2PXGA

Nmr solution structure of omla
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
118
structure length
118
Chain Sequence
b'MAGSGIIYKQPIYQGNLIKQNAVEQLQVGQSKQQVSALLGTPSIPDPFHAQRWDYTSTQRVDRLARTEIKNFTVFFENEQVVRWEGDYFPSQDEQLAKAAPKQFGRNLARDKKKQRGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein
publication title The solution structure of the outer membrane lipoprotein OmlA from Xanthomonas axonopodis pv. citri reveals a protein fold implicated in protein-protein interaction.
pubmed doi rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Membrane protein
total genus 26
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2007-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04355 SmpA_OmlA SmpA / OmlA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1450.10 Alpha Beta 2-Layer Sandwich Beta-lactamase Inhibitory Protein; Chain:B, domain 1 Beta-lactamase Inhibitory Protein; Chain:B, domain 1 2pxgA01
3E2KC 2YH9A 3C4PB 3D4EA 3C7UB 5D0QE 3C7VB 2B5RC 5EKQE 2G2WB 3E2LC 2KM7A 3GMUB 2PXGA 1XXMC 5D0OE 2G2UB 1JTGB 4DM5A 3C4OB 2KXXA 3N4IB 1S0WC 5AYWE
chains in the Genus database with same CATH superfamily
2GUMA 3E2KC 2YH9A 3C4PB 3D4EA 4L1RA 3C7UB 5D0QE 3C7VB 2B5RC 3NWDA 2G2WB 5EKQE 3NWFA 4HSIA 3NW8A 3E2LC 2KM7A 3FVCA 3GMUB 2PXGA 1XXMC 5D0OE 3NWAA 2G2UB 1JTGB 4DM5A 3C4OB 2KXXA 3N4IB 1S0WC 5AYWE
chains in the Genus database with same CATH topology
2GUMA 3E2KC 2YH9A 3C4PB 3D4EA 4L1RA 3C7UB 5D0QE 3C7VB 2B5RC 3NWDA 2G2WB 5EKQE 3NWFA 4HSIA 3NW8A 3E2LC 2KM7A 3FVCA 3GMUB 2PXGA 1XXMC 5D0OE 3NWAA 2G2UB 1JTGB 4DM5A 3C4OB 2KXXA 3N4IB 1S0WC 5AYWE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E2K C;  2YH9 A;  3C4P B;  3D4E A;  3C7U B;  5D0Q E;  3C7V B;  2B5R C;  5EKQ E;  2G2W B;  3E2L C;  2KM7 A;  3GMU B;  2PXG A;  1XXM C;  5D0O E;  2G2U B;  1JTG B;  4DM5 A;  3C4O B;  2KXX A;  3N4I B;  1S0W C;  5AYW E; 
#chains in the Genus database with same CATH topology
 2GUM A;  3E2K C;  2YH9 A;  3C4P B;  3D4E A;  4L1R A;  3C7U B;  5D0Q E;  3C7V B;  2B5R C;  3NWD A;  2G2W B;  5EKQ E;  3NWF A;  4HSI A;  3NW8 A;  3E2L C;  2KM7 A;  3FVC A;  3GMU B;  2PXG A;  1XXM C;  5D0O E;  3NWA A;  2G2U B;  1JTG B;  4DM5 A;  3C4O B;  2KXX A;  3N4I B;  1S0W C;  5AYW E; 
#chains in the Genus database with same CATH homology
 2GUM A;  3E2K C;  2YH9 A;  3C4P B;  3D4E A;  4L1R A;  3C7U B;  5D0Q E;  3C7V B;  2B5R C;  3NWD A;  2G2W B;  5EKQ E;  3NWF A;  4HSI A;  3NW8 A;  3E2L C;  2KM7 A;  3FVC A;  3GMU B;  2PXG A;  1XXM C;  5D0O E;  3NWA A;  2G2U B;  1JTG B;  4DM5 A;  3C4O B;  2KXX A;  3N4I B;  1S0W C;  5AYW E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...