2PXKA

Variant 8 of ribonucleoprotein core of the e. coli signal recognition particle
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
102
structure length
69
Chain Sequence
FDLNDFLEQKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGSGMQVQDVNRLLKQFDDMQRMMKKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A General Strategy to Solve the Phase Problem in RNA Crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein/rna
molecule keywords 4.5 S RNA
total genus 16
structure length 69
sequence length 102
ec nomenclature
pdb deposition date 2007-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.30 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) Signal recognition particle, SRP54 subunit, M-domain 2pxkA00
1HQ1A 2PXPA 2PXQA 2PXFA 3DM5A 2PXKA 1QB2A 1QZXA 2JQEA 5GAHi 2PXBA 1DULA 2PXDA 2PXTA 3KL4A 2PXUA 1MFQC 2PXLA 3LQXA 3NDBB 2XXAA 2FFHA 2PXVA 2PXEA 2V3CC 5GAGi
chains in the Genus database with same CATH superfamily
3GBFA 2J7UA 4ER6A 4IWRA 3DM5A 2EBYA 5JUWA 3G7DA 2PXDA 1XWRA 1YSEA 2L8NA 3R09A 3BS3A 1NERA 1RZRA 4I6UA 3SR4A 2LYPA 4YG1A 2PPXA 2HINA 1UXCA 3KXAA 4MCXA 1ZZBA 5K98B 1DW9A 3U3WA 3G5GA 2AUWA 3IVPA 1LCDA 3JXDL 4PU3C 2FFHA 4PU7A 3MLFA 2ICPA 3QOWA 1AU7A 4X4GA 2JCGA 2WIUB 2LCVA 1U2ZA 2XIUA 1QP0A 3F6WA 5GAHi 2LYRA 2MXDA 4X4CA 1L1MA 1PRVA 2PXTA 3QF3A 1LQCA 2PXUA 4EKIA 3TFLA 4PU8A 1NW3A 3D1NI 2LYSA 4X4IA 1E3OC 3QYXA 3MEJA 1WETA 2AXZA 4JQDA 2PUFA 3TEPA 2HCSA 3QWGA 2D5VA 4ER0A 1JH9A 3ZHIA 1BDIA 4OBMA 2IVBA 2PXVA 3F52A 3OQMA 5DTQA 1ZZ9A 2KEKA 2OR1L 2IVGA 3CROL 1SQ8A 3JXBC 1ZUGA 4X4BA 2O38A 5DT2A 1NEQA 1OCTC 4ER5A 3FYAA 2PXQA 3RZZA 5A7LA 2KEJA 1LCCA 4YG4A 3VWSA 2IV1A 2MQKA 4PU4C 2ICTA 2XSDC 2KEIA 2PIJA 4Z5DA 2EWTA 2R63A 1QPZA 1VPWA 1WH6A 2JVLA 1HQ1A 2LYQA 1ZAYA 2PXPA 4ER3A 4Z59A 1PNRA 4J1XA 2BNNA 1LLIA 2GZUA 1LMB3 2PUBA 3A9YA 3F51A 2EF8A 1OSLA 1RIOA 2AXUA 4DE8A 1QQBA 4YARA 1EFAA 1PRUA 3A9ZA 1UXDA 2PXKA 2HCNA 2KPJA 2OFYA 2CROA 3EUSA 4GQMA 4I6TA 2XXAA 2PXEA 3OQNA 3B7HA 3GUUA 3M9LA 2LYLA 4ER7A 1GT0C 1IC8A 3L1PA 1S7EA 2PUAA 2FJRA 1WH8A 4IA8A 4I8TA 4HRAA 3S8QA 3QFIA 4EQZA 1RPEL 3LQXA 1ZZ8A 2A6CA 2KZ8A 5DSXA 2R1JL 3UWPA 4X4EA 4NDWA 2PXFA 1ZZ7A 4EK9A 2ODRD 2IVQA 3OWQA 2LNMA 2HFZA 3VK0A 3KL4A 2L1PA 4DE9A 2M4HA 2LLVA 1DWKA 1ZS4A 2PXLA 3CLCA 3ME5A 2XXQA 4X4DA 2HSGA 1R69A 4Y42A 3R1FA 3OP9A 2LLWA 2MEZA 2L49A 2GRLA 3PE5A 4EKGA 4IVZA 4Z5HA 3LISA 4JCXA 3SCHA 2BJCA 1QP7A 4OB4A 5DRYA 3KJXA 5DTRA 1Y9QA 4O8BA 2H8RA 2AWIA 4YBAA 1X2LA 3HZIB 3QOXA 1Y7YA 3H5TA 1QQAA 5DRTA 2PXBA 3OKZA 2LYJA 3CECA 2CSFA 1MFQC 2IU7A 2O4AA 2XJ3A 1O4XA 2J7WA 1R63A 2O49A 3SCFA 1RZRD 3G0TA 3KZ3A 1ZPQA 4X4HA 1QZXA 3UFDA 4EZIA 4X4FA 2PUGA 3ZHMA 1ZVVA 3NXHA 3OMTA 4GHJA 4YG7B 3BDNA 4Q2JA 3LFPA 2GRMA 4F8DA 3BD1A 1ADRA 1BDHA 3ZPXA 3GN5B 2AXVA 1POUA 5GAGi 3O9XA 2BNOA 2PUDA 2BNMA 1QB2A 1X57A 2WUSR 2YBDA 1HF0A 4Z58A 2PUEA 3FYMA 3SCGA 4FN3A 1PRAA 2PUCA 1B0NA 3NDBB 3GZDA 2XXPA 4J1WA 1ZZ6A 1CQTA 2PE5A 1WIZA 3NROA 4WVLA 3OQOA 3PXPA 1ZZCA 2IUOA 2LYKA 2JQEA 1PERL 3JXCL 1DULA 2AW6A 1CJGA 3QQ6A 1UTXA 3GZDC 3GN5A 3NZLA 3FMYA 2VEOA 3A9XA 3SX0A 2V3CC 4FBIA 3TELA 1JWLA 3TRBA 4Z5CA 1JFTA 3DNVB 1RZSA 1QP4A 3GZCA 3ZKCA 2B5AA 5DTMA 4JCYA 2XCJA 4I6RA 1JFSA 4MCTA 2XI8A
chains in the Genus database with same CATH topology
1HQ1A 2PXPA 2PXQA 2PXFA 3DM5A 2PXKA 1QB2A 1QZXA 2JQEA 5GAHi 2PXBA 1DULA 2PXDA 2PXTA 3KL4A 2PXUA 1MFQC 2PXLA 3LQXA 3NDBB 2XXAA 2FFHA 2PXVA 2PXEA 2V3CC 5GAGi
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQ1 A;  2PXP A;  2PXQ A;  2PXF A;  3DM5 A;  2PXK A;  1QB2 A;  1QZX A;  2JQE A;  5GAH i;  2PXB A;  1DUL A;  2PXD A;  2PXT A;  3KL4 A;  2PXU A;  1MFQ C;  2PXL A;  3LQX A;  3NDB B;  2XXA A;  2FFH A;  2PXV A;  2PXE A;  2V3C C;  5GAG i; 
#chains in the Genus database with same CATH topology
 3GBF A;  2J7U A;  4ER6 A;  4IWR A;  3DM5 A;  2EBY A;  5JUW A;  3G7D A;  2PXD A;  1XWR A;  1YSE A;  2L8N A;  3R09 A;  3BS3 A;  1NER A;  1RZR A;  4I6U A;  3SR4 A;  2LYP A;  4YG1 A;  2PPX A;  2HIN A;  1UXC A;  3KXA A;  4MCX A;  1ZZB A;  5K98 B;  1DW9 A;  3U3W A;  3G5G A;  2AUW A;  3IVP A;  1LCD A;  3JXD L;  4PU3 C;  2FFH A;  4PU7 A;  3MLF A;  2ICP A;  3QOW A;  1AU7 A;  4X4G A;  2JCG A;  2WIU B;  2LCV A;  1U2Z A;  2XIU A;  1QP0 A;  3F6W A;  5GAH i;  2LYR A;  2MXD A;  4X4C A;  1L1M A;  1PRV A;  2PXT A;  3QF3 A;  1LQC A;  2PXU A;  4EKI A;  3TFL A;  4PU8 A;  1NW3 A;  3D1N I;  2LYS A;  4X4I A;  1E3O C;  3QYX A;  3MEJ A;  1WET A;  2AXZ A;  4JQD A;  2PUF A;  3TEP A;  2HCS A;  3QWG A;  2D5V A;  4ER0 A;  1JH9 A;  3ZHI A;  1BDI A;  4OBM A;  2IVB A;  2PXV A;  3F52 A;  3OQM A;  5DTQ A;  1ZZ9 A;  2KEK A;  2OR1 L;  2IVG A;  3CRO L;  1SQ8 A;  3JXB C;  1ZUG A;  4X4B A;  2O38 A;  5DT2 A;  1NEQ A;  1OCT C;  4ER5 A;  3FYA A;  2PXQ A;  3RZZ A;  5A7L A;  2KEJ A;  1LCC A;  4YG4 A;  3VWS A;  2IV1 A;  2MQK A;  4PU4 C;  2ICT A;  2XSD C;  2KEI A;  2PIJ A;  4Z5D A;  2EWT A;  2R63 A;  1QPZ A;  1VPW A;  1WH6 A;  2JVL A;  1HQ1 A;  2LYQ A;  1ZAY A;  2PXP A;  4ER3 A;  4Z59 A;  1PNR A;  4J1X A;  2BNN A;  1LLI A;  2GZU A;  1LMB 3;  2PUB A;  3A9Y A;  3F51 A;  2EF8 A;  1OSL A;  1RIO A;  2AXU A;  4DE8 A;  1QQB A;  4YAR A;  1EFA A;  1PRU A;  3A9Z A;  1UXD A;  2PXK A;  2HCN A;  2KPJ A;  2OFY A;  2CRO A;  3EUS A;  4GQM A;  4I6T A;  2XXA A;  2PXE A;  3OQN A;  3B7H A;  3GUU A;  3M9L A;  2LYL A;  4ER7 A;  1GT0 C;  1IC8 A;  3L1P A;  1S7E A;  2PUA A;  2FJR A;  1WH8 A;  4IA8 A;  4I8T A;  4HRA A;  3S8Q A;  3QFI A;  4EQZ A;  1RPE L;  3LQX A;  1ZZ8 A;  2A6C A;  2KZ8 A;  5DSX A;  2R1J L;  3UWP A;  4X4E A;  4NDW A;  2PXF A;  1ZZ7 A;  4EK9 A;  2ODR D;  2IVQ A;  3OWQ A;  2LNM A;  2HFZ A;  3VK0 A;  3KL4 A;  2L1P A;  4DE9 A;  2M4H A;  2LLV A;  1DWK A;  1ZS4 A;  2PXL A;  3CLC A;  3ME5 A;  2XXQ A;  4X4D A;  2HSG A;  1R69 A;  4Y42 A;  3R1F A;  3OP9 A;  2LLW A;  2MEZ A;  2L49 A;  2GRL A;  3PE5 A;  4EKG A;  4IVZ A;  4Z5H A;  3LIS A;  4JCX A;  3SCH A;  2BJC A;  1QP7 A;  4OB4 A;  5DRY A;  3KJX A;  5DTR A;  1Y9Q A;  4O8B A;  2H8R A;  2AWI A;  4YBA A;  1X2L A;  3HZI B;  3QOX A;  1Y7Y A;  3H5T A;  1QQA A;  5DRT A;  2PXB A;  3OKZ A;  2LYJ A;  3CEC A;  2CSF A;  1MFQ C;  2IU7 A;  2O4A A;  2XJ3 A;  1O4X A;  2J7W A;  1R63 A;  2O49 A;  3SCF A;  1RZR D;  3G0T A;  3KZ3 A;  1ZPQ A;  4X4H A;  1QZX A;  3UFD A;  4EZI A;  4X4F A;  2PUG A;  3ZHM A;  1ZVV A;  3NXH A;  3OMT A;  4GHJ A;  4YG7 B;  3BDN A;  4Q2J A;  3LFP A;  2GRM A;  4F8D A;  3BD1 A;  1ADR A;  1BDH A;  3ZPX A;  3GN5 B;  2AXV A;  1POU A;  5GAG i;  3O9X A;  2BNO A;  2PUD A;  2BNM A;  1QB2 A;  1X57 A;  2WUS R;  2YBD A;  1HF0 A;  4Z58 A;  2PUE A;  3FYM A;  3SCG A;  4FN3 A;  1PRA A;  2PUC A;  1B0N A;  3NDB B;  3GZD A;  2XXP A;  4J1W A;  1ZZ6 A;  1CQT A;  2PE5 A;  1WIZ A;  3NRO A;  4WVL A;  3OQO A;  3PXP A;  1ZZC A;  2IUO A;  2LYK A;  2JQE A;  1PER L;  3JXC L;  1DUL A;  2AW6 A;  1CJG A;  3QQ6 A;  1UTX A;  3GZD C;  3GN5 A;  3NZL A;  3FMY A;  2VEO A;  3A9X A;  3SX0 A;  2V3C C;  4FBI A;  3TEL A;  1JWL A;  3TRB A;  4Z5C A;  1JFT A;  3DNV B;  1RZS A;  1QP4 A;  3GZC A;  3ZKC A;  2B5A A;  5DTM A;  4JCY A;  2XCJ A;  4I6R A;  1JFS A;  4MCT A;  2XI8 A; 
#chains in the Genus database with same CATH homology
 1HQ1 A;  2PXP A;  2PXQ A;  2PXF A;  3DM5 A;  2PXK A;  1QB2 A;  1QZX A;  2JQE A;  5GAH i;  2PXB A;  1DUL A;  2PXD A;  2PXT A;  3KL4 A;  2PXU A;  1MFQ C;  2PXL A;  3LQX A;  3NDB B;  2XXA A;  2FFH A;  2PXV A;  2PXE A;  2V3C C;  5GAG i; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...