 4HV5A 1F43A 2M9HA 2HWVA 2ISZA 1S6LA 4MFDA 4IEJA 3GTMJ 1IW7F 3EYIA 3BR0A 4G6QA 2LKXA 3JREA 2RQPA 1ENHA 1E0EA 2MH9A 3GF2A 3P9IA 3T0YA 1HOMA 3C2HA 5H6RA 5HLHA 3DPUA 5F0CA 3F72A 1U6GA 2G9WA 3BG9A 1XDSA 5K5RA 1S8NA 4IRHA 4NC6A 2HYFA 4D5FA 3WE3A 4U0WA 3P7NA 1ZTRA 2L9NA 2BVMA 1H9GA 3VSLA 2W1OA 4MLOA 3LA2A 4CH7A 5AIQA 5LFAA 2ELJA 4P5OA 2ZBKA 5DM7F 2EFNA 1F4KA 3BG6A 4YFXF 4HX7A 2NOJB 3K2ZA 4U7DA 1DP3A 2VKDA 4GGGA 1Y39A 2FE3A 5F64A 3M3YJ 3RKXA 3OIOA 1IN5A 4PJ0C 2L2OA 1SFOJ 2RNGA 3K70C 2XSDC 2KLOA 3M1EA 1XPXA 2YUSA 3IL2A 4IQJA 5JR3A 3IRQA 3CCMI 2UZKA 1YX3A 9ANTA 4U0YA 2OQGA 2DYRH 1SVOA 1BI1A 2ZMEA 3M9AA 3DLLF 1YITI 2X1EA 1XB4A 3IH4A 3I9V2 5F1JA 2L0KA 4BXXJ 2EJRA 2FBIA 2V9VA 3AG4H 4GRIA 3HTUA 3RPUA 4I6ZA 1MDMA 3ASOH 3L2QA 2O9LA 1QPMA 2WADA 3IWFA 3W3CA 3GYHX 2DQRA 4PSWA 4GO1A 4XKBA 2XGCA 4XNFA 4XLHA 3WTXC 3RQ4A 4G6TB 5E17F 3HSFA 2LF8A 1WI9A 2DFHA 1ETWA 3H5AA 3O8HA 2AXTC 2K5CA 2GIVA 5GPCA 1J2XA 2Y48A 2IA0A 2FSWA 5L3DA 3DEEA 1KU9A 1RRJA 3G3ZA 4TV7A 5B3SH 4A3MJ 3K0LA 3H0GJ 1H8AC 2BW3A 2O7OA 4E7SA 2OU2A 2OCEA 1I3AA 4GFBA 4RLFA 3WE2A 2KMUA 4EQQA 2IGNA 3S2HJ 4CYDA 1QZZA 3BR5A 4PJMA 1QVUA 3MEXA 4EJWA 2JUCA 3HOUJ 2NYXA 3OYLA 1FYMA 2WB1N 4FCYA 1X58A 3BPVA 3WTZA 3JSPA 1KONA 2ACJA 1BC7C 1FJLA 3CJQB 2ZMEB 3DF8A 3HOVJ 1QQIA 3IKTA 1IN6A 2HKOA 4LLNA 3OYKA 2L4MA 4JBAA 2EZHA 3JRBA 1FYLA 4LMYA 5EGOA 5ERIA 4QPOA 2FMLA 4XLNF 2VJJA 2EWNA 4BE2A 1WSUA 2EK5A 1IC8A 2K40A 2ZXHA 4A69C 1YTYA 2XGEA 1MDMB 4D0PA 3WTSC 2R7TA 2HDWA 4UHTA 1UCRA 3WGIA 2CS3A 4Q47A 2XKPA 2ZSIB 4W97A 2O61A 3G6EI 2ZKZA 1P6RA 5L3GA 2LF7A 2P6TA 1K78A 3E1SA 3OY9A 4KT5C 4CUGA 2R4GA 1MW7A 4EMSA 2ID3A 2KL4A 5IPAA 3BWGA 3F23A 4BHCA 2F4OB 5EEGA 2LKPA 2HI3A 3DFGA 3BR2A 4DIQA 4CCOA 2V7FA 3CCQI 3Q9VA 2JSCA 1KU2A 2DYSH 3M7GA 3U9GA 2IVMA 2LBFA 2YSRA 3KLNA 3GWZA 2KKOA 1BW6A 3LL7A 5D5WB 4BE0A 3LSKA 2PJPA 1SD6A 4B3XA 3K4CA 2ZNYA 4EM1A 4XR6A 2VC0A 3G1MA 2RGVA 3BR3A 2P7CB 3J7AO 5HLTA 1QVTA 5JHUA 3ZN0A 1YOVB 3L2WA 2X9DA 1YRNA 4B43A 1B59A 2DFFA 3EUAA 4Y17A 2ZNZA 1D1AA 2FX0A 2RVCA 3QOEA 3A01B 2GXBA 2CV2A 1LE8A 1MNDA 2E7WA 5J8CA 1HW1A 5DUIA 3IKVA 1HW2A 1Z0XA 1RKTA 4O3MA 4C2UA 3C7JA 3OS1A 2BY1A 3ZQQA 3AL0C 2DT5A 1WQ2A 1PUEE 4HV6A 1S7AA 5DUKA 4IOCF 3HL2A 4ZYGA 2LC2A 3HOXJ 4M3DA 4M6VA 4A3BJ 2OBPA 3CCRI 2DA3A 1W5CC 2P5VA 2Z1DA 3S1NJ 3LNQA 1XGOA 4D5CA 1XC5A 2IBDA 1ZH5A 1WKMA 2WV0A 2Z9OA 3FKIJ 1VQ6I 3BTLA 2MC3A 4KITB 1H88C 5ICFA 3BZ6A 3NAUA 2KRHA 5CKTA 1GV2A 1I39A 4MQVA 4C2TA 2FOKA 3Q3SA 4L0YB 1HKTA 2GLOA 3GTPJ 1MBFA 6PAXA 1JI8A 2OC6A 1ZHFA 4B3AA 3GTLJ 3EETA 5J4VA 4RAZA 3QODA 3W2WA 5BNGA 1WPKA 1K7AA 1XMAA 2OPTA 1A04A 2XKOA 3PQKA 4E7IA 1PUFA 2FU4A 1IG7A 2O6GE 4B48A 5K7HA 1W4MA 1RZ4A 4YEJA 1UB9A 1LE8B 2MABA 2VC1A 5HS8A 1TWHJ 1LUJB 3CJNA 3CC2I 2QKMB 3DP7A 3LSJA 4KISA 1WFXA 2IS1A 3OS0A 4MTDA 2XAJA 5KK1A 4I98B 3RI4A 1VQ4I 3H3VK 5E3MA 1FNNA 3KP2A 2QCOA 3LSIA 2LTPA 3Q0VA 4LGWA 2NOGA 5CVUA 3DXJF 2CMPA 2BY0A 1LB2A 3CLOA 4H0EA 4XSXF 4NDLA 1OCRH 1ITYA 2A05A 3ABUA 3HDDA 4UUSA 2L9VA 4MNUA 1VF9A 4BU2A 1LPQA 5E8IA 1RKWA 5K7ZA 3BJ6A 3HRSA 1G8XA 3K1MA 4OOIA 1Q1VA 2BHZA 1DGWY 3GLLA 4N0BA 3RKYA 4EM0B 4IX7A 3F8MA 3H1CA 1ZGJA 4HW0A 2F5CA 2HPIA 4OWRB 4FISA 2A6TA 3TBIA 3GFJA 2XAHA 1VQMI 4A3GJ 4KIFA 1XS9A 3SXYA 4XN3A 2A07F 3ABMH 2UWMA 3LSHA 4A0YA 3F6OA 4G7OF 3LQQA 2RDPA 4KICA 3ABTA 1UFMA 4UB8C 3RTRA 5C4JJ 3DLAA 3F8CA 2A3SA 4S04A 2CFXA 4JQFA 3JSOA 1MMAA 1VI0A 1BI3A 1PVEA 4G6DA 2MW8A 2STTA 1MKMA 5FGMA 1YG2A 3BQZA 4XOPA 1MMDA 1ZG5A 1EH6A 3MMYB 1U5TA 5IYCJ 4U87A 1O3SA 1RPWA 1TWCJ 2F48A 3KP5A 2E71A 1WJEA 3TDZC 3FWEA 3COAC 1ULYA 4UUSB 1FBQA 4X0GA 1OCOH 3S2DJ 5E3LA 3OL3A 2A61A 3MKLA 3ZQIA 1TBXA 2EIMH 2V26A 2YU3A 1X2MA 3WG9A 1X3WB 4HBLA 1IO2A 4J00A 3KZIC 2F5DA 2IA1A 3DCFA 5J6XA 4IXAA 3J80Z 4KN7X 2K4JA 5D5UB 2E1CA 2R7OA 4CCNA 1MGTA 4Q48A 4BHBA 1O3RA 1SVLA 1TQMA 2OA4A 2OV7A 3BTIA 5HDNA 1G3WA 3HBLA 4IHYA 3I64A 2KRCA 4A5NA 4BE1A 4ZJZA 1ZRDA 4OINF 2DOFA 5K1YA 2VBYA 4LFUA 1TTYA 3OOPA 2GA1A 1OR7C 3WTVC 2O8XA 1U0JA 5D8KB 1FTTA 3RPUD 5EEAA 1VQLI 3KP3A 4JOMA 2CJJA 3OYAA 3S15J 5LGNA 3LAJA 1A35A 2VIXA 3T5XA 2K9NA 1OCZH 1U5TB 1H9TA 2B7EA 3KYDB 4XBFA 1LVAA 3L09A 4UXNA 4XM3A 2KZVA 1X1AA 2QQBA 2PEXA 4EVIA 4EJUA 1T2KA 3NWSA 1V3FA 1MBJA 3F3XA 3QP5A 2DMNA 5EG0B 3LWFA 3BDDA 3BCAA 2OF7A 4QPQA 4CSWA 3L2UA 3JW4A 1H0MA 1G3YA 1VQ8I 4DZPA 3PO2J 1CQTA 2D5VA 4XLFA 5CVRA 5FB2A 1JKPC 2FNPA 3ROUA 1ETKA 2M0CA 1TQPA 2VQHA 3HGGA 3ULQB 3FXUA 4MEXF 4BDYA 3FX3A 4A3JJ 4L9VA 2HDCA 3GZNB 3UR3C 3HYIA 2DA2A 1SD5A 3K4MA 5DCFA 2PX9A 4HX4A 4BEHA 5ICGA 1LJ9A 1QRYA 4EJOA 4E4HA 4S0HB 1U8BA 2JUGA 1LKXA 3U2RA 3A03A 2LOOA 3EQLF 4DZJA 3JRIA 1K79A 2CGPA 2PMUA 2CV1A 2QUFA 3QYFA 5J1RA 3TDUC 2JQ7A 3KFWX 1CF7B 1I6HJ 4RS8A 5CVJA 2IGMA 2MG4A 1QNTA 4L5EA 2HNHA 2WV1A 2D1HA 2DDBA 1HDDC 1FBUA 1SEUA 2QM3A 5FD6A 2ID6A 4E7ZA 1BOAA 1J9IA 4ON0A 4A0ZA 5KCMA 1BL0A 1FPQA 1GVJA 4AYBA 3VEPA 4RMNA 2ME6A 1RR7A 4XLAA 1D5YA 1G59A 1FOYA 2W00A 4G9YA 1D1CA 3OYHA 1SC7A 3EYYA 3MZYA 2VBWA 4CICA 3DPTA 3A2KA 4HLYA 3CCYA 4IQ4A 2M87A 3FIWA 4DBQA 3S8PA 2MYSA 1X4OA 4FX4A 3FHNA 3BTCA 4FX0A 2B9SA 3ESWB 5LLQA 2V4JC 3LA7A 3S3NA 2N8GA 1WZ2A 3OR2C 1APLC 3ZQHA 4XRSA 4BEHB 3BROA 4M3EA 4NC8A 2WC2A 2E1MC 3CUQA 4HF1A 1WCMJ 3VDXA 2LK2A 2KJCA 1D1BA 2WA0A 3BT9A 3G1OA 2MBFA 3FK6A 3K4LA 2CUZA 3KE2A 3DU6A 1UJ8A 3HSRA 3GMEA 3CMMA 1ODDA 1U3EM 2V6EA 3ZMTA 5FRNA 2F5FA 3OYBA 4MQ9F 2M3AA 2J5PA 4EATA 1KU7A 4FTHA 1E17A 1AKHB 2XPUA 1X3UA 2XRLA 1X1DA 5K7FA 4IRGA 2CQQA 3JAMZ 2XB0X 4HF0A 4HSTA 1I50J 1VNDA 3HC7A 4LOCA 4M3GA 2Q1ZB 2C6YA 4W1UA 2BXYA 5F04A 3OL4A 1EH7A 1D8KA 3W2AA 1UAAA 4BY7J 2YR2A 5HS7A 1YFHA 2VKHA 2VT2A 1MH3A 3M8EA 1SFXA 4HDUA 1DU6A 1OCPA 4EJTA 2IT0A 2ZB9A 5IP6A 5EYRA 2R7DA 4XORA 4P55A 4C30A 1RNLA 3VYSB 2DA6A 3LA3A 1W5SA 1XGMA 1XCBA 3M8JA 3DTIA 1MIJA 2YS9A 1A31A 3CCVI 1HCRA 3CUOA 1R5ID 2NS8A 3DV8A 3TW7A 3AG3H 4E7KA 1UHMA 1E3HA 3RKQA 1LFUP 4GYIA 2GA2A 3CCUI 2JVGA 4FE7A 2KDOA 5IT9Z 1RUOA 1KYZA 1WJFA 2HYJA 3FKJA 4RDUA 1IV6A 4ZDOA 1XG1A 5LEKA 3ZQCA 2IJLA 3RDIA 2M34A 2IXSA 4GCVA 1LFBA 3L2CA 1MD0A 4IVNA 1AHDP 2D2WA 2DA5A 2M8EA 3E6DA 4LB6B 2LH9A 2RKHA 3HM5A 5J4YA 3D1NI 3S1RJ 2VQLA 4KIGA 3E6MA 1NH3A 2VL8A 3P9KA 4A6EA 1Y6IA 3WODF 5JI6A 1R1UA 3G2BA 2R93J 2EB7A 1OFCX 2Y69H 4BQNA 3SZPA 2GBYA 4HOBA 3SDBA 1XGSA 2EV5A 4IHWA 3MKYB 1MBKA 2JZYA 3BP8A 3ZMUA 1W0TA 1DGRM 2W7NA 3JRDA 1TZLA 4A3DJ 2VONA 2KIMA 1MH4A 5DYMA 3HEFA 1BR4A 1Z3XA 2CU7A 4V2FA 4I01A 2FXAA 1X4PA 4O5VA 2VE9A 4RAYA 2GIZA 2JPBA 5GPAA 5L3CA 3RZOJ 4G8XA 2NVYJ 3I59B 4I0AA 3D0SA 1F5TA 4HQMA 1FLIA 4BL0B 2IGKA 3DBHB 2OAZA 3FXMA 4WWCA 5CYVA 2DFEA 2E2JJ 1W1WE 5FKLA 2X6XA 4KUMA 1Y0NA 2P81A 1LDDA 2LYCA 1J75A 2AQFA 2VOPA 4M9ZA 1USSA 2FA5A 2ZMEC 3EDPA 4WX9A 5DD8A 4PGGA 1HKSA 2V9KA 4OIPF 2L7FP 4X1EA 4A0XA 1V55H 4AM3A 4HEA2 3GVAA 3KYCB 2M7BA 2BEOA 5J8FA 2X6OA 2ADUA 2DCEA 4M3BA 2H1KA 3RSNA 2L7ZA 3LQRA 2DPDA 2QENA 2Y0MA 2KIQA 4HLXA 5K5QA 4IHXA 5HLGA 1SD4A 2HOTA 1IXRC 3ZMSA 4LJZF 2E1OA 2P5LC 2W24A 3TGNA 2Z99A 5E1ZB 4L0ZB 3F0CA 2QLZA 3CD6I 2XAQA 3D5SC 3HIFA 2Z3YA 2JA6J 2LSOA 2XVCA 3IAS2 3GUDA 4YFNF 2IS2A 1JGGA 4S05A 2CW0F 1EKEA 1HBXG 3JAMK 3BCBA 4HPQA 1S29A 5DV5A 4LD5A 2HQNA 2L7KA 3C1DA 2K9SA 4EEFG 2ZFWA 4I02A 5D4SA 3HJEA 2XPVA 3J7ZI 3RKWA 4KA4A 4ETSA 1C0WA 2HS5A 2LP0A 1FOXA 5F0HA 4HF2A 1QGPA 5D5XB 1PDNC 2XIGA 4CO8A 4JP0A 5B1AH 4DYRA 1R23A 2IEKA 2M4GA 1USTA 2YX4A 3DTKA 3F6VA 4A12A 4RB1A 1P4WA 5E1WA 2RV8A 5ED4A 2DLLA 1HC8A 4Y15A 3FZVA 2BHYA 2H8WA 1YJ9I 4ZZLA 4B4CA 2WY7Q 3S3MA 2BY3A 5CLSA 3DQVC 1LQ1A 3LSPA 3BG7A 2MGQA 2WAQA 5IT9K 1YS6A 5IP9J 1IDYA 3SEQA 3QU6A 2R7VA 1Z7LA 3A01A 4Q5SF 1BM9A 1TWFJ 1JKQC 5M5WJ 1T6SA 2EV0A 1WJ5A 1J7KA 2R7RA 1LDKB 3OSFA 2OUMA 4RB3C 3MFKA 1ZK8A 2QWWA 3CJRB 1S72I 4HRIA 3AKZA 4UV9A 2A5WA 2RAEA 4M6XA 3SDGA 2JRTA 4MO7A 3F9KA 3TO6A 3IH3A 1Z1DA 2PMZN 1OMIA 5FKNA 1P2FA 1ZARA 1SANA 2EILH 2Z5UA 3TP3A 1A6IA 3D5RC 2AHQA 2CO5A 3JRHA 1FX7A 1TW3A 2L5QA 4FE4A 4YIIA 1GHCA 3WGGA 1ZG1A 4HA8A 2VUMJ 4B1RA 4A93J 2CQ7A 4YIRX 3AAFA 1XSXA 2CUJA 4M74A 2YPRA 4BQOA 2CW7A 1FZPB 1R58A 1T98A 2LDUA 3BJAA 1N75A 2DT6A 1MMGA 2OQRA 4AD9A 4F3QA 1R36A 3I56I 4UY8I 1SVMA 2XAUA 3K7AJ 3WG7H 1JHHA 3VPRA 1HXDA 5LBQA 1FMVA 2JWTA 1E3PA 2JA7J 2EQRA 1STZA 3MCZA 2NRAC 4II2A 2MSYA 2KJBA 1BIBA 2FRHA 1XMKA 4GXOA 4E7HA 1TL8A 2DBBA 4CCKA 1JKOC 3OYGA 4BNCA 3KZZA 2PJRB 3LSTA 3ZN1A 1GVDA 2CUFA 5K5OA 2NVTJ 2EIJH 2Y9YA 4L9JA 2LR8A 4PUSA 3TMOA 5LEJA 3Q5FA 3ZCOA 5EEHA 1VQ9I 1I3QJ 3FF5A 3MD2A 2VPRA 4ZTFA 1KQ0A 1QHHD 1X1PA 4HDVA 3CESA 3C18A 3DBRB 4F55A 3KCCA 1F36A 2DJIA 3OYMA 1L3LA 2EINH 1DDNA 1GDTA 2PLYA 2DK8A 3QPLA 1DUXC 3KLOA 3BZKA 4I99C 1FIPA 3VFZA 1ZG3A 3JRFA 4ABZA 4XSZF 4AU7A 1IRGA 1FT9A 1O7LA 1WWXA 1LEBA 5KHDA 1OCCH 2MLKA 2Z16A 2Z2SB 4IHTA 1D5VA 2R5YA 1UMQA 2OZ6A 3OYCA 2EV6A 2P8TA 2JPCA 2V1DA 5LGTA 3KPHA 2VXDA 1N77A 2Q8KA 3CCLI 4BXFA 3SZGA 1T95A 2O8KA 4HSRA 2DQLA 2H1LA 3FXRA 3HUGB 3I71A 4KN4X 4LK0F 4XKVA 4KIBA 2KZGA 2FF4A 2IS6A 3A0BC 2L7MP 3T1BA 2EFOA 3QQAA 3BC8A 3EUHC 4ENJA 1JUSA 4AVZA 4L5IA 2XC7A 1UHWA 2VASA 4J19A 4Y52J 4PJJA 2PMZA 4WXHA 5BMZA 4RGUA 4CHUA 2HQRA 1S7OA 3KIOA 1R5GA 3TO7A 2QA4I 1W7PB 1JUMA 1REPC 2G7UA 3OIQA 3ZMZA 1ETOA 3PNVA 3SFIA 2XROA 1IXCA 3ZPLA 3K4JA 1U2WA 2OD5A 2Q0OA 3CJTB 5J47A 2JA2A 1YS7A 3H92A 2CQNA 3FHZA 1LEAA 3SFZA 5FFXA 4RM3A 1OLTA 1XGNA 1Z21A 1YE9A 3EUHA 3M1CA 2NVQJ 2OJED 3U1KA 3GFIA 1JXSA 1N25A 4N4OB 4CZCA 3JRAA 1FC3A 1B9NA 3OYFA 2A69F 2A5YB 5HNFA 5DDGA 2QQ8A 3JRGA 2R5YB 1S7EA 3J7AY 4BY1J 4I7HA 1U5TC 2M2EA 5BOXA 1W5TA 2EH3A 1KU3A 2FBHA 2H09A 4BUPA 1X2NA 2BXZA 2MLGA 2E5ZA 1HA8A 2KT0A 4A6DA 2G0EA 1ONVA 5F08A 1R6RA 4L5JA 3T8TA 2DOEA 4WF2A 1KQ8A 2YX7A 4P1WA 3HSEA 2L01A 4JX5A 3NWTA 3BTJA 4KMUX 4P96A 5C44J 2PBIA 3GEZA 1EH8A 1TT0A 2Y75A 1R4NB 1KA8A 5HS9A 2JJ7A 3RJPA 2JN6A 1RR8C 5HODA 3CP8A 2DODA 3QPHA 1KGSA 5J1YA 2CQKA 2K85A 4A3KJ 4NQWB 5EG0A 4AYBN 3ML6A 3M8FA 2HEOA 3ZOBA 3VYRB 3S2WA 1SMYF 1YO5C 2OZUA 3U1DA 2IS4A 2VN2A 3VODA 3OYJA 1E2XA 4Y3OA 2XAGA 3FXOA 1TC3C 3S1QJ 1IN7A 1IN4A 1VQOI 1OYWA 3S93A 2A68F 2LKSA 1IZ1A 2KISA 5E79C 1JTXA 3GXOA 2CUEA 2CG4A 3B73A 3CDIA 3V7RA 1D0YA 3A1YA 2ZJPF 1B8IB 1P4XA 4Z6YA 5CJ9A 3TEDA 4N9HA 3TKYA 1T8IA 2M7AA 3A4CA 1WVRA 3CC7I 4CCJA 5E18F 1O57A 2CFOA 4QSHA 4XICA 1NK2P 2JT1A 5D5VB 2DPUA 3QPTA 3H3ZA 1CF7A 2FMYA 3QAHA 1SFEA 1JHFA 2E19A 2XSJC 4IOAF 3UNGC 3TOAA 1AOYA 2DDAA 5FROA 3CC4I 2NXNB 1YW8A 2EFPA 1NK3P 5JLXA 1ZLJA 2DU9A 3G4SI 3A02A 1O7FA 3TL4X 2R7UA 2GXAA 2K86A 2LY9A 1MMNA 1YW9A 5CVVA 4PFOA 4CDGA 3E5QA 3VYTB 3RQIA 4KJZA 1O4XA 3HPGA 2VOOA 3FXQA 3OSGA 1EA3A 1R5HA 2X1CA 4I0BA 2IA2A 2R5ZB 2PMHA 1BN5A 3MAJA 2HDDA 4F52A 3I53A 2DJNA 3UKGA 2RREA 3I55I 1OYYA 2H94A 3WTWC 2UUZA 2XF6A 3WHCA 3H3UA 4ASNA 3RZDJ 1HSTA 4GDFA 4C2MJ 2XF7A 4Z2YA 3FXLA 5C4XJ 3E6CC 4GYGA 4PZJA 3FM3A 1G3TA 5DM6F 2HZDA 1TNSA 4C9YA 1Z67A 4ZYDA 1Z91A 2KIFA 2OCCH 2XV4S 1XTAA 1U9NA 3CO6C 1ETQA 2LRDA 5KNLA 1R71A 1V54H 1BI0A 2HVQA 4N9IA 3CZ6A 2MA3A 2R7ZJ 1HSJA 4IL6C 4OIQF 2R7WA 3JCUC 4A3FJ 4FASD 1B4AA 4AIHA 1D8JA 4AIJA 2UXXA 2K9LA 1YQAA 3HHHA 1T0FA 1I27A 4PJNA 1AKHA 1IF1A 2QZ8A 1GT0C 1H89C 4RGXA 4O6JA 3ONQA 2VBXA 2HXIA 4E70A 2EPFA 3L1PA 3CUQC 5A2QZ 1A5JA 3ERMA 3OIPA 3DU5A 3IWZA 3FDYA 4PDKA 4Y7NJ 2DTRA 2W48A 2X1DA 2EIKH 3BR6A 3I4NJ 4AIDA 2HKXA 2HTSA 3P9CA 2JTVA 2M30A 4R79A 1ZELA 3G71I 1YLFA 5JLWA 2ICWG 5TRDA 3LSGA 5FO5A 2D1VA 2GXGA 3VSKA 4A5MA 2KHMA 4RBOA 2ZC2A 2DW4A 3VOEA 3F21A 3AG1H 2CQXA 2VKEA 2X85A 1WGXA 4FHTA 1IGNA 5E1XA 1B72A 2Y0SA 3V8LA 1TW2A 4ESFA 3C2GA 4RB2C 1F1ZA 2KPMA 3PO3J 4A3LJ 1A6QA 5JFRA 5FLXK 4ANJA 1G3SA 4MIMA 3RYRA 4BBRJ 4BH9A 1DPRA 1ETXA 3DKWA 1YYVA 4JX6A 4OIOF 1E3OC 2ELKA 3TP0A 3GTKJ 4F91B 4IF4A 3A0HC 5BPIA 1T08B 3H5NA 2XGXA 2DI3A 2QF7A 3SYTA 1YI2I 2M45A 2RN7A 4UVBA 4XLCA 4Y4RA 2HYGD 3E5UA 3PIPF 2I8DA 4FT8A 2W57A 2DFIA 1Z6TA 2KRFA 3E7LA 2NVXJ 3OWTA 2NS7A 1VQ7I 1WI3A 2LNBA 1D3YA 3PL8A 2V6CA 1QO0D 3EUKL 2TRTA 5FRMA 5B1BH 3KP6A 4UUTA 3E3VA 1VTNC 2XRNA 3I59A 3X2QH 3ZR8X 1B72B 3SEZA 5J40A 1NG7A 3RPQA 3D5LA 4D7NA 3I0TA 3IP4B 4RB0A 4F93B 2GQQA 3ASNH 2DMPA 2EZLA 1IN8A 2ZSHB 3R6SA 3WU1B 3FISA 2HZTA 4B44A 4CGZA 3KX2A 4CZZA 2V79A 3OS2A 1PP7U 4XLPF 1FMWA 3BZCA 2WBMA 4CXFA 2X6YA 2D45A 1RIOH 3EPZA 2HFHA 1ETYA 2V1XA 4RA2A 4V2GA 3B6CA 4IRIA 2QYOA 3QYBA 3OYDA 1JUPA 1ACIA 1U78A 2H6BA 2CV0A 3CMAI 3M07A 2WAEA 4ZC3A 2BY2A 1K83J 4A3IJ 1L0OC 1ERDA 3CCSI 4XKWA 3OYEA 4HNTA 1P4AA 2GOXB 3FK7A 3FMSA 5IP7J 3S3OA 3TO9A 3PNYA 2EZIA 2V1NA 4WXCA 2Y2ZA 5IY5H 1UELB 2WAQN 1F9NA 3H9QA 4G7HF 2JSPA 4BBSJ 4E7LA 2ESHA 2ZXWH 3F8FA 2MC4A 3CDHA 4G12A 1I5ZA 2IPQX 4DW6A 2CRGA 2F4MB 2W85A 3MKZA 3Q9SA 4YRVA 4IJAA 4HG2A 2Y30A 1Z9CA 1IAWA 2RNJA 4ZYAA 1GLNA 1XN7A 1XCVA 4P9UA 1DPUA 1Z77A 3F8NA 5D6EA 1FYKA 2E7XA 5A2QK 2R7SA 1FTZA 4PFPA 2VQGA 1R49A 3N05A 1OPCA 2DMUA 2DT7B 3GFLA 2I10A 3QU3A 1WJAA 5HDGA 3ISPA 2W4SA 4E6KG 5IOZA 3KETA 1SFUA 2QBYB 5L3BA 3ABKH 4ZTJA 4LK1F 3KP7A 5L3FA 3CTAA 4RGSA 1IRZA 5DTDA 1ZN2A 3I58A 3L9FA 1Y8RB 3S32A 3SHFA 2LVSA 4ENMA 1SMTA 3I4PA 4L18B 1VQKI 2KQRA 2QSHX 1QHGA 2ZO4A 4BACA 1YIOA 3WU2C 1TWAJ 1TQIA 4RAFA 1B6AA 4C3HJ 1ZREA 1Y1WJ 2HXOA 4OMZA 3CCEI 3I4MJ 2M1BA 3O3KA 2PFBA 4HNVA 1TNTA 1LNWA 2XPWA 2AS5F 1M1EB 1ZR4A 3HTSB 4LLGF 3HRMA 3BR1A 1BJAA 1XX5A 4NBQA 1FOKA 2P4WA 2COMA 1RUNA 3P5JA 4K2EA 2IGOA 3W6KB 4XK4A 3V8JA 5B66C 4UV8A 2G7HA 2R7XA 4CYCB 1OQYA 1UZCA 1GV5A 4XQFA 2WAFA 3J81Z 2NS0A 2M4KA 3R60A 3R61A 4AIKA 1CGPA 3NARA 3GO5A 1ZR2A 4EGZA 1IV8A 2XASA 2LLKA 4HYEA 4D7MA 2PN6A 2P5KA 1V5FA 4KFCA 1FBSA 1TT5B 2A6HF 1ZGWA 2O3FA 1S9HA 1XDUA 5HDKA 4A3EJ 1BR2A 1Z05A 4V19K 2CSOA 2DTZA 3L2VA 3GTGJ 4MHGA 3CO7C 1MNEA 2IRFG 3CMEI 1AA7A 1IXSB 2A6EF 1ORKA 2HQAA 2VJ4A 3IC7A 2VPLA 3C2BA 1K61A 2VBZA 3E5XA 4M71A 4M9XA 4Q4ZF 2FQ4A 5CQGA 1K6OA 1G4DA 3LFUA 3K4NA 3PFYA 3HZJA 1R7JA 5HVQC 1JJ8C 2K3FA 3WTTC 2QQ9A 3HOWJ 1ZRFA 4DBRA 1IJWC 1X3ZB 3QPSA 3BLYA 3C3WA 2PJRA 2ESNA 3GFMA 4KDPA 2QSGX 1FP1D 1HW5A 4YELA 1KZHA 1J59A 4G7ZF 4QIWN 2H6CA 2IW5A 1ZYRF 1QZEA 2PQ8A 4DGWB 2PI0A 3M4OJ 2VJ5A 2L3DA 3BOQA 1WH7A 5TISC 2H27A 2DN0A 2NNNA 2ZFUA 5J3LA 2WY8Q 1XSDA 1DP7P 1WH5A 2BOLA 4DYCA 5H2FC 3WU0A 2EZKA 4DOZA 5FJ8J 5F27A 1MMSA 4LG0A 2VXZA 3SJMA 3GBGA 4AC0A 1K4SA 2L9SA 3HOSA 2HPMA 3GLXA 3DTEA 3K69A 2HOEA 3HKZN 4U7BA 1T33A 4G94A 3PM1A 2F6CA 1XD7A 4AUXA 2XHKA 2F5EA 4B47A 4NHJA 1OJLA 3NEUA 5JVTA 3S16J 4Y33A 1T38A 2YU9J 2MH2A 3Q0WA 3IV5A 2HVRA 3G73A 3R4KA 1YIJI 4XONA 1PYVA 5HLIA 2VODA 4WK8F 2AXLA 1ON2A 4XOTA 3T8RA 2E60A 5EF6A 3WTUC 1U8RA 4OMYA 4ZH4F 2BW3B 3TQNA 2TDXA 2LMDA 1X19A 3HUGA 1ZLKA 3HHGA 3PJRA 2ZCWA 4QLCU 1Y0UA 2PG4A 3V7SA 3CCJI 5CQEA 1FY7A 3BG3A 2XB5A 3RIRA 2FEZA 1WJBA 3F8BA 4BAYA 3GCMA 2FJ1A 4OU0A 3TW6A 4MGRA 2WTEA 4OAZA 2NVUB 5EGOB 4M72A 3IHUA 2M0MA 1W7PA 2VT3A 3E0JB 4HQEA 1I6XA 2X4HA 4ESJA 3MVPA 3HXLA 4LG0B 3GZ5A 1Y8QB 3REOA 1UG0A 1B1BA 1BOBA 3CDLA 1HF0A 1ZAOA 4CCMA 1O3QA 3PUBA 3MZ8A 1K78B 2XUBA 5KAFC 2R7QA 3B02A 2GOMA 2EFWA 2XDVA 3OMYA 3CF2A 5LHGA 3ECOA 3DEWA 3QYEA 4PGHA 3OV8A 5EDNA 5LGUA 1MJBA 2V9PA 3PUFA 4F92B 1K4TA 1JT6A 2O0YA 2F5VA 2LBFB 5GTHC 3H36A 1UHSA 4PJLA 4L9TA 1IUYA 1WJCA 1NTCA 2R92J 2ECCA 2WB1A 2NNYA 4IKFA 3LOCA 4LITA 3AFHA 3J81K 4HZFA 2FOWA 1TWGJ 4L9NA 4C3JJ 3KP4A 4H4KC 4RAGA 3ZXSA 4D9JA 1YJNI 2E2HJ 4LIVA 1D0XA 4LB5A 5L3EA 5LRRA 1RETA 1YRNB 1P9QC 1N78A 3N4MA 1R4MB 2O03A 3K6GA 4I2OA 1P92A 1G2HA 4E7JA 1QA6A 5F1RA 4R8HA 3QRFF 2LREA 2E35A 1FOWA 4NQWA 1B9MA 4ZYHA 1YX5A 4MEYF 1W0UA 1FSEA 4B8XA 1LDJA 1T39A 2E36A 3L7WA 1NHAA 3DWLE 3ZMVA 2FBKA 1GXQA 5TJJA 1X1CA 3PQJA 5DS9A 2Y31A 3HKZA 2MD0A 4Y13A 1K6YA 2P0WA 1HLVA 3ZQFA 1YHQI 4X6AJ 2O5RA 3R0JA 1VQ5I 3PNTA 1MJAA 3VYUB 4IZZA 4UVAA 5TGTA 3H9GA 5GAHJ 1VQNI 1WJDA 5ILSA 1B8IA 2VJIA 4EV0A 3DEUA 1X1BA 4MTEA 1W36C 2Y9ZA 5GP9A 2KFDA 1WHUA 4EM2A 3H5RA 3S17J 1S5LC 1LFPA 3AL0B 5D8LB 5FFZA 2QSFX 2FQ3A 4A2UA 5GADJ 1I1SA 5E3OA 4CCLA 5BS6A 3QWLA 2Q2EA 4XIDA 1QPIA 1O3TA 1ZQ3P 2EBIA 1QZYA 3MQ0A 4XL9A 5HOOA 3ZP5A 4PK4A 4QTRA 2DMTA 3FBIB 4LG3A 3J7YJ 1PUFB 2X0LA 1NG6A 2AQEA 4M6YA 2CH0A 3HOZJ 4ZDPA 4RM2A 5ICEA 1Y56A 5FLXZ 3BY6A 5CVIA 2IAIA 2UV1A 4B09A 1MBHA 5FKKA 2GAUA 5IYBJ 3W6JB 3K1NA 3SQNA 1QBJA 1RC9A 3I3LA 3WGHA 1AU7A 1R1TA 1KQ9A 5E20A 3OYNA 3GX4X 2ZJQF 2R5ZA 1JT0A 2AO9A 1MZBA 1Z7UA 3V4GA 2ELHA 5F6FA 4XRSG 5ILVA 5M5XJ 1HKQA 2B0LA 2XAFA 3DBLB 5DEQA 4UNOA 1OKRA 2E1NA 2K27A 2DO7A 3HGYA 2JK3A 3DKXA 1JJ6C 5AIPA 5LRSA 1FSHA 2VKVA 5KAIC 3PSIA 4KT6A 3HG9A 4BHPA 4EJVA 2VLAA 2ZXJA 2VQCA 2JVHA 3PSFA 4BQQA 5EZGA 3CQZJ 1P7IA 1V4RA 5E8GA 2DA1A 4XRFA 3G1LA 1MSEC 5M3MJ 1OISA 4U0VA 3KEYA 4LLLA 2Q2EB 5FKOA 1YJWI 1IDZA 5C3EJ 2M5WA 3ZMDA 5M3FJ 3RYPA 1I1GA 1SAUA 4BJ6C 3CF5F 4KMFA 4RGRA 2Y0SN 1MSFC 3BQYA 2FUG2 2CW8A 2VI6A 1SFKA 1ON1A 3JTHA 2DMQA 4IPAA 3F22A 4NC7A 5KVRA 1JGSA 4FQGA 1EF4A 2LY1A 2LD5A 4II3A 2B63J 1EV7A 4N4NB 3K9TA 3OR1C 4NUBA 2HOAA 2P7VB 4UUVA 4HNUA 3FBNB 2R7FA 5EJCA 2GZWA 4DJAA 3TOBA 3K10A 4ITVA 2IP2A 5GAEJ 5DCMA 4M73A 3W2VA 2E2IJ 3HOYJ 3K70D 3JRCA 2ME0A 1JTYA 4ENKA 4XRMA 2BV6A 2JMWA 4JK1X 3BG5A 5AONA 2RQQA 4I76A 2ISYA 3H35A 1OR7A 3H9JA 4YG2F 1BR1A 4XLEA 1YW7A 2NAZA 3FXKA 4R1HA 3L00A 1T0FC 4MFEA 2LY2A 3N97A 1Q1HA 2DK5A 3KZYA 1T56A 3PIOF 4IO9F 1ETVA 2HVSA 1BIAA 3ZGKA 4JX4A 3WTYC 3HB9A 3U21A 4BJ5C 2E34A 5J1UA 3CP2A 2L02A 1VZ0A 3IRRA 1BJZA 1POGA 2X6WA 2V1UA 5H6QA 3GTOJ 1BI2A 2H8RA 1U9OA 2KP6A 3KEOA 2R0QC 5LHIA 3O8GA 3LSRA 4NNJA 4XMYA 3IH2A 3I5UA 5FLVA 5CPRB 4D1QA 3CMYA 3HRTA 2VE8A 2ZXIA 2HQ5A 2BYVE 2JA5J 2EA2A 5LHHA 2X48A 2OTJI 4WXDA 1JKRC 3DPLC 3GW2A 4QWQA 1HDPA 2I5UA 1EJ9A 3S14J 5B5EC 1J5YA 1RESA 4UB6C 5DCMB 1HQCA 4NB5A 3V7CA 4BYYA 3K4BA 2HU9A 4BQAA 4PSXA 2X51A 3ELKA 1PJRA 2K3PA 5FD5A 2F2EA 1IRXA 1JE8A 3GTJJ 3B6AA 1DU0A 4WCGA 4FETA 3JTGA 3E97A 2Z33A 4BS9A 2CWEA 1FIAA 3LSMA 1J09A 3K2AA 3IUOA 5H20A 5IT3A 2BVLA 4IHVA 2J5OA 5ICCA 1GXPA 3KYLA 3K4KA 3ZQ7A 1TP4A 2JRMA 5IOYA 3ECHA 2BBYA 3Q0UA 4AWXB 3PFIA 2OTLI 4I09A 2RC4A 3ABLH 3R0AA 5JVGF 3V42A 1ZKGA 5ILUA 3E6BA 3ERED 2VB6A 5DD4A 3IAM2 1MBEA 2K9QA 2W25A 1A36A 1LVKA 2F4IA 2LFBA 2EFQA 2QVOA 3HRUA 1SD7A 3HPHA 3FM5A 5M5YJ 3JR9A 5BPDA 3ZQLA 1DQUA 3GTQJ 2R3SA 1W7PD 1SAXA 2HGCA 4U88A 2DXIA 3MWMA 4BDZA 1UG2A 1RI7A 1D0ZA 3OYIA 1V5GA 4ESBA 3K1PA 5FKMA 5D4RA 3BPXA 3NRVA 5F0FA 1WRJA 2E5NA 4F7ZA 1BW5A 2FD5A 2MFZA 2BZTA 1P7JA 4ENNA 3OOUA 5E3NA 1S3JA 4M9SA 3RCOA 3ZRGA 3FMQA 4RLQA 2QQAA 3VWBA 1GUUA 2DOAA 2K7LA 2M8GX 1MJ9A 3J80K 4OAYA 4BKXA 2QKLB 1IUFA 3MZHA 4YFKF 2DA7A 3LMMA 4KYWA 2KIUA 3FMRA 5GAGJ 1R9TJ 4XN0A 2ZJ2A 3O6BB 2P6SA 4BGDA 4UVCA 5BQTA 2GM4A 4ZDLA 4LIUA 2HOSA 3I54A 1V5EA 5LD2C 3AG2H 5JHFA 2HR3A 2EA4A 2W82A 1Z6RA 2K9MA 1KYWA 2WWYA 3DKYA 3NQOA 3L2RA 5IYDJ 1FP2A 3QOPA 3CUQB 4BJTA 3S1MJ 4BXUA 5GTIC 2COBA 1IRFA 4JYKA 1J0RA 4DNCA 2K02A 4J01A 4CA0A 1PP8F 2STWA 4M3FA 2QBYA 4KNYA 3QP6A 2KDZA 2LG4A 3ZQGA 1MBGA 3KEQA 3VB2A 2UXNA 2K4BA 1FWZA 1G6NA 4YIFA 2HTJA 2QGUA 1ZGAA 4EGYA 2BGCA 4IHSA 3WHBA 2XGDA 1MNMC 1OYIA 2BE5F 2JA8J 3O2PE 2MD5A 4PCQA 3LAPA 2ZJRF 3SZTA 3CLQA 1FEXA 3LFKA 4HAMA 1QU3A 2FNAA 1ZRCA 5FLMJ 1XSVA 4AVPA 1VFCA 3HOTA 2E1MB 3V8KA 2GWRA 1Z3YA 4P9FA 4A3CJ 4ZZDA 4XKCA 1AWCA 4DQ2A 2L9RA 2L4AA 2W84A 3BJOA 3FXJA 1VQPI 3W6VA 2TCTA 1TLHB 1R22A 3H0DA 3MN2A 1BC8C 1BBYA 4C3IJ 4DYQA 1R00A 4HX8A 1R1VA 4OIRF 1BA5A 2DAOA 1OCTC 2L54A 2XF5A 4ZYEA 2QEXI 2DA4A 2ECBA 5EZHA
chains in the Genus database with same CATH topology
3DBLB 3GZNB 1TT5B 3DBRB 1Y8QB 1R4MB 1Y8RB 3KYDB 1YOVB 2NVUB 2PX9A 3DBHB 3KYCB 1R4NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DBL B;  3GZN B;  1TT5 B;  3DBR B;  1Y8Q B;  1R4M B;  1Y8R B;  3KYD B;  1YOV B;  2NVU B;  2PX9 A;  3DBH B;  3KYC B;  1R4N B; 
#chains in the Genus database with same CATH topology
 2ETH A;  4CYC A;  5HNH A;  5D6F A;  3MKW B;  1XMX A;  2CYY A;  1W36 D;  1Y1V J;  3GZ6 A;  4HV5 A;  1F43 A;  2M9H A;  2HWV A;  2ISZ A;  1S6L A;  4MFD A;  4IEJ A;  3GTM J;  1IW7 F;  3EYI A;  3BR0 A;  4G6Q A;  2LKX A;  3JRE A;  2RQP A;  1ENH A;  1E0E A;  2MH9 A;  3GF2 A;  3P9I A;  3T0Y A;  1HOM A;  3C2H A;  5H6R A;  5HLH A;  3DPU A;  5F0C A;  3F72 A;  1U6G A;  2G9W A;  3BG9 A;  1XDS A;  5K5R A;  1S8N A;  4IRH A;  4NC6 A;  2HYF A;  4D5F A;  3WE3 A;  4U0W A;  3P7N A;  1ZTR A;  2L9N A;  2BVM A;  1H9G A;  3VSL A;  2W1O A;  4MLO A;  3LA2 A;  4CH7 A;  5AIQ A;  5LFA A;  2ELJ A;  4P5O A;  2ZBK A;  5DM7 F;  2EFN A;  1F4K A;  3BG6 A;  4YFX F;  4HX7 A;  2NOJ B;  3K2Z A;  4U7D A;  1DP3 A;  2VKD A;  4GGG A;  1Y39 A;  2FE3 A;  5F64 A;  3M3Y J;  3RKX A;  3OIO A;  1IN5 A;  4PJ0 C;  2L2O A;  1SFO J;  2RNG A;  3K70 C;  2XSD C;  2KLO A;  3M1E A;  1XPX A;  2YUS A;  3IL2 A;  4IQJ A;  5JR3 A;  3IRQ A;  3CCM I;  2UZK A;  1YX3 A;  9ANT A;  4U0Y A;  2OQG A;  2DYR H;  1SVO A;  1BI1 A;  2ZME A;  3M9A A;  3DLL F;  1YIT I;  2X1E A;  1XB4 A;  3IH4 A;  3I9V 2;  5F1J A;  2L0K A;  4BXX J;  2EJR A;  2FBI A;  2V9V A;  3AG4 H;  4GRI A;  3HTU A;  3RPU A;  4I6Z A;  1MDM A;  3ASO H;  3L2Q A;  2O9L A;  1QPM A;  2WAD A;  3IWF A;  3W3C A;  3GYH X;  2DQR A;  4PSW A;  4GO1 A;  4XKB A;  2XGC A;  4XNF A;  4XLH A;  3WTX C;  3RQ4 A;  4G6T B;  5E17 F;  3HSF A;  2LF8 A;  1WI9 A;  2DFH A;  1ETW A;  3H5A A;  3O8H A;  2AXT C;  2K5C A;  2GIV A;  5GPC A;  1J2X A;  2Y48 A;  2IA0 A;  2FSW A;  5L3D A;  3DEE A;  1KU9 A;  1RRJ A;  3G3Z A;  4TV7 A;  5B3S H;  4A3M J;  3K0L A;  3H0G J;  1H8A C;  2BW3 A;  2O7O A;  4E7S A;  2OU2 A;  2OCE A;  1I3A A;  4GFB A;  4RLF A;  3WE2 A;  2KMU A;  4EQQ A;  2IGN A;  3S2H J;  4CYD A;  1QZZ A;  3BR5 A;  4PJM A;  1QVU A;  3MEX A;  4EJW A;  2JUC A;  3HOU J;  2NYX A;  3OYL A;  1FYM A;  2WB1 N;  4FCY A;  1X58 A;  3BPV A;  3WTZ A;  3JSP A;  1KON A;  2ACJ A;  1BC7 C;  1FJL A;  3CJQ B;  2ZME B;  3DF8 A;  3HOV J;  1QQI A;  3IKT A;  1IN6 A;  2HKO A;  4LLN A;  3OYK A;  2L4M A;  4JBA A;  2EZH A;  3JRB A;  1FYL A;  4LMY A;  5EGO A;  5ERI A;  4QPO A;  2FML A;  4XLN F;  2VJJ A;  2EWN A;  4BE2 A;  1WSU A;  2EK5 A;  1IC8 A;  2K40 A;  2ZXH A;  4A69 C;  1YTY A;  2XGE A;  1MDM B;  4D0P A;  3WTS C;  2R7T A;  2HDW A;  4UHT A;  1UCR A;  3WGI A;  2CS3 A;  4Q47 A;  2XKP A;  2ZSI B;  4W97 A;  2O61 A;  3G6E I;  2ZKZ A;  1P6R A;  5L3G A;  2LF7 A;  2P6T A;  1K78 A;  3E1S A;  3OY9 A;  4KT5 C;  4CUG A;  2R4G A;  1MW7 A;  4EMS A;  2ID3 A;  2KL4 A;  5IPA A;  3BWG A;  3F23 A;  4BHC A;  2F4O B;  5EEG A;  2LKP A;  2HI3 A;  3DFG A;  3BR2 A;  4DIQ A;  4CCO A;  2V7F A;  3CCQ I;  3Q9V A;  2JSC A;  1KU2 A;  2DYS H;  3M7G A;  3U9G A;  2IVM A;  2LBF A;  2YSR A;  3KLN A;  3GWZ A;  2KKO A;  1BW6 A;  3LL7 A;  5D5W B;  4BE0 A;  3LSK A;  2PJP A;  1SD6 A;  4B3X A;  3K4C A;  2ZNY A;  4EM1 A;  4XR6 A;  2VC0 A;  3G1M A;  2RGV A;  3BR3 A;  2P7C B;  3J7A O;  5HLT A;  1QVT A;  5JHU A;  3ZN0 A;  1YOV B;  3L2W A;  2X9D A;  1YRN A;  4B43 A;  1B59 A;  2DFF A;  3EUA A;  4Y17 A;  2ZNZ A;  1D1A A;  2FX0 A;  2RVC A;  3QOE A;  3A01 B;  2GXB A;  2CV2 A;  1LE8 A;  1MND A;  2E7W A;  5J8C A;  1HW1 A;  5DUI A;  3IKV A;  1HW2 A;  1Z0X A;  1RKT A;  4O3M A;  4C2U A;  3C7J A;  3OS1 A;  2BY1 A;  3ZQQ A;  3AL0 C;  2DT5 A;  1WQ2 A;  1PUE E;  4HV6 A;  1S7A A;  5DUK A;  4IOC F;  3HL2 A;  4ZYG A;  2LC2 A;  3HOX J;  4M3D A;  4M6V A;  4A3B J;  2OBP A;  3CCR I;  2DA3 A;  1W5C C;  2P5V A;  2Z1D A;  3S1N J;  3LNQ A;  1XGO A;  4D5C A;  1XC5 A;  2IBD A;  1ZH5 A;  1WKM A;  2WV0 A;  2Z9O A;  3FKI J;  1VQ6 I;  3BTL A;  2MC3 A;  4KIT B;  1H88 C;  5ICF A;  3BZ6 A;  3NAU A;  2KRH A;  5CKT A;  1GV2 A;  1I39 A;  4MQV A;  4C2T A;  2FOK A;  3Q3S A;  4L0Y B;  1HKT A;  2GLO A;  3GTP J;  1MBF A;  6PAX A;  1JI8 A;  2OC6 A;  1ZHF A;  4B3A A;  3GTL J;  3EET A;  5J4V A;  4RAZ A;  3QOD A;  3W2W A;  5BNG A;  1WPK A;  1K7A A;  1XMA A;  2OPT A;  1A04 A;  2XKO A;  3PQK A;  4E7I A;  1PUF A;  2FU4 A;  1IG7 A;  2O6G E;  4B48 A;  5K7H A;  1W4M A;  1RZ4 A;  4YEJ A;  1UB9 A;  1LE8 B;  2MAB A;  2VC1 A;  5HS8 A;  1TWH J;  1LUJ B;  3CJN A;  3CC2 I;  2QKM B;  3DP7 A;  3LSJ A;  4KIS A;  1WFX A;  2IS1 A;  3OS0 A;  4MTD A;  2XAJ A;  5KK1 A;  4I98 B;  3RI4 A;  1VQ4 I;  3H3V K;  5E3M A;  1FNN A;  3KP2 A;  2QCO A;  3LSI A;  2LTP A;  3Q0V A;  4LGW A;  2NOG A;  5CVU A;  3DXJ F;  2CMP A;  2BY0 A;  1LB2 A;  3CLO A;  4H0E A;  4XSX F;  4NDL A;  1OCR H;  1ITY A;  2A05 A;  3ABU A;  3HDD A;  4UUS A;  2L9V A;  4MNU A;  1VF9 A;  4BU2 A;  1LPQ A;  5E8I A;  1RKW A;  5K7Z A;  3BJ6 A;  3HRS A;  1G8X A;  3K1M A;  4OOI A;  1Q1V A;  2BHZ A;  1DGW Y;  3GLL A;  4N0B A;  3RKY A;  4EM0 B;  4IX7 A;  3F8M A;  3H1C A;  1ZGJ A;  4HW0 A;  2F5C A;  2HPI A;  4OWR B;  4FIS A;  2A6T A;  3TBI A;  3GFJ A;  2XAH A;  1VQM I;  4A3G J;  4KIF A;  1XS9 A;  3SXY A;  4XN3 A;  2A07 F;  3ABM H;  2UWM A;  3LSH A;  4A0Y A;  3F6O A;  4G7O F;  3LQQ A;  2RDP A;  4KIC A;  3ABT A;  1UFM A;  4UB8 C;  3RTR A;  5C4J J;  3DLA A;  3F8C A;  2A3S A;  4S04 A;  2CFX A;  4JQF A;  3JSO A;  1MMA A;  1VI0 A;  1BI3 A;  1PVE A;  4G6D A;  2MW8 A;  2STT A;  1MKM A;  5FGM A;  1YG2 A;  3BQZ A;  4XOP A;  1MMD A;  1ZG5 A;  1EH6 A;  3MMY B;  1U5T A;  5IYC J;  4U87 A;  1O3S A;  1RPW A;  1TWC J;  2F48 A;  3KP5 A;  2E71 A;  1WJE A;  3TDZ C;  3FWE A;  3COA C;  1ULY A;  4UUS B;  1FBQ A;  4X0G A;  1OCO H;  3S2D J;  5E3L A;  3OL3 A;  2A61 A;  3MKL A;  3ZQI A;  1TBX A;  2EIM H;  2V26 A;  2YU3 A;  1X2M A;  3WG9 A;  1X3W B;  4HBL A;  1IO2 A;  4J00 A;  3KZI C;  2F5D A;  2IA1 A;  3DCF A;  5J6X A;  4IXA A;  3J80 Z;  4KN7 X;  2K4J A;  5D5U B;  2E1C A;  2R7O A;  4CCN A;  1MGT A;  4Q48 A;  4BHB A;  1O3R A;  1SVL A;  1TQM A;  2OA4 A;  2OV7 A;  3BTI A;  5HDN A;  1G3W A;  3HBL A;  4IHY A;  3I64 A;  2KRC A;  4A5N A;  4BE1 A;  4ZJZ A;  1ZRD A;  4OIN F;  2DOF A;  5K1Y A;  2VBY A;  4LFU A;  1TTY A;  3OOP A;  2GA1 A;  1OR7 C;  3WTV C;  2O8X A;  1U0J A;  5D8K B;  1FTT A;  3RPU D;  5EEA A;  1VQL I;  3KP3 A;  4JOM A;  2CJJ A;  3OYA A;  3S15 J;  5LGN A;  3LAJ A;  1A35 A;  2VIX A;  3T5X A;  2K9N A;  1OCZ H;  1U5T B;  1H9T A;  2B7E A;  3KYD B;  4XBF A;  1LVA A;  3L09 A;  4UXN A;  4XM3 A;  2KZV A;  1X1A A;  2QQB A;  2PEX A;  4EVI A;  4EJU A;  1T2K A;  3NWS A;  1V3F A;  1MBJ A;  3F3X A;  3QP5 A;  2DMN A;  5EG0 B;  3LWF A;  3BDD A;  3BCA A;  2OF7 A;  4QPQ A;  4CSW A;  3L2U A;  3JW4 A;  1H0M A;  1G3Y A;  1VQ8 I;  4DZP A;  3PO2 J;  1CQT A;  2D5V A;  4XLF A;  5CVR A;  5FB2 A;  1JKP C;  2FNP A;  3ROU A;  1ETK A;  2M0C A;  1TQP A;  2VQH A;  3HGG A;  3ULQ B;  3FXU A;  4MEX F;  4BDY A;  3FX3 A;  4A3J J;  4L9V A;  2HDC A;  3GZN B;  3UR3 C;  3HYI A;  2DA2 A;  1SD5 A;  3K4M A;  5DCF A;  2PX9 A;  4HX4 A;  4BEH A;  5ICG A;  1LJ9 A;  1QRY A;  4EJO A;  4E4H A;  4S0H B;  1U8B A;  2JUG A;  1LKX A;  3U2R A;  3A03 A;  2LOO A;  3EQL F;  4DZJ A;  3JRI A;  1K79 A;  2CGP A;  2PMU A;  2CV1 A;  2QUF A;  3QYF A;  5J1R A;  3TDU C;  2JQ7 A;  3KFW X;  1CF7 B;  1I6H J;  4RS8 A;  5CVJ A;  2IGM A;  2MG4 A;  1QNT A;  4L5E A;  2HNH A;  2WV1 A;  2D1H A;  2DDB A;  1HDD C;  1FBU A;  1SEU A;  2QM3 A;  5FD6 A;  2ID6 A;  4E7Z A;  1BOA A;  1J9I A;  4ON0 A;  4A0Z A;  5KCM A;  1BL0 A;  1FPQ A;  1GVJ A;  4AYB A;  3VEP A;  4RMN A;  2ME6 A;  1RR7 A;  4XLA A;  1D5Y A;  1G59 A;  1FOY A;  2W00 A;  4G9Y A;  1D1C A;  3OYH A;  1SC7 A;  3EYY A;  3MZY A;  2VBW A;  4CIC A;  3DPT A;  3A2K A;  4HLY A;  3CCY A;  4IQ4 A;  2M87 A;  3FIW A;  4DBQ A;  3S8P A;  2MYS A;  1X4O A;  4FX4 A;  3FHN A;  3BTC A;  4FX0 A;  2B9S A;  3ESW B;  5LLQ A;  2V4J C;  3LA7 A;  3S3N A;  2N8G A;  1WZ2 A;  3OR2 C;  1APL C;  3ZQH A;  4XRS A;  4BEH B;  3BRO A;  4M3E A;  4NC8 A;  2WC2 A;  2E1M C;  3CUQ A;  4HF1 A;  1WCM J;  3VDX A;  2LK2 A;  2KJC A;  1D1B A;  2WA0 A;  3BT9 A;  3G1O A;  2MBF A;  3FK6 A;  3K4L A;  2CUZ A;  3KE2 A;  3DU6 A;  1UJ8 A;  3HSR A;  3GME A;  3CMM A;  1ODD A;  1U3E M;  2V6E A;  3ZMT A;  5FRN A;  2F5F A;  3OYB A;  4MQ9 F;  2M3A A;  2J5P A;  4EAT A;  1KU7 A;  4FTH A;  1E17 A;  1AKH B;  2XPU A;  1X3U A;  2XRL A;  1X1D A;  5K7F A;  4IRG A;  2CQQ A;  3JAM Z;  2XB0 X;  4HF0 A;  4HST A;  1I50 J;  1VND A;  3HC7 A;  4LOC A;  4M3G A;  2Q1Z B;  2C6Y A;  4W1U A;  2BXY A;  5F04 A;  3OL4 A;  1EH7 A;  1D8K A;  3W2A A;  1UAA A;  4BY7 J;  2YR2 A;  5HS7 A;  1YFH A;  2VKH A;  2VT2 A;  1MH3 A;  3M8E A;  1SFX A;  4HDU A;  1DU6 A;  1OCP A;  4EJT A;  2IT0 A;  2ZB9 A;  5IP6 A;  5EYR A;  2R7D A;  4XOR A;  4P55 A;  4C30 A;  1RNL A;  3VYS B;  2DA6 A;  3LA3 A;  1W5S A;  1XGM A;  1XCB A;  3M8J A;  3DTI A;  1MIJ A;  2YS9 A;  1A31 A;  3CCV I;  1HCR A;  3CUO A;  1R5I D;  2NS8 A;  3DV8 A;  3TW7 A;  3AG3 H;  4E7K A;  1UHM A;  1E3H A;  3RKQ A;  1LFU P;  4GYI A;  2GA2 A;  3CCU I;  2JVG A;  4FE7 A;  2KDO A;  5IT9 Z;  1RUO A;  1KYZ A;  1WJF A;  2HYJ A;  3FKJ A;  4RDU A;  1IV6 A;  4ZDO A;  1XG1 A;  5LEK A;  3ZQC A;  2IJL A;  3RDI A;  2M34 A;  2IXS A;  4GCV A;  1LFB A;  3L2C A;  1MD0 A;  4IVN A;  1AHD P;  2D2W A;  2DA5 A;  2M8E A;  3E6D A;  4LB6 B;  2LH9 A;  2RKH A;  3HM5 A;  5J4Y A;  3D1N I;  3S1R J;  2VQL A;  4KIG A;  3E6M A;  1NH3 A;  2VL8 A;  3P9K A;  4A6E A;  1Y6I A;  3WOD F;  5JI6 A;  1R1U A;  3G2B A;  2R93 J;  2EB7 A;  1OFC X;  2Y69 H;  4BQN A;  3SZP A;  2GBY A;  4HOB A;  3SDB A;  1XGS A;  2EV5 A;  4IHW A;  3MKY B;  1MBK A;  2JZY A;  3BP8 A;  3ZMU A;  1W0T A;  1DGR M;  2W7N A;  3JRD A;  1TZL A;  4A3D J;  2VON A;  2KIM A;  1MH4 A;  5DYM A;  3HEF A;  1BR4 A;  1Z3X A;  2CU7 A;  4V2F A;  4I01 A;  2FXA A;  1X4P A;  4O5V A;  2VE9 A;  4RAY A;  2GIZ A;  2JPB A;  5GPA A;  5L3C A;  3RZO J;  4G8X A;  2NVY J;  3I59 B;  4I0A A;  3D0S A;  1F5T A;  4HQM A;  1FLI A;  4BL0 B;  2IGK A;  3DBH B;  2OAZ A;  3FXM A;  4WWC A;  5CYV A;  2DFE A;  2E2J J;  1W1W E;  5FKL A;  2X6X A;  4KUM A;  1Y0N A;  2P81 A;  1LDD A;  2LYC A;  1J75 A;  2AQF A;  2VOP A;  4M9Z A;  1USS A;  2FA5 A;  2ZME C;  3EDP A;  4WX9 A;  5DD8 A;  4PGG A;  1HKS A;  2V9K A;  4OIP F;  2L7F P;  4X1E A;  4A0X A;  1V55 H;  4AM3 A;  4HEA 2;  3GVA A;  3KYC B;  2M7B A;  2BEO A;  5J8F A;  2X6O A;  2ADU A;  2DCE A;  4M3B A;  2H1K A;  3RSN A;  2L7Z A;  3LQR A;  2DPD A;  2QEN A;  2Y0M A;  2KIQ A;  4HLX A;  5K5Q A;  4IHX A;  5HLG A;  1SD4 A;  2HOT A;  1IXR C;  3ZMS A;  4LJZ F;  2E1O A;  2P5L C;  2W24 A;  3TGN A;  2Z99 A;  5E1Z B;  4L0Z B;  3F0C A;  2QLZ A;  3CD6 I;  2XAQ A;  3D5S C;  3HIF A;  2Z3Y A;  2JA6 J;  2LSO A;  2XVC A;  3IAS 2;  3GUD A;  4YFN F;  2IS2 A;  1JGG A;  4S05 A;  2CW0 F;  1EKE A;  1HBX G;  3JAM K;  3BCB A;  4HPQ A;  1S29 A;  5DV5 A;  4LD5 A;  2HQN A;  2L7K A;  3C1D A;  2K9S A;  4EEF G;  2ZFW A;  4I02 A;  5D4S A;  3HJE A;  2XPV A;  3J7Z I;  3RKW A;  4KA4 A;  4ETS A;  1C0W A;  2HS5 A;  2LP0 A;  1FOX A;  5F0H A;  4HF2 A;  1QGP A;  5D5X B;  1PDN C;  2XIG A;  4CO8 A;  4JP0 A;  5B1A H;  4DYR A;  1R23 A;  2IEK A;  2M4G A;  1UST A;  2YX4 A;  3DTK A;  3F6V A;  4A12 A;  4RB1 A;  1P4W A;  5E1W A;  2RV8 A;  5ED4 A;  2DLL A;  1HC8 A;  4Y15 A;  3FZV A;  2BHY A;  2H8W A;  1YJ9 I;  4ZZL A;  4B4C A;  2WY7 Q;  3S3M A;  2BY3 A;  5CLS A;  3DQV C;  1LQ1 A;  3LSP A;  3BG7 A;  2MGQ A;  2WAQ A;  5IT9 K;  1YS6 A;  5IP9 J;  1IDY A;  3SEQ A;  3QU6 A;  2R7V A;  1Z7L A;  3A01 A;  4Q5S F;  1BM9 A;  1TWF J;  1JKQ C;  5M5W J;  1T6S A;  2EV0 A;  1WJ5 A;  1J7K A;  2R7R A;  1LDK B;  3OSF A;  2OUM A;  4RB3 C;  3MFK A;  1ZK8 A;  2QWW A;  3CJR B;  1S72 I;  4HRI A;  3AKZ A;  4UV9 A;  2A5W A;  2RAE A;  4M6X A;  3SDG A;  2JRT A;  4MO7 A;  3F9K A;  3TO6 A;  3IH3 A;  1Z1D A;  2PMZ N;  1OMI A;  5FKN A;  1P2F A;  1ZAR A;  1SAN A;  2EIL H;  2Z5U A;  3TP3 A;  1A6I A;  3D5R C;  2AHQ A;  2CO5 A;  3JRH A;  1FX7 A;  1TW3 A;  2L5Q A;  4FE4 A;  4YII A;  1GHC A;  3WGG A;  1ZG1 A;  4HA8 A;  2VUM J;  4B1R A;  4A93 J;  2CQ7 A;  4YIR X;  3AAF A;  1XSX A;  2CUJ A;  4M74 A;  2YPR A;  4BQO A;  2CW7 A;  1FZP B;  1R58 A;  1T98 A;  2LDU A;  3BJA A;  1N75 A;  2DT6 A;  1MMG A;  2OQR A;  4AD9 A;  4F3Q A;  1R36 A;  3I56 I;  4UY8 I;  1SVM A;  2XAU A;  3K7A J;  3WG7 H;  1JHH A;  3VPR A;  1HXD A;  5LBQ A;  1FMV A;  2JWT A;  1E3P A;  2JA7 J;  2EQR A;  1STZ A;  3MCZ A;  2NRA C;  4II2 A;  2MSY A;  2KJB A;  1BIB A;  2FRH A;  1XMK A;  4GXO A;  4E7H A;  1TL8 A;  2DBB A;  4CCK A;  1JKO C;  3OYG A;  4BNC A;  3KZZ A;  2PJR B;  3LST A;  3ZN1 A;  1GVD A;  2CUF A;  5K5O A;  2NVT J;  2EIJ H;  2Y9Y A;  4L9J A;  2LR8 A;  4PUS A;  3TMO A;  5LEJ A;  3Q5F A;  3ZCO A;  5EEH A;  1VQ9 I;  1I3Q J;  3FF5 A;  3MD2 A;  2VPR A;  4ZTF A;  1KQ0 A;  1QHH D;  1X1P A;  4HDV A;  3CES A;  3C18 A;  3DBR B;  4F55 A;  3KCC A;  1F36 A;  2DJI A;  3OYM A;  1L3L A;  2EIN H;  1DDN A;  1GDT A;  2PLY A;  2DK8 A;  3QPL A;  1DUX C;  3KLO A;  3BZK A;  4I99 C;  1FIP A;  3VFZ A;  1ZG3 A;  3JRF A;  4ABZ A;  4XSZ F;  4AU7 A;  1IRG A;  1FT9 A;  1O7L A;  1WWX A;  1LEB A;  5KHD A;  1OCC H;  2MLK A;  2Z16 A;  2Z2S B;  4IHT A;  1D5V A;  2R5Y A;  1UMQ A;  2OZ6 A;  3OYC A;  2EV6 A;  2P8T A;  2JPC A;  2V1D A;  5LGT A;  3KPH A;  2VXD A;  1N77 A;  2Q8K A;  3CCL I;  4BXF A;  3SZG A;  1T95 A;  2O8K A;  4HSR A;  2DQL A;  2H1L A;  3FXR A;  3HUG B;  3I71 A;  4KN4 X;  4LK0 F;  4XKV A;  4KIB A;  2KZG A;  2FF4 A;  2IS6 A;  3A0B C;  2L7M P;  3T1B A;  2EFO A;  3QQA A;  3BC8 A;  3EUH C;  4ENJ A;  1JUS A;  4AVZ A;  4L5I A;  2XC7 A;  1UHW A;  2VAS A;  4J19 A;  4Y52 J;  4PJJ A;  2PMZ A;  4WXH A;  5BMZ A;  4RGU A;  4CHU A;  2HQR A;  1S7O A;  3KIO A;  1R5G A;  3TO7 A;  2QA4 I;  1W7P B;  1JUM A;  1REP C;  2G7U A;  3OIQ A;  3ZMZ A;  1ETO A;  3PNV A;  3SFI A;  2XRO A;  1IXC A;  3ZPL A;  3K4J A;  1U2W A;  2OD5 A;  2Q0O A;  3CJT B;  5J47 A;  2JA2 A;  1YS7 A;  3H92 A;  2CQN A;  3FHZ A;  1LEA A;  3SFZ A;  5FFX A;  4RM3 A;  1OLT A;  1XGN A;  1Z21 A;  1YE9 A;  3EUH A;  3M1C A;  2NVQ J;  2OJE D;  3U1K A;  3GFI A;  1JXS A;  1N25 A;  4N4O B;  4CZC A;  3JRA A;  1FC3 A;  1B9N A;  3OYF A;  2A69 F;  2A5Y B;  5HNF A;  5DDG A;  2QQ8 A;  3JRG A;  2R5Y B;  1S7E A;  3J7A Y;  4BY1 J;  4I7H A;  1U5T C;  2M2E A;  5BOX A;  1W5T A;  2EH3 A;  1KU3 A;  2FBH A;  2H09 A;  4BUP A;  1X2N A;  2BXZ A;  2MLG A;  2E5Z A;  1HA8 A;  2KT0 A;  4A6D A;  2G0E A;  1ONV A;  5F08 A;  1R6R A;  4L5J A;  3T8T A;  2DOE A;  4WF2 A;  1KQ8 A;  2YX7 A;  4P1W A;  3HSE A;  2L01 A;  4JX5 A;  3NWT A;  3BTJ A;  4KMU X;  4P96 A;  5C44 J;  2PBI A;  3GEZ A;  1EH8 A;  1TT0 A;  2Y75 A;  1R4N B;  1KA8 A;  5HS9 A;  2JJ7 A;  3RJP A;  2JN6 A;  1RR8 C;  5HOD A;  3CP8 A;  2DOD A;  3QPH A;  1KGS A;  5J1Y A;  2CQK A;  2K85 A;  4A3K J;  4NQW B;  5EG0 A;  4AYB N;  3ML6 A;  3M8F A;  2HEO A;  3ZOB A;  3VYR B;  3S2W A;  1SMY F;  1YO5 C;  2OZU A;  3U1D A;  2IS4 A;  2VN2 A;  3VOD A;  3OYJ A;  1E2X A;  4Y3O A;  2XAG A;  3FXO A;  1TC3 C;  3S1Q J;  1IN7 A;  1IN4 A;  1VQO I;  1OYW A;  3S93 A;  2A68 F;  2LKS A;  1IZ1 A;  2KIS A;  5E79 C;  1JTX A;  3GXO A;  2CUE A;  2CG4 A;  3B73 A;  3CDI A;  3V7R A;  1D0Y A;  3A1Y A;  2ZJP F;  1B8I B;  1P4X A;  4Z6Y A;  5CJ9 A;  3TED A;  4N9H A;  3TKY A;  1T8I A;  2M7A A;  3A4C A;  1WVR A;  3CC7 I;  4CCJ A;  5E18 F;  1O57 A;  2CFO A;  4QSH A;  4XIC A;  1NK2 P;  2JT1 A;  5D5V B;  2DPU A;  3QPT A;  3H3Z A;  1CF7 A;  2FMY A;  3QAH A;  1SFE A;  1JHF A;  2E19 A;  2XSJ C;  4IOA F;  3UNG C;  3TOA A;  1AOY A;  2DDA A;  5FRO A;  3CC4 I;  2NXN B;  1YW8 A;  2EFP A;  1NK3 P;  5JLX A;  1ZLJ A;  2DU9 A;  3G4S I;  3A02 A;  1O7F A;  3TL4 X;  2R7U A;  2GXA A;  2K86 A;  2LY9 A;  1MMN A;  1YW9 A;  5CVV A;  4PFO A;  4CDG A;  3E5Q A;  3VYT B;  3RQI A;  4KJZ A;  1O4X A;  3HPG A;  2VOO A;  3FXQ A;  3OSG A;  1EA3 A;  1R5H A;  2X1C A;  4I0B A;  2IA2 A;  2R5Z B;  2PMH A;  1BN5 A;  3MAJ A;  2HDD A;  4F52 A;  3I53 A;  2DJN A;  3UKG A;  2RRE A;  3I55 I;  1OYY A;  2H94 A;  3WTW C;  2UUZ A;  2XF6 A;  3WHC A;  3H3U A;  4ASN A;  3RZD J;  1HST A;  4GDF A;  4C2M J;  2XF7 A;  4Z2Y A;  3FXL A;  5C4X J;  3E6C C;  4GYG A;  4PZJ A;  3FM3 A;  1G3T A;  5DM6 F;  2HZD A;  1TNS A;  4C9Y A;  1Z67 A;  4ZYD A;  1Z91 A;  2KIF A;  2OCC H;  2XV4 S;  1XTA A;  1U9N A;  3CO6 C;  1ETQ A;  2LRD A;  5KNL A;  1R71 A;  1V54 H;  1BI0 A;  2HVQ A;  4N9I A;  3CZ6 A;  2MA3 A;  2R7Z J;  1HSJ A;  4IL6 C;  4OIQ F;  2R7W A;  3JCU C;  4A3F J;  4FAS D;  1B4A A;  4AIH A;  1D8J A;  4AIJ A;  2UXX A;  2K9L A;  1YQA A;  3HHH A;  1T0F A;  1I27 A;  4PJN A;  1AKH A;  1IF1 A;  2QZ8 A;  1GT0 C;  1H89 C;  4RGX A;  4O6J A;  3ONQ A;  2VBX A;  2HXI A;  4E70 A;  2EPF A;  3L1P A;  3CUQ C;  5A2Q Z;  1A5J A;  3ERM A;  3OIP A;  3DU5 A;  3IWZ A;  3FDY A;  4PDK A;  4Y7N J;  2DTR A;  2W48 A;  2X1D A;  2EIK H;  3BR6 A;  3I4N J;  4AID A;  2HKX A;  2HTS A;  3P9C A;  2JTV A;  2M30 A;  4R79 A;  1ZEL A;  3G71 I;  1YLF A;  5JLW A;  2ICW G;  5TRD A;  3LSG A;  5FO5 A;  2D1V A;  2GXG A;  3VSK A;  4A5M A;  2KHM A;  4RBO A;  2ZC2 A;  2DW4 A;  3VOE A;  3F21 A;  3AG1 H;  2CQX A;  2VKE A;  2X85 A;  1WGX A;  4FHT A;  1IGN A;  5E1X A;  1B72 A;  2Y0S A;  3V8L A;  1TW2 A;  4ESF A;  3C2G A;  4RB2 C;  1F1Z A;  2KPM A;  3PO3 J;  4A3L J;  1A6Q A;  5JFR A;  5FLX K;  4ANJ A;  1G3S A;  4MIM A;  3RYR A;  4BBR J;  4BH9 A;  1DPR A;  1ETX A;  3DKW A;  1YYV A;  4JX6 A;  4OIO F;  1E3O C;  2ELK A;  3TP0 A;  3GTK J;  4F91 B;  4IF4 A;  3A0H C;  5BPI A;  1T08 B;  3H5N A;  2XGX A;  2DI3 A;  2QF7 A;  3SYT A;  1YI2 I;  2M45 A;  2RN7 A;  4UVB A;  4XLC A;  4Y4R A;  2HYG D;  3E5U A;  3PIP F;  2I8D A;  4FT8 A;  2W57 A;  2DFI A;  1Z6T A;  2KRF A;  3E7L A;  2NVX J;  3OWT A;  2NS7 A;  1VQ7 I;  1WI3 A;  2LNB A;  1D3Y A;  3PL8 A;  2V6C A;  1QO0 D;  3EUK L;  2TRT A;  5FRM A;  5B1B H;  3KP6 A;  4UUT A;  3E3V A;  1VTN C;  2XRN A;  3I59 A;  3X2Q H;  3ZR8 X;  1B72 B;  3SEZ A;  5J40 A;  1NG7 A;  3RPQ A;  3D5L A;  4D7N A;  3I0T A;  3IP4 B;  4RB0 A;  4F93 B;  2GQQ A;  3ASN H;  2DMP A;  2EZL A;  1IN8 A;  2ZSH B;  3R6S A;  3WU1 B;  3FIS A;  2HZT A;  4B44 A;  4CGZ A;  3KX2 A;  4CZZ A;  2V79 A;  3OS2 A;  1PP7 U;  4XLP F;  1FMW A;  3BZC A;  2WBM A;  4CXF A;  2X6Y A;  2D45 A;  1RIO H;  3EPZ A;  2HFH A;  1ETY A;  2V1X A;  4RA2 A;  4V2G A;  3B6C A;  4IRI A;  2QYO A;  3QYB A;  3OYD A;  1JUP A;  1ACI A;  1U78 A;  2H6B A;  2CV0 A;  3CMA I;  3M07 A;  2WAE A;  4ZC3 A;  2BY2 A;  1K83 J;  4A3I J;  1L0O C;  1ERD A;  3CCS I;  4XKW A;  3OYE A;  4HNT A;  1P4A A;  2GOX B;  3FK7 A;  3FMS A;  5IP7 J;  3S3O A;  3TO9 A;  3PNY A;  2EZI A;  2V1N A;  4WXC A;  2Y2Z A;  5IY5 H;  1UEL B;  2WAQ N;  1F9N A;  3H9Q A;  4G7H F;  2JSP A;  4BBS J;  4E7L A;  2ESH A;  2ZXW H;  3F8F A;  2MC4 A;  3CDH A;  4G12 A;  1I5Z A;  2IPQ X;  4DW6 A;  2CRG A;  2F4M B;  2W85 A;  3MKZ A;  3Q9S A;  4YRV A;  4IJA A;  4HG2 A;  2Y30 A;  1Z9C A;  1IAW A;  2RNJ A;  4ZYA A;  1GLN A;  1XN7 A;  1XCV A;  4P9U A;  1DPU A;  1Z77 A;  3F8N A;  5D6E A;  1FYK A;  2E7X A;  5A2Q K;  2R7S A;  1FTZ A;  4PFP A;  2VQG A;  1R49 A;  3N05 A;  1OPC A;  2DMU A;  2DT7 B;  3GFL A;  2I10 A;  3QU3 A;  1WJA A;  5HDG A;  3ISP A;  2W4S A;  4E6K G;  5IOZ A;  3KET A;  1SFU A;  2QBY B;  5L3B A;  3ABK H;  4ZTJ A;  4LK1 F;  3KP7 A;  5L3F A;  3CTA A;  4RGS A;  1IRZ A;  5DTD A;  1ZN2 A;  3I58 A;  3L9F A;  1Y8R B;  3S32 A;  3SHF A;  2LVS A;  4ENM A;  1SMT A;  3I4P A;  4L18 B;  1VQK I;  2KQR A;  2QSH X;  1QHG A;  2ZO4 A;  4BAC A;  1YIO A;  3WU2 C;  1TWA J;  1TQI A;  4RAF A;  1B6A A;  4C3H J;  1ZRE A;  1Y1W J;  2HXO A;  4OMZ A;  3CCE I;  3I4M J;  2M1B A;  3O3K A;  2PFB A;  4HNV A;  1TNT A;  1LNW A;  2XPW A;  2AS5 F;  1M1E B;  1ZR4 A;  3HTS B;  4LLG F;  3HRM A;  3BR1 A;  1BJA A;  1XX5 A;  4NBQ A;  1FOK A;  2P4W A;  2COM A;  1RUN A;  3P5J A;  4K2E A;  2IGO A;  3W6K B;  4XK4 A;  3V8J A;  5B66 C;  4UV8 A;  2G7H A;  2R7X A;  4CYC B;  1OQY A;  1UZC A;  1GV5 A;  4XQF A;  2WAF A;  3J81 Z;  2NS0 A;  2M4K A;  3R60 A;  3R61 A;  4AIK A;  1CGP A;  3NAR A;  3GO5 A;  1ZR2 A;  4EGZ A;  1IV8 A;  2XAS A;  2LLK A;  4HYE A;  4D7M A;  2PN6 A;  2P5K A;  1V5F A;  4KFC A;  1FBS A;  1TT5 B;  2A6H F;  1ZGW A;  2O3F A;  1S9H A;  1XDU A;  5HDK A;  4A3E J;  1BR2 A;  1Z05 A;  4V19 K;  2CSO A;  2DTZ A;  3L2V A;  3GTG J;  4MHG A;  3CO7 C;  1MNE A;  2IRF G;  3CME I;  1AA7 A;  1IXS B;  2A6E F;  1ORK A;  2HQA A;  2VJ4 A;  3IC7 A;  2VPL A;  3C2B A;  1K61 A;  2VBZ A;  3E5X A;  4M71 A;  4M9X A;  4Q4Z F;  2FQ4 A;  5CQG A;  1K6O A;  1G4D A;  3LFU A;  3K4N A;  3PFY A;  3HZJ A;  1R7J A;  5HVQ C;  1JJ8 C;  2K3F A;  3WTT C;  2QQ9 A;  3HOW J;  1ZRF A;  4DBR A;  1IJW C;  1X3Z B;  3QPS A;  3BLY A;  3C3W A;  2PJR A;  2ESN A;  3GFM A;  4KDP A;  2QSG X;  1FP1 D;  1HW5 A;  4YEL A;  1KZH A;  1J59 A;  4G7Z F;  4QIW N;  2H6C A;  2IW5 A;  1ZYR F;  1QZE A;  2PQ8 A;  4DGW B;  2PI0 A;  3M4O J;  2VJ5 A;  2L3D A;  3BOQ A;  1WH7 A;  5TIS C;  2H27 A;  2DN0 A;  2NNN A;  2ZFU A;  5J3L A;  2WY8 Q;  1XSD A;  1DP7 P;  1WH5 A;  2BOL A;  4DYC A;  5H2F C;  3WU0 A;  2EZK A;  4DOZ A;  5FJ8 J;  5F27 A;  1MMS A;  4LG0 A;  2VXZ A;  3SJM A;  3GBG A;  4AC0 A;  1K4S A;  2L9S A;  3HOS A;  2HPM A;  3GLX A;  3DTE A;  3K69 A;  2HOE A;  3HKZ N;  4U7B A;  1T33 A;  4G94 A;  3PM1 A;  2F6C A;  1XD7 A;  4AUX A;  2XHK A;  2F5E A;  4B47 A;  4NHJ A;  1OJL A;  3NEU A;  5JVT A;  3S16 J;  4Y33 A;  1T38 A;  2YU9 J;  2MH2 A;  3Q0W A;  3IV5 A;  2HVR A;  3G73 A;  3R4K A;  1YIJ I;  4XON A;  1PYV A;  5HLI A;  2VOD A;  4WK8 F;  2AXL A;  1ON2 A;  4XOT A;  3T8R A;  2E60 A;  5EF6 A;  3WTU C;  1U8R A;  4OMY A;  4ZH4 F;  2BW3 B;  3TQN A;  2TDX A;  2LMD A;  1X19 A;  3HUG A;  1ZLK A;  3HHG A;  3PJR A;  2ZCW A;  4QLC U;  1Y0U A;  2PG4 A;  3V7S A;  3CCJ I;  5CQE A;  1FY7 A;  3BG3 A;  2XB5 A;  3RIR A;  2FEZ A;  1WJB A;  3F8B A;  4BAY A;  3GCM A;  2FJ1 A;  4OU0 A;  3TW6 A;  4MGR A;  2WTE A;  4OAZ A;  2NVU B;  5EGO B;  4M72 A;  3IHU A;  2M0M A;  1W7P A;  2VT3 A;  3E0J B;  4HQE A;  1I6X A;  2X4H A;  4ESJ A;  3MVP A;  3HXL A;  4LG0 B;  3GZ5 A;  1Y8Q B;  3REO A;  1UG0 A;  1B1B A;  1BOB A;  3CDL A;  1HF0 A;  1ZAO A;  4CCM A;  1O3Q A;  3PUB A;  3MZ8 A;  1K78 B;  2XUB A;  5KAF C;  2R7Q A;  3B02 A;  2GOM A;  2EFW A;  2XDV A;  3OMY A;  3CF2 A;  5LHG A;  3ECO A;  3DEW A;  3QYE A;  4PGH A;  3OV8 A;  5EDN A;  5LGU A;  1MJB A;  2V9P A;  3PUF A;  4F92 B;  1K4T A;  1JT6 A;  2O0Y A;  2F5V A;  2LBF B;  5GTH C;  3H36 A;  1UHS A;  4PJL A;  4L9T A;  1IUY A;  1WJC A;  1NTC A;  2R92 J;  2ECC A;  2WB1 A;  2NNY A;  4IKF A;  3LOC A;  4LIT A;  3AFH A;  3J81 K;  4HZF A;  2FOW A;  1TWG J;  4L9N A;  4C3J J;  3KP4 A;  4H4K C;  4RAG A;  3ZXS A;  4D9J A;  1YJN I;  2E2H J;  4LIV A;  1D0X A;  4LB5 A;  5L3E A;  5LRR A;  1RET A;  1YRN B;  1P9Q C;  1N78 A;  3N4M A;  1R4M B;  2O03 A;  3K6G A;  4I2O A;  1P92 A;  1G2H A;  4E7J A;  1QA6 A;  5F1R A;  4R8H A;  3QRF F;  2LRE A;  2E35 A;  1FOW A;  4NQW A;  1B9M A;  4ZYH A;  1YX5 A;  4MEY F;  1W0U A;  1FSE A;  4B8X A;  1LDJ A;  1T39 A;  2E36 A;  3L7W A;  1NHA A;  3DWL E;  3ZMV A;  2FBK A;  1GXQ A;  5TJJ A;  1X1C A;  3PQJ A;  5DS9 A;  2Y31 A;  3HKZ A;  2MD0 A;  4Y13 A;  1K6Y A;  2P0W A;  1HLV A;  3ZQF A;  1YHQ I;  4X6A J;  2O5R A;  3R0J A;  1VQ5 I;  3PNT A;  1MJA A;  3VYU B;  4IZZ A;  4UVA A;  5TGT A;  3H9G A;  5GAH J;  1VQN I;  1WJD A;  5ILS A;  1B8I A;  2VJI A;  4EV0 A;  3DEU A;  1X1B A;  4MTE A;  1W36 C;  2Y9Z A;  5GP9 A;  2KFD A;  1WHU A;  4EM2 A;  3H5R A;  3S17 J;  1S5L C;  1LFP A;  3AL0 B;  5D8L B;  5FFZ A;  2QSF X;  2FQ3 A;  4A2U A;  5GAD J;  1I1S A;  5E3O A;  4CCL A;  5BS6 A;  3QWL A;  2Q2E A;  4XID A;  1QPI A;  1O3T A;  1ZQ3 P;  2EBI A;  1QZY A;  3MQ0 A;  4XL9 A;  5HOO A;  3ZP5 A;  4PK4 A;  4QTR A;  2DMT A;  3FBI B;  4LG3 A;  3J7Y J;  1PUF B;  2X0L A;  1NG6 A;  2AQE A;  4M6Y A;  2CH0 A;  3HOZ J;  4ZDP A;  4RM2 A;  5ICE A;  1Y56 A;  5FLX Z;  3BY6 A;  5CVI A;  2IAI A;  2UV1 A;  4B09 A;  1MBH A;  5FKK A;  2GAU A;  5IYB J;  3W6J B;  3K1N A;  3SQN A;  1QBJ A;  1RC9 A;  3I3L A;  3WGH A;  1AU7 A;  1R1T A;  1KQ9 A;  5E20 A;  3OYN A;  3GX4 X;  2ZJQ F;  2R5Z A;  1JT0 A;  2AO9 A;  1MZB A;  1Z7U A;  3V4G A;  2ELH A;  5F6F A;  4XRS G;  5ILV A;  5M5X J;  1HKQ A;  2B0L A;  2XAF A;  3DBL B;  5DEQ A;  4UNO A;  1OKR A;  2E1N A;  2K27 A;  2DO7 A;  3HGY A;  2JK3 A;  3DKX A;  1JJ6 C;  5AIP A;  5LRS A;  1FSH A;  2VKV A;  5KAI C;  3PSI A;  4KT6 A;  3HG9 A;  4BHP A;  4EJV A;  2VLA A;  2ZXJ A;  2VQC A;  2JVH A;  3PSF A;  4BQQ A;  5EZG A;  3CQZ J;  1P7I A;  1V4R A;  5E8G A;  2DA1 A;  4XRF A;  3G1L A;  1MSE C;  5M3M J;  1OIS A;  4U0V A;  3KEY A;  4LLL A;  2Q2E B;  5FKO A;  1YJW I;  1IDZ A;  5C3E J;  2M5W A;  3ZMD A;  5M3F J;  3RYP A;  1I1G A;  1SAU A;  4BJ6 C;  3CF5 F;  4KMF A;  4RGR A;  2Y0S N;  1MSF C;  3BQY A;  2FUG 2;  2CW8 A;  2VI6 A;  1SFK A;  1ON1 A;  3JTH A;  2DMQ A;  4IPA A;  3F22 A;  4NC7 A;  5KVR A;  1JGS A;  4FQG A;  1EF4 A;  2LY1 A;  2LD5 A;  4II3 A;  2B63 J;  1EV7 A;  4N4N B;  3K9T A;  3OR1 C;  4NUB A;  2HOA A;  2P7V B;  4UUV A;  4HNU A;  3FBN B;  2R7F A;  5EJC A;  2GZW A;  4DJA A;  3TOB A;  3K10 A;  4ITV A;  2IP2 A;  5GAE J;  5DCM A;  4M73 A;  3W2V A;  2E2I J;  3HOY J;  3K70 D;  3JRC A;  2ME0 A;  1JTY A;  4ENK A;  4XRM A;  2BV6 A;  2JMW A;  4JK1 X;  3BG5 A;  5AON A;  2RQQ A;  4I76 A;  2ISY A;  3H35 A;  1OR7 A;  3H9J A;  4YG2 F;  1BR1 A;  4XLE A;  1YW7 A;  2NAZ A;  3FXK A;  4R1H A;  3L00 A;  1T0F C;  4MFE A;  2LY2 A;  3N97 A;  1Q1H A;  2DK5 A;  3KZY A;  1T56 A;  3PIO F;  4IO9 F;  1ETV A;  2HVS A;  1BIA A;  3ZGK A;  4JX4 A;  3WTY C;  3HB9 A;  3U21 A;  4BJ5 C;  2E34 A;  5J1U A;  3CP2 A;  2L02 A;  1VZ0 A;  3IRR A;  1BJZ A;  1POG A;  2X6W A;  2V1U A;  5H6Q A;  3GTO J;  1BI2 A;  2H8R A;  1U9O A;  2KP6 A;  3KEO A;  2R0Q C;  5LHI A;  3O8G A;  3LSR A;  4NNJ A;  4XMY A;  3IH2 A;  3I5U A;  5FLV A;  5CPR B;  4D1Q A;  3CMY A;  3HRT A;  2VE8 A;  2ZXI A;  2HQ5 A;  2BYV E;  2JA5 J;  2EA2 A;  5LHH A;  2X48 A;  2OTJ I;  4WXD A;  1JKR C;  3DPL C;  3GW2 A;  4QWQ A;  1HDP A;  2I5U A;  1EJ9 A;  3S14 J;  5B5E C;  1J5Y A;  1RES A;  4UB6 C;  5DCM B;  1HQC A;  4NB5 A;  3V7C A;  4BYY A;  3K4B A;  2HU9 A;  4BQA A;  4PSX A;  2X51 A;  3ELK A;  1PJR A;  2K3P A;  5FD5 A;  2F2E A;  1IRX A;  1JE8 A;  3GTJ J;  3B6A A;  1DU0 A;  4WCG A;  4FET A;  3JTG A;  3E97 A;  2Z33 A;  4BS9 A;  2CWE A;  1FIA A;  3LSM A;  1J09 A;  3K2A A;  3IUO A;  5H20 A;  5IT3 A;  2BVL A;  4IHV A;  2J5O A;  5ICC A;  1GXP A;  3KYL A;  3K4K A;  3ZQ7 A;  1TP4 A;  2JRM A;  5IOY A;  3ECH A;  2BBY A;  3Q0U A;  4AWX B;  3PFI A;  2OTL I;  4I09 A;  2RC4 A;  3ABL H;  3R0A A;  5JVG F;  3V42 A;  1ZKG A;  5ILU A;  3E6B A;  3ERE D;  2VB6 A;  5DD4 A;  3IAM 2;  1MBE A;  2K9Q A;  2W25 A;  1A36 A;  1LVK A;  2F4I A;  2LFB A;  2EFQ A;  2QVO A;  3HRU A;  1SD7 A;  3HPH A;  3FM5 A;  5M5Y J;  3JR9 A;  5BPD A;  3ZQL A;  1DQU A;  3GTQ J;  2R3S A;  1W7P D;  1SAX A;  2HGC A;  4U88 A;  2DXI A;  3MWM A;  4BDZ A;  1UG2 A;  1RI7 A;  1D0Z A;  3OYI A;  1V5G A;  4ESB A;  3K1P A;  5FKM A;  5D4R A;  3BPX A;  3NRV A;  5F0F A;  1WRJ A;  2E5N A;  4F7Z A;  1BW5 A;  2FD5 A;  2MFZ A;  2BZT A;  1P7J A;  4ENN A;  3OOU A;  5E3N A;  1S3J A;  4M9S A;  3RCO A;  3ZRG A;  3FMQ A;  4RLQ A;  2QQA A;  3VWB A;  1GUU A;  2DOA A;  2K7L A;  2M8G X;  1MJ9 A;  3J80 K;  4OAY A;  4BKX A;  2QKL B;  1IUF A;  3MZH A;  4YFK F;  2DA7 A;  3LMM A;  4KYW A;  2KIU A;  3FMR A;  5GAG J;  1R9T J;  4XN0 A;  2ZJ2 A;  3O6B B;  2P6S A;  4BGD A;  4UVC A;  5BQT A;  2GM4 A;  4ZDL A;  4LIU A;  2HOS A;  3I54 A;  1V5E A;  5LD2 C;  3AG2 H;  5JHF A;  2HR3 A;  2EA4 A;  2W82 A;  1Z6R A;  2K9M A;  1KYW A;  2WWY A;  3DKY A;  3NQO A;  3L2R A;  5IYD J;  1FP2 A;  3QOP A;  3CUQ B;  4BJT A;  3S1M J;  4BXU A;  5GTI C;  2COB A;  1IRF A;  4JYK A;  1J0R A;  4DNC A;  2K02 A;  4J01 A;  4CA0 A;  1PP8 F;  2STW A;  4M3F A;  2QBY A;  4KNY A;  3QP6 A;  2KDZ A;  2LG4 A;  3ZQG A;  1MBG A;  3KEQ A;  3VB2 A;  2UXN A;  2K4B A;  1FWZ A;  1G6N A;  4YIF A;  2HTJ A;  2QGU A;  1ZGA A;  4EGY A;  2BGC A;  4IHS A;  3WHB A;  2XGD A;  1MNM C;  1OYI A;  2BE5 F;  2JA8 J;  3O2P E;  2MD5 A;  4PCQ A;  3LAP A;  2ZJR F;  3SZT A;  3CLQ A;  1FEX A;  3LFK A;  4HAM A;  1QU3 A;  2FNA A;  1ZRC A;  5FLM J;  1XSV A;  4AVP A;  1VFC A;  3HOT A;  2E1M B;  3V8K A;  2GWR A;  1Z3Y A;  4P9F A;  4A3C J;  4ZZD A;  4XKC A;  1AWC A;  4DQ2 A;  2L9R A;  2L4A A;  2W84 A;  3BJO A;  3FXJ A;  1VQP I;  3W6V A;  2TCT A;  1TLH B;  1R22 A;  3H0D A;  3MN2 A;  1BC8 C;  1BBY A;  4C3I J;  4DYQ A;  1R00 A;  4HX8 A;  1R1V A;  4OIR F;  1BA5 A;  2DAO A;  1OCT C;  2L54 A;  2XF5 A;  4ZYE A;  2QEX I;  2DA4 A;  2ECB A;  5EZH A; 
#chains in the Genus database with same CATH homology
 3DBL B;  3GZN B;  1TT5 B;  3DBR B;  1Y8Q B;  1R4M B;  1Y8R B;  3KYD B;  1YOV B;  2NVU B;  2PX9 A;  3DBH B;  3KYC B;  1R4N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...