2PXBA

Variant 2 of ribonucleoprotein core of the e. coli signal recognition particle
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
102
structure length
69
Chain Sequence
FDLNDFLEQKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGSGMQVQDVNRLLKQFDDMQRMMKKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A General Strategy to Solve the Phase Problem in RNA Crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein/rna
molecule keywords 4.5 S RNA
total genus 21
structure length 69
sequence length 102
ec nomenclature
pdb deposition date 2007-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.30 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) Signal recognition particle, SRP54 subunit, M-domain 2pxbA00
1QZXA 2PXTA 1QB2A 1DULA 2PXUA 1MFQC 3NDBB 2PXLA 2PXBA 3LQXA 2PXEA 2PXDA 2JQEA 2PXQA 2V3CC 2PXKA 3KL4A 2PXPA 5GAGi 5GAHi 2XXAA 3DM5A 2PXVA 2FFHA 2PXFA 1HQ1A
chains in the Genus database with same CATH superfamily
2AXZA 3KZ3A 1PNRA 5DTRA 3ZHMA 1ZPQA 2PPXA 2LYSA 1UTXA 4ER3A 1WH6A 2HCNA 2PUFA 3U3WA 1DULA 3ZHIA 5K98B 1ZZCA 3F52A 3GZDA 3KJXA 1AU7A 4MCXA 1ZZ9A 3OMTA 3H5TA 1IC8A 1OCTC 3TFLA 1ADRA 2LLVA 4Z5HA 2LLWA 3F51A 3ME5A 3S8QA 1XWRA 2A6CA 2IVGA 2PXDA 2KZ8A 3BS3A 2IV1A 2XXAA 1VPWA 3G7DA 3FMYA 2PXVA 4X4BA 2AXUA 1RZRA 2H8RA 3G5GA 1QP7A 4I8TA 4EQZA 2MXDA 3GZCA 2KPJA 2O38A 4Z5CA 1QB2A 1BDIA 1Y9QA 5DRYA 2GZUA 4IVZA 2LCVA 2LYRA 4YG1A 4FN3A 5DSXA 3MLFA 3R1FA 4PU4C 2ICPA 3GZDC 3SCFA 3UFDA 2LYKA 3HZIB 1CQTA 2WUSR 1ZAYA 2R63A 3RZZA 4J1WA 2IUOA 2WIUB 4WVLA 2PXQA 2JQEA 2IVQA 1O4XA 2PXKA 3IVPA 1X57A 3JXBC 4EK9A 3A9XA 2FFHA 2XI8A 4X4HA 3SCHA 2FJRA 2YBDA 5DRTA 1U2ZA 1ZZ6A 4YBAA 4X4EA 4JCXA 4FBIA 1RIOA 4Z5DA 3NDBB 2PXLA 1RZRD 2L49A 1POUA 3QF3A 2PXPA 2AW6A 4JQDA 3A9YA 3OKZA 2ICTA 2KEIA 2EF8A 3TELA 1R69A 2D5VA 1UXDA 4X4FA 2PXTA 3M9LA 1HF0A 1JH9A 3QOXA 1B0NA 3L1PA 3LFPA 2AUWA 1DWKA 1YSEA 3TEPA 1BDHA 3OQOA 2BJCA 3CROL 3B7HA 2HINA 2GRLA 2EWTA 3EUSA 1ZS4A 2PXEA 2AWIA 3PE5A 1EFAA 3FYMA 2CSFA 2VEOA 1HQ1A 1LLIA 3KXAA 3QWGA 5DTQA 1E3OC 1QZXA 3DNVB 1WETA 1ZUGA 2AXVA 3BDNA 3PXPA 5DT2A 2HSGA 2LYQA 4I6TA 1UXCA 2BNNA 2L1PA 2PUDA 2OFYA 1NEQA 3QYXA 2PUAA 2GRMA 4ER6A 4EKIA 1ZZ7A 2R1JL 4DE8A 1JWLA 1NW3A 1SQ8A 2IU7A 4YG7B 4X4CA 2V3CC 2CROA 3A9ZA 3KL4A 2BNMA 3TRBA 2XXQA 4X4IA 3GBFA 1R63A 2XCJA 1PRAA 4OBMA 2J7UA 2XXPA 4ER5A 2PUBA 3OWQA 2PXBA 2XIUA 4Z59A 3LQXA 1LMB3 3OP9A 4MCTA 1ZZ8A 4I6RA 2MQKA 2M4HA 3FYAA 3NXHA 3CLCA 2PE5A 2EBYA 3F6WA 4DE9A 2KEKA 4ER7A 3VWSA 4Z58A 3VK0A 1ZZBA 2PUCA 4HRAA 4YARA 3QQ6A 1CJGA 4X4GA 4GHJA 3OQNA 4OB4A 1LCCA 1WH8A 4NDWA 4O8BA 1PRUA 2B5AA 2O49A 2ODRD 2IVBA 1OSLA 3SX0A 1QP0A 4YG4A 1JFTA 1QPZA 2PUGA 4JCYA 1DW9A 2XSDC 1RZSA 1PERL 1NERA 1L1MA 3UWPA 2LYJA 2KEJA 3MEJA 3QFIA 5A7LA 1LCDA 1Y7YA 5DTMA 1QQBA 2HFZA 1PRVA 2L8NA 1JFSA 1LQCA 4PU8A 4ER0A 4EZIA 3GN5B 4GQMA 4F8DA 3JXCL 2XJ3A 4Q2JA 4I6UA 2JCGA 1X2LA 2BNOA 2PIJA 2OR1L 2O4AA 3G0TA 3O9XA 4EKGA 2MEZA 4IWRA 3NZLA 4X4DA 1S7EA 3OQMA 4IA8A 3LISA 5GAGi 2J7WA 3SR4A 4J1XA 3DM5A 4PU3C 2PXFA 2LNMA 3GN5A 3R09A 2PUEA 1ZVVA 3GUUA 3BD1A 3QOWA 2PXUA 1MFQC 5JUWA 1WIZA 1QP4A 3CECA 1QQAA 1RPEL 2LYPA 3NROA 3JXDL 2JVLA 3D1NI 1GT0C 2HCSA 2LYLA 3ZKCA 4Y42A 4PU7A 5GAHi 3SCGA 3ZPXA
chains in the Genus database with same CATH topology
1QZXA 2PXTA 1QB2A 1DULA 2PXUA 1MFQC 3NDBB 2PXLA 2PXBA 3LQXA 2PXEA 2PXDA 2JQEA 2PXQA 2V3CC 2PXKA 3KL4A 2PXPA 5GAGi 5GAHi 2XXAA 3DM5A 2PXVA 2FFHA 2PXFA 1HQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZX A;  2PXT A;  1QB2 A;  1DUL A;  2PXU A;  1MFQ C;  3NDB B;  2PXL A;  2PXB A;  3LQX A;  2PXE A;  2PXD A;  2JQE A;  2PXQ A;  2V3C C;  2PXK A;  3KL4 A;  2PXP A;  5GAG i;  5GAH i;  2XXA A;  3DM5 A;  2PXV A;  2FFH A;  2PXF A;  1HQ1 A; 
#chains in the Genus database with same CATH topology
 2AXZ A;  3KZ3 A;  1PNR A;  5DTR A;  3ZHM A;  1ZPQ A;  2PPX A;  2LYS A;  1UTX A;  4ER3 A;  1WH6 A;  2HCN A;  2PUF A;  3U3W A;  1DUL A;  3ZHI A;  5K98 B;  1ZZC A;  3F52 A;  3GZD A;  3KJX A;  1AU7 A;  4MCX A;  1ZZ9 A;  3OMT A;  3H5T A;  1IC8 A;  1OCT C;  3TFL A;  1ADR A;  2LLV A;  4Z5H A;  2LLW A;  3F51 A;  3ME5 A;  3S8Q A;  1XWR A;  2A6C A;  2IVG A;  2PXD A;  2KZ8 A;  3BS3 A;  2IV1 A;  2XXA A;  1VPW A;  3G7D A;  3FMY A;  2PXV A;  4X4B A;  2AXU A;  1RZR A;  2H8R A;  3G5G A;  1QP7 A;  4I8T A;  4EQZ A;  2MXD A;  3GZC A;  2KPJ A;  2O38 A;  4Z5C A;  1QB2 A;  1BDI A;  1Y9Q A;  5DRY A;  2GZU A;  4IVZ A;  2LCV A;  2LYR A;  4YG1 A;  4FN3 A;  5DSX A;  3MLF A;  3R1F A;  4PU4 C;  2ICP A;  3GZD C;  3SCF A;  3UFD A;  2LYK A;  3HZI B;  1CQT A;  2WUS R;  1ZAY A;  2R63 A;  3RZZ A;  4J1W A;  2IUO A;  2WIU B;  4WVL A;  2PXQ A;  2JQE A;  2IVQ A;  1O4X A;  2PXK A;  3IVP A;  1X57 A;  3JXB C;  4EK9 A;  3A9X A;  2FFH A;  2XI8 A;  4X4H A;  3SCH A;  2FJR A;  2YBD A;  5DRT A;  1U2Z A;  1ZZ6 A;  4YBA A;  4X4E A;  4JCX A;  4FBI A;  1RIO A;  4Z5D A;  3NDB B;  2PXL A;  1RZR D;  2L49 A;  1POU A;  3QF3 A;  2PXP A;  2AW6 A;  4JQD A;  3A9Y A;  3OKZ A;  2ICT A;  2KEI A;  2EF8 A;  3TEL A;  1R69 A;  2D5V A;  1UXD A;  4X4F A;  2PXT A;  3M9L A;  1HF0 A;  1JH9 A;  3QOX A;  1B0N A;  3L1P A;  3LFP A;  2AUW A;  1DWK A;  1YSE A;  3TEP A;  1BDH A;  3OQO A;  2BJC A;  3CRO L;  3B7H A;  2HIN A;  2GRL A;  2EWT A;  3EUS A;  1ZS4 A;  2PXE A;  2AWI A;  3PE5 A;  1EFA A;  3FYM A;  2CSF A;  2VEO A;  1HQ1 A;  1LLI A;  3KXA A;  3QWG A;  5DTQ A;  1E3O C;  1QZX A;  3DNV B;  1WET A;  1ZUG A;  2AXV A;  3BDN A;  3PXP A;  5DT2 A;  2HSG A;  2LYQ A;  4I6T A;  1UXC A;  2BNN A;  2L1P A;  2PUD A;  2OFY A;  1NEQ A;  3QYX A;  2PUA A;  2GRM A;  4ER6 A;  4EKI A;  1ZZ7 A;  2R1J L;  4DE8 A;  1JWL A;  1NW3 A;  1SQ8 A;  2IU7 A;  4YG7 B;  4X4C A;  2V3C C;  2CRO A;  3A9Z A;  3KL4 A;  2BNM A;  3TRB A;  2XXQ A;  4X4I A;  3GBF A;  1R63 A;  2XCJ A;  1PRA A;  4OBM A;  2J7U A;  2XXP A;  4ER5 A;  2PUB A;  3OWQ A;  2PXB A;  2XIU A;  4Z59 A;  3LQX A;  1LMB 3;  3OP9 A;  4MCT A;  1ZZ8 A;  4I6R A;  2MQK A;  2M4H A;  3FYA A;  3NXH A;  3CLC A;  2PE5 A;  2EBY A;  3F6W A;  4DE9 A;  2KEK A;  4ER7 A;  3VWS A;  4Z58 A;  3VK0 A;  1ZZB A;  2PUC A;  4HRA A;  4YAR A;  3QQ6 A;  1CJG A;  4X4G A;  4GHJ A;  3OQN A;  4OB4 A;  1LCC A;  1WH8 A;  4NDW A;  4O8B A;  1PRU A;  2B5A A;  2O49 A;  2ODR D;  2IVB A;  1OSL A;  3SX0 A;  1QP0 A;  4YG4 A;  1JFT A;  1QPZ A;  2PUG A;  4JCY A;  1DW9 A;  2XSD C;  1RZS A;  1PER L;  1NER A;  1L1M A;  3UWP A;  2LYJ A;  2KEJ A;  3MEJ A;  3QFI A;  5A7L A;  1LCD A;  1Y7Y A;  5DTM A;  1QQB A;  2HFZ A;  1PRV A;  2L8N A;  1JFS A;  1LQC A;  4PU8 A;  4ER0 A;  4EZI A;  3GN5 B;  4GQM A;  4F8D A;  3JXC L;  2XJ3 A;  4Q2J A;  4I6U A;  2JCG A;  1X2L A;  2BNO A;  2PIJ A;  2OR1 L;  2O4A A;  3G0T A;  3O9X A;  4EKG A;  2MEZ A;  4IWR A;  3NZL A;  4X4D A;  1S7E A;  3OQM A;  4IA8 A;  3LIS A;  5GAG i;  2J7W A;  3SR4 A;  4J1X A;  3DM5 A;  4PU3 C;  2PXF A;  2LNM A;  3GN5 A;  3R09 A;  2PUE A;  1ZVV A;  3GUU A;  3BD1 A;  3QOW A;  2PXU A;  1MFQ C;  5JUW A;  1WIZ A;  1QP4 A;  3CEC A;  1QQA A;  1RPE L;  2LYP A;  3NRO A;  3JXD L;  2JVL A;  3D1N I;  1GT0 C;  2HCS A;  2LYL A;  3ZKC A;  4Y42 A;  4PU7 A;  5GAH i;  3SCG A;  3ZPX A; 
#chains in the Genus database with same CATH homology
 1QZX A;  2PXT A;  1QB2 A;  1DUL A;  2PXU A;  1MFQ C;  3NDB B;  2PXL A;  2PXB A;  3LQX A;  2PXE A;  2PXD A;  2JQE A;  2PXQ A;  2V3C C;  2PXK A;  3KL4 A;  2PXP A;  5GAG i;  5GAH i;  2XXA A;  3DM5 A;  2PXV A;  2FFH A;  2PXF A;  1HQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...