2PXVA

Variant 6 of ribonucleoprotein core of the e. coli signal recognition particle
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
102
structure length
69
Chain Sequence
FDLNDFLEQKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGSGMQVQDVNRLLKQFDDMQRMMKKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A General Strategy to Solve the Phase Problem in RNA Crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein/rna
molecule keywords 4.5 S RNA
total genus 15
structure length 69
sequence length 102
ec nomenclature
pdb deposition date 2007-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.30 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) Signal recognition particle, SRP54 subunit, M-domain 2pxvA00
2PXUA 5GAHi 2PXVA 2PXLA 2JQEA 2PXTA 1HQ1A 1QB2A 2PXBA 3NDBB 3DM5A 2PXFA 2XXAA 2PXKA 2PXQA 2PXPA 1QZXA 1DULA 1MFQC 2PXEA 3LQXA 2FFHA 2PXDA 3KL4A 5GAGi 2V3CC
chains in the Genus database with same CATH superfamily
1S7EA 2GRLA 3QF3A 1WH6A 2A6CA 5GAHi 3U3WA 4JCXA 1EFAA 2HCNA 3QYXA 3GN5B 3F51A 1JFTA 1ZPQA 2O38A 1HF0A 1CJGA 1QQAA 2GRMA 3F6WA 1ZS4A 3QQ6A 4OB4A 1RZRD 1E3OC 2J7WA 3R09A 4X4HA 2PXLA 3FYMA 3QWGA 4ER7A 4Y42A 2PIJA 2PXKA 4PU4C 4DE9A 3OKZA 3QOWA 1MFQC 2L49A 3A9XA 3LISA 2PUAA 4YG7B 3QOXA 1UTXA 1R63A 3A9ZA 3NXHA 3GZDA 2JQEA 3GBFA 4JCYA 2KZ8A 1QB2A 2KEJA 2XJ3A 1R69A 3PE5A 1ZZ8A 3IVPA 1LCCA 2GZUA 4I6TA 2LLWA 3BD1A 3TFLA 3LQXA 1NEQA 1XWRA 3TRBA 2MQKA 2R1JL 4PU3C 3OWQA 3JXCL 2MXDA 3A9YA 4X4GA 5DTQA 1VPWA 4EKIA 1WETA 1L1MA 1ZZ9A 1PERL 1AU7A 5DTRA 2LYSA 1SQ8A 2O49A 3TEPA 1ZAYA 3SCFA 3ME5A 3KZ3A 2XCJA 1JFSA 3QFIA 3FYAA 2LNMA 1ZVVA 2AWIA 3OMTA 3G5GA 2LYQA 4EQZA 2PXQA 3ZHMA 4PU8A 2FJRA 3O9XA 2PUFA 1ZZ6A 1ZZ7A 2CSFA 2JVLA 2HCSA 1GT0C 1IC8A 1ZZCA 2AUWA 2OFYA 2BNMA 4OBMA 4ER6A 2PXPA 2PUCA 2KEKA 1LLIA 1ZUGA 1OSLA 2PUDA 2ODRD 2IVQA 3UFDA 2PPXA 2PXVA 2HINA 3NDBB 1LMB3 2IV1A 2KPJA 3KJXA 4F8DA 2LYKA 3MEJA 1UXDA 4MCTA 2M4HA 3G0TA 1RIOA 3DM5A 1BDHA 4DE8A 3PXPA 3OQOA 3RZZA 5K98B 3CLCA 3KL4A 1RZRA 1OCTC 1RPEL 2EF8A 4X4FA 4X4DA 3EUSA 1PRVA 4YG4A 1QP4A 4NDWA 3CECA 4X4IA 2H8RA 2R63A 1X2LA 3GZDC 1CQTA 2LCVA 4ER3A 4Z58A 4IVZA 3VWSA 3NROA 4EK9A 2PUGA 2AXZA 2ICTA 3ZHIA 3ZPXA 4IWRA 1X57A 4X4CA 3H5TA 1HQ1A 3TELA 3JXBC 2HFZA 1LQCA 2LYJA 2LYPA 1PNRA 4JQDA 2B5AA 1ADRA 2FFHA 4ER0A 1JH9A 3R1FA 3MLFA 3L1PA 2PUBA 4Z5DA 2AXVA 5JUWA 1B0NA 4WVLA 1BDIA 4FBIA 4X4EA 2EWTA 4HRAA 3G7DA 4EKGA 4EZIA 3GZCA 3SCGA 1DWKA 3FMYA 2BNOA 2EBYA 1DW9A 5A7LA 3CROL 2PE5A 2L1PA 2PXEA 3SCHA 4I8TA 2VEOA 4J1XA 4MCXA 2AW6A 3OQNA 1JWLA 1POUA 2CROA 3BDNA 2XIUA 1Y7YA 3GUUA 4GQMA 2LYRA 2AXUA 3M9LA 3BS3A 2PUEA 2WUSR 3OQMA 2IVGA 1RZSA 4X4BA 5GAGi 3B7HA 2XSDC 3GN5A 4ER5A 2ICPA 3LFPA 3F52A 4Z59A 3S8QA 3OP9A 4FN3A 5DSXA 2XXAA 4IA8A 2KEIA 2J7UA 2JCGA 2BJCA 2XXQA 3SR4A 2PXDA 4I6UA 2BNNA 1LCDA 2XXPA 2YBDA 2PXTA 4J1WA 3UWPA 1YSEA 5DRYA 2HSGA 3ZKCA 1QP7A 2LYLA 3JXDL 1O4XA 1ZZBA 4Z5CA 2V3CC 4YARA 2IUOA 2WIUB 1PRUA 1NW3A 4PU7A 3VK0A 2LLVA 2O4AA 1WIZA 2IU7A 2PXBA 2IVBA 2XI8A 2PXFA 1UXCA 1PRAA 5DRTA 4YG1A 3HZIB 5DT2A 1QZXA 4YBAA 2D5VA 4GHJA 2OR1L 1QQBA 1NERA 1U2ZA 4Z5HA 3D1NI 4I6RA 2PXUA 4O8BA 1Y9QA 3NZLA 2MEZA 1QPZA 3KXAA 4Q2JA 3DNVB 1WH8A 2L8NA 1DULA 5DTMA 1QP0A 3SX0A
chains in the Genus database with same CATH topology
2PXUA 5GAHi 2PXVA 2PXLA 2JQEA 2PXTA 1HQ1A 1QB2A 2PXBA 3NDBB 3DM5A 2PXFA 2XXAA 2PXKA 2PXQA 2PXPA 1QZXA 1DULA 1MFQC 2PXEA 3LQXA 2FFHA 2PXDA 3KL4A 5GAGi 2V3CC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PXU A;  5GAH i;  2PXV A;  2PXL A;  2JQE A;  2PXT A;  1HQ1 A;  1QB2 A;  2PXB A;  3NDB B;  3DM5 A;  2PXF A;  2XXA A;  2PXK A;  2PXQ A;  2PXP A;  1QZX A;  1DUL A;  1MFQ C;  2PXE A;  3LQX A;  2FFH A;  2PXD A;  3KL4 A;  5GAG i;  2V3C C; 
#chains in the Genus database with same CATH topology
 1S7E A;  2GRL A;  3QF3 A;  1WH6 A;  2A6C A;  5GAH i;  3U3W A;  4JCX A;  1EFA A;  2HCN A;  3QYX A;  3GN5 B;  3F51 A;  1JFT A;  1ZPQ A;  2O38 A;  1HF0 A;  1CJG A;  1QQA A;  2GRM A;  3F6W A;  1ZS4 A;  3QQ6 A;  4OB4 A;  1RZR D;  1E3O C;  2J7W A;  3R09 A;  4X4H A;  2PXL A;  3FYM A;  3QWG A;  4ER7 A;  4Y42 A;  2PIJ A;  2PXK A;  4PU4 C;  4DE9 A;  3OKZ A;  3QOW A;  1MFQ C;  2L49 A;  3A9X A;  3LIS A;  2PUA A;  4YG7 B;  3QOX A;  1UTX A;  1R63 A;  3A9Z A;  3NXH A;  3GZD A;  2JQE A;  3GBF A;  4JCY A;  2KZ8 A;  1QB2 A;  2KEJ A;  2XJ3 A;  1R69 A;  3PE5 A;  1ZZ8 A;  3IVP A;  1LCC A;  2GZU A;  4I6T A;  2LLW A;  3BD1 A;  3TFL A;  3LQX A;  1NEQ A;  1XWR A;  3TRB A;  2MQK A;  2R1J L;  4PU3 C;  3OWQ A;  3JXC L;  2MXD A;  3A9Y A;  4X4G A;  5DTQ A;  1VPW A;  4EKI A;  1WET A;  1L1M A;  1ZZ9 A;  1PER L;  1AU7 A;  5DTR A;  2LYS A;  1SQ8 A;  2O49 A;  3TEP A;  1ZAY A;  3SCF A;  3ME5 A;  3KZ3 A;  2XCJ A;  1JFS A;  3QFI A;  3FYA A;  2LNM A;  1ZVV A;  2AWI A;  3OMT A;  3G5G A;  2LYQ A;  4EQZ A;  2PXQ A;  3ZHM A;  4PU8 A;  2FJR A;  3O9X A;  2PUF A;  1ZZ6 A;  1ZZ7 A;  2CSF A;  2JVL A;  2HCS A;  1GT0 C;  1IC8 A;  1ZZC A;  2AUW A;  2OFY A;  2BNM A;  4OBM A;  4ER6 A;  2PXP A;  2PUC A;  2KEK A;  1LLI A;  1ZUG A;  1OSL A;  2PUD A;  2ODR D;  2IVQ A;  3UFD A;  2PPX A;  2PXV A;  2HIN A;  3NDB B;  1LMB 3;  2IV1 A;  2KPJ A;  3KJX A;  4F8D A;  2LYK A;  3MEJ A;  1UXD A;  4MCT A;  2M4H A;  3G0T A;  1RIO A;  3DM5 A;  1BDH A;  4DE8 A;  3PXP A;  3OQO A;  3RZZ A;  5K98 B;  3CLC A;  3KL4 A;  1RZR A;  1OCT C;  1RPE L;  2EF8 A;  4X4F A;  4X4D A;  3EUS A;  1PRV A;  4YG4 A;  1QP4 A;  4NDW A;  3CEC A;  4X4I A;  2H8R A;  2R63 A;  1X2L A;  3GZD C;  1CQT A;  2LCV A;  4ER3 A;  4Z58 A;  4IVZ A;  3VWS A;  3NRO A;  4EK9 A;  2PUG A;  2AXZ A;  2ICT A;  3ZHI A;  3ZPX A;  4IWR A;  1X57 A;  4X4C A;  3H5T A;  1HQ1 A;  3TEL A;  3JXB C;  2HFZ A;  1LQC A;  2LYJ A;  2LYP A;  1PNR A;  4JQD A;  2B5A A;  1ADR A;  2FFH A;  4ER0 A;  1JH9 A;  3R1F A;  3MLF A;  3L1P A;  2PUB A;  4Z5D A;  2AXV A;  5JUW A;  1B0N A;  4WVL A;  1BDI A;  4FBI A;  4X4E A;  2EWT A;  4HRA A;  3G7D A;  4EKG A;  4EZI A;  3GZC A;  3SCG A;  1DWK A;  3FMY A;  2BNO A;  2EBY A;  1DW9 A;  5A7L A;  3CRO L;  2PE5 A;  2L1P A;  2PXE A;  3SCH A;  4I8T A;  2VEO A;  4J1X A;  4MCX A;  2AW6 A;  3OQN A;  1JWL A;  1POU A;  2CRO A;  3BDN A;  2XIU A;  1Y7Y A;  3GUU A;  4GQM A;  2LYR A;  2AXU A;  3M9L A;  3BS3 A;  2PUE A;  2WUS R;  3OQM A;  2IVG A;  1RZS A;  4X4B A;  5GAG i;  3B7H A;  2XSD C;  3GN5 A;  4ER5 A;  2ICP A;  3LFP A;  3F52 A;  4Z59 A;  3S8Q A;  3OP9 A;  4FN3 A;  5DSX A;  2XXA A;  4IA8 A;  2KEI A;  2J7U A;  2JCG A;  2BJC A;  2XXQ A;  3SR4 A;  2PXD A;  4I6U A;  2BNN A;  1LCD A;  2XXP A;  2YBD A;  2PXT A;  4J1W A;  3UWP A;  1YSE A;  5DRY A;  2HSG A;  3ZKC A;  1QP7 A;  2LYL A;  3JXD L;  1O4X A;  1ZZB A;  4Z5C A;  2V3C C;  4YAR A;  2IUO A;  2WIU B;  1PRU A;  1NW3 A;  4PU7 A;  3VK0 A;  2LLV A;  2O4A A;  1WIZ A;  2IU7 A;  2PXB A;  2IVB A;  2XI8 A;  2PXF A;  1UXC A;  1PRA A;  5DRT A;  4YG1 A;  3HZI B;  5DT2 A;  1QZX A;  4YBA A;  2D5V A;  4GHJ A;  2OR1 L;  1QQB A;  1NER A;  1U2Z A;  4Z5H A;  3D1N I;  4I6R A;  2PXU A;  4O8B A;  1Y9Q A;  3NZL A;  2MEZ A;  1QPZ A;  3KXA A;  4Q2J A;  3DNV B;  1WH8 A;  2L8N A;  1DUL A;  5DTM A;  1QP0 A;  3SX0 A; 
#chains in the Genus database with same CATH homology
 2PXU A;  5GAH i;  2PXV A;  2PXL A;  2JQE A;  2PXT A;  1HQ1 A;  1QB2 A;  2PXB A;  3NDB B;  3DM5 A;  2PXF A;  2XXA A;  2PXK A;  2PXQ A;  2PXP A;  1QZX A;  1DUL A;  1MFQ C;  2PXE A;  3LQX A;  2FFH A;  2PXD A;  3KL4 A;  5GAG i;  2V3C C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...