2PXKA

Variant 8 of ribonucleoprotein core of the e. coli signal recognition particle
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
102
structure length
69
Chain Sequence
FDLNDFLEQKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGSGMQVQDVNRLLKQFDDMQRMMKKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A General Strategy to Solve the Phase Problem in RNA Crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein/rna
molecule keywords 4.5 S RNA
total genus 16
structure length 69
sequence length 102
ec nomenclature
pdb deposition date 2007-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.30 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) Signal recognition particle, SRP54 subunit, M-domain 2pxkA00
2PXBA 1QZXA 1QB2A 2PXVA 2PXKA 1HQ1A 1DULA 2FFHA 2PXPA 3LQXA 3KL4A 2V3CC 5GAHi 2PXUA 2PXEA 2JQEA 2PXQA 1MFQC 3NDBB 5GAGi 2PXDA 2PXTA 2PXFA 2XXAA 3DM5A 2PXLA
chains in the Genus database with same CATH superfamily
1R63A 3D1NI 3KXAA 2AXVA 3VK0A 2XIUA 3LQXA 1R69A 5GAHi 4Y42A 2HSGA 2O49A 1ZZ8A 2LNMA 1E3OC 1PRAA 3KJXA 2EF8A 3FYAA 2PXBA 4EKIA 1CJGA 3TFLA 4JCXA 2ICPA 2FFHA 2H8RA 4I8TA 3G7DA 1JFTA 1QP7A 2PUGA 3TEPA 3SCFA 2LYLA 4X4DA 3GZDA 3NDBB 1PRVA 2O38A 4X4FA 2V3CC 2AXZA 1JWLA 4PU3C 1PNRA 1RZSA 3R1FA 2LCVA 2J7WA 3NXHA 3JXDL 2PXPA 1OSLA 1RZRA 1QQBA 3GBFA 3SR4A 3JXBC 2JCGA 3M9LA 4DE8A 3A9YA 1LLIA 4X4HA 3OMTA 1B0NA 3BD1A 5DTQA 4X4EA 3TRBA 2PE5A 2BNMA 3H5TA 4MCXA 3NROA 4OB4A 3GZDC 2PUCA 2XCJA 4PU8A 2OFYA 1UXCA 3L1PA 4ER5A 2EBYA 1JFSA 1CQTA 4ER6A 3OQMA 1AU7A 3U3WA 2GZUA 1JH9A 2PXDA 3GZCA 1VPWA 1WH6A 5JUWA 1U2ZA 2LYRA 3TELA 1HQ1A 2FJRA 2D5VA 5DRTA 3A9ZA 3SCHA 3ZHIA 4Q2JA 1DWKA 1NW3A 5DTRA 2ICTA 3GN5B 2EWTA 2XXQA 4PU4C 1X57A 1PRUA 2PIJA 2GRLA 4IVZA 5DT2A 2L49A 1WH8A 2KPJA 2PUDA 2ODRD 3BDNA 4I6RA 3KL4A 2HCNA 3RZZA 2GRMA 4EZIA 3JXCL 1PERL 3GUUA 1NERA 3CECA 1S7EA 4FBIA 2WIUB 1QP0A 2KEJA 4Z58A 1ZVVA 1UTXA 1LQCA 2OR1L 2PUAA 2VEOA 2JVLA 4EQZA 3QYXA 1IC8A 2AWIA 3G0TA 5GAGi 3QFIA 5K98B 4X4GA 4HRAA 2PXQA 1OCTC 1XWRA 2IVGA 1QB2A 1QZXA 5DTMA 2IVBA 2O4AA 3HZIB 2AXUA 4F8DA 3PXPA 3F51A 1L1MA 1MFQC 1NEQA 4EKGA 2XXAA 2CROA 1RIOA 3DM5A 1RZRD 1LMB3 2BNNA 1X2LA 3BS3A 3VWSA 4GHJA 2KEIA 2PXEA 3LISA 1Y9QA 3EUSA 5A7LA 4YG7B 2IU7A 4ER7A 3FMYA 2IV1A 3OWQA 2BJCA 2CSFA 1UXDA 4X4IA 4Z5HA 4MCTA 3R09A 4YG4A 1QQAA 3QOXA 2A6CA 2M4HA 3ZKCA 4GQMA 1Y7YA 1ZZ9A 4NDWA 2LLWA 3LFPA 4WVLA 3OKZA 3UWPA 3ME5A 4X4CA 4Z5DA 1ADRA 2JQEA 2BNOA 4IWRA 2L8NA 3OQNA 3PE5A 1WIZA 2HINA 3CLCA 3OP9A 3QF3A 4YBAA 2LYQA 2LYJA 1QPZA 2PXVA 2B5AA 4JCYA 2WUSR 3S8QA 4PU7A 1LCDA 2MXDA 3F52A 1ZPQA 2HFZA 2PUFA 4I6TA 4JQDA 4J1WA 3UFDA 1LCCA 4YARA 4IA8A 2PPXA 3F6WA 2AUWA 2PXKA 4FN3A 1ZZCA 2IUOA 3QOWA 3MLFA 3O9XA 2PXUA 4X4BA 2MEZA 2XSDC 1ZZ7A 2J7UA 1RPEL 1O4XA 1ZZ6A 1POUA 2PXTA 1HF0A 3ZHMA 4Z59A 3A9XA 1QP4A 4ER3A 3G5GA 2LYKA 1DULA 3DNVB 1WETA 1GT0C 1BDIA 2XXPA 2LYPA 5DRYA 5DSXA 4ER0A 1DW9A 4I6UA 1ZAYA 2PXLA 2R63A 2XJ3A 4EK9A 3OQOA 1BDHA 2KZ8A 3NZLA 1ZS4A 3ZPXA 2KEKA 4OBMA 2IVQA 4YG1A 2PUEA 3IVPA 3FYMA 2YBDA 2PUBA 2AW6A 2HCSA 2R1JL 1EFAA 2L1PA 2MQKA 3QWGA 3SX0A 3CROL 1ZUGA 3SCGA 3MEJA 1YSEA 1ZZBA 4Z5CA 4DE9A 4J1XA 3KZ3A 4O8BA 2LLVA 3QQ6A 3GN5A 2XI8A 3B7HA 2PXFA 1SQ8A 2LYSA
chains in the Genus database with same CATH topology
2PXBA 1QZXA 1QB2A 2PXVA 2PXKA 1HQ1A 1DULA 2FFHA 2PXPA 3LQXA 3KL4A 2V3CC 5GAHi 2PXUA 2PXEA 2JQEA 2PXQA 1MFQC 3NDBB 5GAGi 2PXDA 2PXTA 2PXFA 2XXAA 3DM5A 2PXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PXB A;  1QZX A;  1QB2 A;  2PXV A;  2PXK A;  1HQ1 A;  1DUL A;  2FFH A;  2PXP A;  3LQX A;  3KL4 A;  2V3C C;  5GAH i;  2PXU A;  2PXE A;  2JQE A;  2PXQ A;  1MFQ C;  3NDB B;  5GAG i;  2PXD A;  2PXT A;  2PXF A;  2XXA A;  3DM5 A;  2PXL A; 
#chains in the Genus database with same CATH topology
 1R63 A;  3D1N I;  3KXA A;  2AXV A;  3VK0 A;  2XIU A;  3LQX A;  1R69 A;  5GAH i;  4Y42 A;  2HSG A;  2O49 A;  1ZZ8 A;  2LNM A;  1E3O C;  1PRA A;  3KJX A;  2EF8 A;  3FYA A;  2PXB A;  4EKI A;  1CJG A;  3TFL A;  4JCX A;  2ICP A;  2FFH A;  2H8R A;  4I8T A;  3G7D A;  1JFT A;  1QP7 A;  2PUG A;  3TEP A;  3SCF A;  2LYL A;  4X4D A;  3GZD A;  3NDB B;  1PRV A;  2O38 A;  4X4F A;  2V3C C;  2AXZ A;  1JWL A;  4PU3 C;  1PNR A;  1RZS A;  3R1F A;  2LCV A;  2J7W A;  3NXH A;  3JXD L;  2PXP A;  1OSL A;  1RZR A;  1QQB A;  3GBF A;  3SR4 A;  3JXB C;  2JCG A;  3M9L A;  4DE8 A;  3A9Y A;  1LLI A;  4X4H A;  3OMT A;  1B0N A;  3BD1 A;  5DTQ A;  4X4E A;  3TRB A;  2PE5 A;  2BNM A;  3H5T A;  4MCX A;  3NRO A;  4OB4 A;  3GZD C;  2PUC A;  2XCJ A;  4PU8 A;  2OFY A;  1UXC A;  3L1P A;  4ER5 A;  2EBY A;  1JFS A;  1CQT A;  4ER6 A;  3OQM A;  1AU7 A;  3U3W A;  2GZU A;  1JH9 A;  2PXD A;  3GZC A;  1VPW A;  1WH6 A;  5JUW A;  1U2Z A;  2LYR A;  3TEL A;  1HQ1 A;  2FJR A;  2D5V A;  5DRT A;  3A9Z A;  3SCH A;  3ZHI A;  4Q2J A;  1DWK A;  1NW3 A;  5DTR A;  2ICT A;  3GN5 B;  2EWT A;  2XXQ A;  4PU4 C;  1X57 A;  1PRU A;  2PIJ A;  2GRL A;  4IVZ A;  5DT2 A;  2L49 A;  1WH8 A;  2KPJ A;  2PUD A;  2ODR D;  3BDN A;  4I6R A;  3KL4 A;  2HCN A;  3RZZ A;  2GRM A;  4EZI A;  3JXC L;  1PER L;  3GUU A;  1NER A;  3CEC A;  1S7E A;  4FBI A;  2WIU B;  1QP0 A;  2KEJ A;  4Z58 A;  1ZVV A;  1UTX A;  1LQC A;  2OR1 L;  2PUA A;  2VEO A;  2JVL A;  4EQZ A;  3QYX A;  1IC8 A;  2AWI A;  3G0T A;  5GAG i;  3QFI A;  5K98 B;  4X4G A;  4HRA A;  2PXQ A;  1OCT C;  1XWR A;  2IVG A;  1QB2 A;  1QZX A;  5DTM A;  2IVB A;  2O4A A;  3HZI B;  2AXU A;  4F8D A;  3PXP A;  3F51 A;  1L1M A;  1MFQ C;  1NEQ A;  4EKG A;  2XXA A;  2CRO A;  1RIO A;  3DM5 A;  1RZR D;  1LMB 3;  2BNN A;  1X2L A;  3BS3 A;  3VWS A;  4GHJ A;  2KEI A;  2PXE A;  3LIS A;  1Y9Q A;  3EUS A;  5A7L A;  4YG7 B;  2IU7 A;  4ER7 A;  3FMY A;  2IV1 A;  3OWQ A;  2BJC A;  2CSF A;  1UXD A;  4X4I A;  4Z5H A;  4MCT A;  3R09 A;  4YG4 A;  1QQA A;  3QOX A;  2A6C A;  2M4H A;  3ZKC A;  4GQM A;  1Y7Y A;  1ZZ9 A;  4NDW A;  2LLW A;  3LFP A;  4WVL A;  3OKZ A;  3UWP A;  3ME5 A;  4X4C A;  4Z5D A;  1ADR A;  2JQE A;  2BNO A;  4IWR A;  2L8N A;  3OQN A;  3PE5 A;  1WIZ A;  2HIN A;  3CLC A;  3OP9 A;  3QF3 A;  4YBA A;  2LYQ A;  2LYJ A;  1QPZ A;  2PXV A;  2B5A A;  4JCY A;  2WUS R;  3S8Q A;  4PU7 A;  1LCD A;  2MXD A;  3F52 A;  1ZPQ A;  2HFZ A;  2PUF A;  4I6T A;  4JQD A;  4J1W A;  3UFD A;  1LCC A;  4YAR A;  4IA8 A;  2PPX A;  3F6W A;  2AUW A;  2PXK A;  4FN3 A;  1ZZC A;  2IUO A;  3QOW A;  3MLF A;  3O9X A;  2PXU A;  4X4B A;  2MEZ A;  2XSD C;  1ZZ7 A;  2J7U A;  1RPE L;  1O4X A;  1ZZ6 A;  1POU A;  2PXT A;  1HF0 A;  3ZHM A;  4Z59 A;  3A9X A;  1QP4 A;  4ER3 A;  3G5G A;  2LYK A;  1DUL A;  3DNV B;  1WET A;  1GT0 C;  1BDI A;  2XXP A;  2LYP A;  5DRY A;  5DSX A;  4ER0 A;  1DW9 A;  4I6U A;  1ZAY A;  2PXL A;  2R63 A;  2XJ3 A;  4EK9 A;  3OQO A;  1BDH A;  2KZ8 A;  3NZL A;  1ZS4 A;  3ZPX A;  2KEK A;  4OBM A;  2IVQ A;  4YG1 A;  2PUE A;  3IVP A;  3FYM A;  2YBD A;  2PUB A;  2AW6 A;  2HCS A;  2R1J L;  1EFA A;  2L1P A;  2MQK A;  3QWG A;  3SX0 A;  3CRO L;  1ZUG A;  3SCG A;  3MEJ A;  1YSE A;  1ZZB A;  4Z5C A;  4DE9 A;  4J1X A;  3KZ3 A;  4O8B A;  2LLV A;  3QQ6 A;  3GN5 A;  2XI8 A;  3B7H A;  2PXF A;  1SQ8 A;  2LYS A; 
#chains in the Genus database with same CATH homology
 2PXB A;  1QZX A;  1QB2 A;  2PXV A;  2PXK A;  1HQ1 A;  1DUL A;  2FFH A;  2PXP A;  3LQX A;  3KL4 A;  2V3C C;  5GAH i;  2PXU A;  2PXE A;  2JQE A;  2PXQ A;  1MFQ C;  3NDB B;  5GAG i;  2PXD A;  2PXT A;  2PXF A;  2XXA A;  3DM5 A;  2PXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...