2PXBA

Variant 2 of ribonucleoprotein core of the e. coli signal recognition particle
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
102
structure length
69
Chain Sequence
FDLNDFLEQKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGSGMQVQDVNRLLKQFDDMQRMMKKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4.5 S RNA
publication title A General Strategy to Solve the Phase Problem in RNA Crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein/rna
total genus 21
structure length 69
sequence length 102
ec nomenclature
pdb deposition date 2007-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.30 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) Signal recognition particle, SRP54 subunit, M-domain 2pxbA00
2PXQA 2XXAA 2PXBA 5GAHi 2PXEA 1DULA 2PXFA 5GAGi 3NDBB 3LQXA 2PXTA 2PXPA 3DM5A 1HQ1A 1MFQC 2PXVA 1QZXA 3KL4A 2PXKA 2FFHA 2V3CC 2PXDA 2PXUA 2PXLA 1QB2A 2JQEA
chains in the Genus database with same CATH superfamily
2R1JL 2HCNA 1UTXA 1JH9A 2PXFA 2IVBA 1LQCA 2D5VA 3QWGA 1LMB3 3TRBA 3UWPA 1WH6A 2ICPA 3BD1A 3H5TA 1X57A 2O38A 1LLIA 4Z5CA 2PUBA 2WIUB 2PUEA 3OP9A 4YG7B 3VK0A 2PE5A 2CSFA 1OCTC 4OBMA 3QFIA 2L49A 1HF0A 4I8TA 3OQNA 1ZZ7A 1LCCA 2XI8A 2JCGA 3SR4A 5DT2A 2ICTA 2CROA 2O4AA 2LYKA 4DE8A 3JXCL 1PRAA 1RPEL 2MQKA 2PIJA 4JCYA 1SQ8A 3TEPA 1ZPQA 3S8QA 2PXKA 2V3CC 2IVQA 2VEOA 1AU7A 2HSGA 4PU7A 3FYMA 1R69A 1NW3A 2LYPA 4I6TA 4EK9A 3OQOA 4Z59A 2GRMA 2KPJA 2MXDA 2BJCA 4YG1A 1QP0A 3NDBB 1WH8A 1U2ZA 4YARA 2HINA 3SCGA 1DWKA 3FMYA 2EWTA 3R09A 1XWRA 3NZLA 1B0NA 2MEZA 1DULA 4JCXA 3JXBC 3QYXA 2J7UA 4I6RA 2XCJA 3IVPA 3GN5A 3KL4A 3F51A 3GN5B 3PXPA 4ER7A 3ZPXA 3L1PA 3CROL 2XIUA 4ER0A 2B5AA 4X4BA 3ZKCA 4X4IA 2PUCA 2WUSR 2PXBA 3QF3A 1ZZBA 4X4GA 3U3WA 3FYAA 2YBDA 3G7DA 2XSDC 2J7WA 3GZDA 3D1NI 4JQDA 4J1WA 1ZZ6A 4Q2JA 4X4DA 1HQ1A 3CECA 3O9XA 3M9LA 1QPZA 1O4XA 2L8NA 3QOWA 2OR1L 2EBYA 5GAHi 1VPWA 2LLVA 3G5GA 1OSLA 3QOXA 2AUWA 3DNVB 4Z5DA 1L1MA 3MLFA 3KJXA 1LCDA 2LYRA 2R63A 1MFQC 3NROA 3OWQA 2O49A 2IV1A 2XXQA 5DRTA 5DSXA 1UXCA 2PUAA 1ZS4A 1BDIA 5DTQA 2KEIA 1ZAYA 2PPXA 4OB4A 2XJ3A 1BDHA 2LYJA 4O8BA 2PXVA 1PERL 2IUOA 3CLCA 3OMTA 3B7HA 3F6WA 3BS3A 2XXPA 4HRAA 2XXAA 3GZDC 1PNRA 1YSEA 4PU8A 2LYLA 4ER5A 4Z5HA 2AXVA 3LFPA 1Y7YA 2AXZA 3A9YA 3NXHA 3RZZA 1ZZ8A 1QZXA 2ODRD 4MCXA 3PE5A 4Y42A 5K98B 2PUFA 2PXDA 1JFSA 1RZRD 4IA8A 5DTRA 5DTMA 2PUDA 2OFYA 1POUA 4GQMA 1ZZCA 1QP7A 1DW9A 2IU7A 4X4CA 3EUSA 3HZIB 1ZUGA 3DM5A 4I6UA 3TELA 2IVGA 5DRYA 1JFTA 1QB2A 4EKGA 3OKZA 4X4EA 2FJRA 4WVLA 2BNNA 1Y9QA 4Z58A 5A7LA 1JWLA 1WETA 3SX0A 1S7EA 4MCTA 4PU4C 1IC8A 4ER6A 2GRLA 2HFZA 4X4FA 2M4HA 3OQMA 3G0TA 5GAGi 1ZZ9A 1ADRA 1RZRA 3A9ZA 1QQBA 2LNMA 1EFAA 4YG4A 3GZCA 3A9XA 2AW6A 2EF8A 1QP4A 2GZUA 4F8DA 2LCVA 1PRVA 5JUWA 2L1PA 3ZHIA 2LYSA 1E3OC 3TFLA 1RIOA 1QQAA 4X4HA 1PRUA 2PXLA 2JQEA 3R1FA 1CJGA 3F52A 4EKIA 2JVLA 4NDWA 3SCHA 2PXQA 4PU3C 2PXEA 2KEKA 1CQTA 2AXUA 1NERA 4ER3A 4GHJA 3LQXA 4DE9A 3GUUA 3KZ3A 3ME5A 4YBAA 1RZSA 3GBFA 3LISA 3ZHMA 2KEJA 1X2LA 4EQZA 2PXUA 3BDNA 3MEJA 3UFDA 1R63A 2HCSA 4FN3A 2LYQA 1NEQA 2H8RA 2LLWA 4IVZA 1GT0C 1ZVVA 2PXPA 3SCFA 1UXDA 2AWIA 3QQ6A 3JXDL 4J1XA 4EZIA 2BNMA 2BNOA 1WIZA 2PXTA 2PUGA 2FFHA 3VWSA 2A6CA 4IWRA 3KXAA 4FBIA 2KZ8A
chains in the Genus database with same CATH topology
2PXQA 2XXAA 2PXBA 5GAHi 2PXEA 1DULA 2PXFA 5GAGi 3NDBB 3LQXA 2PXTA 2PXPA 3DM5A 1HQ1A 1MFQC 2PXVA 1QZXA 3KL4A 2PXKA 2FFHA 2V3CC 2PXDA 2PXUA 2PXLA 1QB2A 2JQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PXQ A;  2XXA A;  2PXB A;  5GAH i;  2PXE A;  1DUL A;  2PXF A;  5GAG i;  3NDB B;  3LQX A;  2PXT A;  2PXP A;  3DM5 A;  1HQ1 A;  1MFQ C;  2PXV A;  1QZX A;  3KL4 A;  2PXK A;  2FFH A;  2V3C C;  2PXD A;  2PXU A;  2PXL A;  1QB2 A;  2JQE A; 
#chains in the Genus database with same CATH topology
 2R1J L;  2HCN A;  1UTX A;  1JH9 A;  2PXF A;  2IVB A;  1LQC A;  2D5V A;  3QWG A;  1LMB 3;  3TRB A;  3UWP A;  1WH6 A;  2ICP A;  3BD1 A;  3H5T A;  1X57 A;  2O38 A;  1LLI A;  4Z5C A;  2PUB A;  2WIU B;  2PUE A;  3OP9 A;  4YG7 B;  3VK0 A;  2PE5 A;  2CSF A;  1OCT C;  4OBM A;  3QFI A;  2L49 A;  1HF0 A;  4I8T A;  3OQN A;  1ZZ7 A;  1LCC A;  2XI8 A;  2JCG A;  3SR4 A;  5DT2 A;  2ICT A;  2CRO A;  2O4A A;  2LYK A;  4DE8 A;  3JXC L;  1PRA A;  1RPE L;  2MQK A;  2PIJ A;  4JCY A;  1SQ8 A;  3TEP A;  1ZPQ A;  3S8Q A;  2PXK A;  2V3C C;  2IVQ A;  2VEO A;  1AU7 A;  2HSG A;  4PU7 A;  3FYM A;  1R69 A;  1NW3 A;  2LYP A;  4I6T A;  4EK9 A;  3OQO A;  4Z59 A;  2GRM A;  2KPJ A;  2MXD A;  2BJC A;  4YG1 A;  1QP0 A;  3NDB B;  1WH8 A;  1U2Z A;  4YAR A;  2HIN A;  3SCG A;  1DWK A;  3FMY A;  2EWT A;  3R09 A;  1XWR A;  3NZL A;  1B0N A;  2MEZ A;  1DUL A;  4JCX A;  3JXB C;  3QYX A;  2J7U A;  4I6R A;  2XCJ A;  3IVP A;  3GN5 A;  3KL4 A;  3F51 A;  3GN5 B;  3PXP A;  4ER7 A;  3ZPX A;  3L1P A;  3CRO L;  2XIU A;  4ER0 A;  2B5A A;  4X4B A;  3ZKC A;  4X4I A;  2PUC A;  2WUS R;  2PXB A;  3QF3 A;  1ZZB A;  4X4G A;  3U3W A;  3FYA A;  2YBD A;  3G7D A;  2XSD C;  2J7W A;  3GZD A;  3D1N I;  4JQD A;  4J1W A;  1ZZ6 A;  4Q2J A;  4X4D A;  1HQ1 A;  3CEC A;  3O9X A;  3M9L A;  1QPZ A;  1O4X A;  2L8N A;  3QOW A;  2OR1 L;  2EBY A;  5GAH i;  1VPW A;  2LLV A;  3G5G A;  1OSL A;  3QOX A;  2AUW A;  3DNV B;  4Z5D A;  1L1M A;  3MLF A;  3KJX A;  1LCD A;  2LYR A;  2R63 A;  1MFQ C;  3NRO A;  3OWQ A;  2O49 A;  2IV1 A;  2XXQ A;  5DRT A;  5DSX A;  1UXC A;  2PUA A;  1ZS4 A;  1BDI A;  5DTQ A;  2KEI A;  1ZAY A;  2PPX A;  4OB4 A;  2XJ3 A;  1BDH A;  2LYJ A;  4O8B A;  2PXV A;  1PER L;  2IUO A;  3CLC A;  3OMT A;  3B7H A;  3F6W A;  3BS3 A;  2XXP A;  4HRA A;  2XXA A;  3GZD C;  1PNR A;  1YSE A;  4PU8 A;  2LYL A;  4ER5 A;  4Z5H A;  2AXV A;  3LFP A;  1Y7Y A;  2AXZ A;  3A9Y A;  3NXH A;  3RZZ A;  1ZZ8 A;  1QZX A;  2ODR D;  4MCX A;  3PE5 A;  4Y42 A;  5K98 B;  2PUF A;  2PXD A;  1JFS A;  1RZR D;  4IA8 A;  5DTR A;  5DTM A;  2PUD A;  2OFY A;  1POU A;  4GQM A;  1ZZC A;  1QP7 A;  1DW9 A;  2IU7 A;  4X4C A;  3EUS A;  3HZI B;  1ZUG A;  3DM5 A;  4I6U A;  3TEL A;  2IVG A;  5DRY A;  1JFT A;  1QB2 A;  4EKG A;  3OKZ A;  4X4E A;  2FJR A;  4WVL A;  2BNN A;  1Y9Q A;  4Z58 A;  5A7L A;  1JWL A;  1WET A;  3SX0 A;  1S7E A;  4MCT A;  4PU4 C;  1IC8 A;  4ER6 A;  2GRL A;  2HFZ A;  4X4F A;  2M4H A;  3OQM A;  3G0T A;  5GAG i;  1ZZ9 A;  1ADR A;  1RZR A;  3A9Z A;  1QQB A;  2LNM A;  1EFA A;  4YG4 A;  3GZC A;  3A9X A;  2AW6 A;  2EF8 A;  1QP4 A;  2GZU A;  4F8D A;  2LCV A;  1PRV A;  5JUW A;  2L1P A;  3ZHI A;  2LYS A;  1E3O C;  3TFL A;  1RIO A;  1QQA A;  4X4H A;  1PRU A;  2PXL A;  2JQE A;  3R1F A;  1CJG A;  3F52 A;  4EKI A;  2JVL A;  4NDW A;  3SCH A;  2PXQ A;  4PU3 C;  2PXE A;  2KEK A;  1CQT A;  2AXU A;  1NER A;  4ER3 A;  4GHJ A;  3LQX A;  4DE9 A;  3GUU A;  3KZ3 A;  3ME5 A;  4YBA A;  1RZS A;  3GBF A;  3LIS A;  3ZHM A;  2KEJ A;  1X2L A;  4EQZ A;  2PXU A;  3BDN A;  3MEJ A;  3UFD A;  1R63 A;  2HCS A;  4FN3 A;  2LYQ A;  1NEQ A;  2H8R A;  2LLW A;  4IVZ A;  1GT0 C;  1ZVV A;  2PXP A;  3SCF A;  1UXD A;  2AWI A;  3QQ6 A;  3JXD L;  4J1X A;  4EZI A;  2BNM A;  2BNO A;  1WIZ A;  2PXT A;  2PUG A;  2FFH A;  3VWS A;  2A6C A;  4IWR A;  3KXA A;  4FBI A;  2KZ8 A; 
#chains in the Genus database with same CATH homology
 2PXQ A;  2XXA A;  2PXB A;  5GAH i;  2PXE A;  1DUL A;  2PXF A;  5GAG i;  3NDB B;  3LQX A;  2PXT A;  2PXP A;  3DM5 A;  1HQ1 A;  1MFQ C;  2PXV A;  1QZX A;  3KL4 A;  2PXK A;  2FFH A;  2V3C C;  2PXD A;  2PXU A;  2PXL A;  1QB2 A;  2JQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...