2PXWA

Crystal structure of n66d mutant of green fluorescent protein from zoanthus sp. at 2.4 a resolution (transition state)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
225
Chain Sequence
SKHGLTKEMTMKYRMEGCVDGHKFVITGEGIGYPFKGKQAINLCVVEGGPLPFAEDILSAAFNRVFTEYPQDIVDYFKNSCPAGYTWDRSFLFEDGAVCICNADITVSVEENCMYHESKFYGVNFPADGPVMKKMTDNWEPSCEKIIPVPKQGILKGDVSMYLLLKDGGRLRCQFDTVYKAKSVPRKMPDWHFIQHKLTREDRSDAKNQKWHLTEHAIASGSALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GFP-like fluorescent chromoprotein FP506
publication title Refined crystal structures of red and green fluorescent proteins from the button polyp Zoanthus.
pubmed doi rcsb
source organism Zoanthus sp.
molecule tags Fluorescent protein
total genus 65
structure length 225
sequence length 226
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 2pxwA00
5H88A 4KF4A 4Q7RA 4Z4KA 4W6NA 5DQMA 3G9AA 3EVVA 1KYRA 1Q4BA 3V3DA 5EBJA 4W7FA 3OSQA 3U0KA 3GEXA 1ZGOA 2H6VA 1XA9A 2DUIA 1YJFA 4ZFSA 4DXIA 1XMZA 2WHUA 3U8CA 3GL4A 2QLEA 2Y0GA 4ZF5A 4L13A 2JADA 3ZUJA 3SVCA 4W7EA 4W6OA 4W7DA 4KPIA 2A53B 4W6UA 5LTPA 4H3NA 5EJUA 1YJ2A 3IP2A 2O24A 1XAEA 2Z6ZA 4EULA 1HCJA 4W6DA 4W6MA 1EMAA 1H6RA 4DKMA 2IB6A 3DQHA 3DQ4A 4Q7TA 3DQNA 1KYPA 5HZTA 2DDDA 3NT3A 3RWTA 1MYWA 2ICRA 3PIBA 4OJ0A 2ZMUA 3SVOA 2G3OA 3GB3A 4XGYA 4W6TA 3U8AA 2OTBA 4U2VA 3EK4A 3SSHA 5FVFA 1EMGA 4LJCA 1GGXA 3M24A 3PJ7A 1RMOA 4DXMA 5BQLA 3DQUA 3AI5A 3DPXA 4AR7A 3U0LA 3MGFA 2A47A 3LVCA 1Q4CA 4W69A 3U8PA 2G6XA 4LJBA 4LQTA 5DTXA 4L1IA 4N3DA 1W7TA 4BDUA 1Z1QA 3CD1A 4EDOA 3CBEA 3ZTFA 4ZINA 1OXDA 2VVHA 2OJKA 3DQ5A 2HJOA 4H47A 2HGYA 3U0NA 3DQ3A 2QU1A 5EB7A 2PXWA 4W6JA 2A54B 2FZUA 3SVBA 3BX9A 1H4UA 2G3DB 3E5VA 2AH8A 3GJ2A 1YHHA 3OSRA 2VAEA 4IK4A 1W7SA 2HQZA 5FVGA 5BT0A 2WISA 4GESB 5EXBA 1MOVA 3DQCA 3ED8A 4ZIOA 4GOBA 1ZUXA 3KCSA 5HGEA 4JEOA 3SSTA 1JBYA 4L12A 2QZ0A 3SG6A 3LSAA 4XL5A 2Z1OA 1GL4A 4JFGA 3CFFA 4RYSA 2ZO6A 4W6FA 3K1KA 2EMDA 2OTEA 3S05A 2G5ZB 4NWSA 4Z4MA 4W6GA 3SVEA 2Q57A 2AWKA 3SSYA 2G6YA 5F9GA 5DTYA 1EMEA 2EMNA 4XOWA 4W7AA 2BTJA 5DPGA 3ST2A 2GX0A 3BXAA 1OXFA 2PXSA 1GFLA 2Z6YA 2Z6XA 4ZB1A 3DQ8A 2WSOA 3P8UA 3LS3A 4OHSA 4H48A 1QYFA 1MOUA 4XVPA 3SVUA 2YDZA 4ZF4A 2OKWA 4W7XA 1RMMA 2DUFA 3CFHA 3W1DA 5FHVA 2B3QA 1JBZA 2FWQA 1ZGQA 4KF5C 4HQ9A 3TMRA 4KGEA 4TZGA 2A46A 3BXBA 3DPZA 3EKJA 5BTTA 2A50B 4H3MA 1W7UA 3NT9A 2YE1A 3SSPA 5HZUA 3AKOA 3VK1A 5HW9A 4HE4A 3NEDA 3CGLA 4RYWA 2HPWA 4KF5A 4OY4A 4R6DA 2GW3A 2VVJA 3RWAA 4TZAA 4W6HA 3PJBA 4J8AA 4LQUA 2C9IA 3H1RA 5LK4A 1JC1A 3TMTA 5DQBA 3NF0A 1G7KA 3IR8A 1QYOA 4ANJA 2OKYA 2VZXA 3CB9A 4JRBA 5LTRA 2G16B 1S6ZA 2C9JA 4Q9WA 4DXQA 3DQEA 4KA9A 3SV5A 4W77A 4JC2A 2WIQA 4W73A 2DD7A 1EMMA 3VHTA 3VHTB 3EVPA 2H9WA 3UG0A 3EVRA 3O78A 2A48A 4W6BA 2QRFA 5DRFA 5H89A 4OQWA 1ZGPA 2A56B 4DXPA 2QT2A 3GJ1A 4Q9XA 2OGRA 3SRYA 1KYSA 3SG4A 5EXUA 3LVDA 3SVSA 3SG3A 4W6KA 1QXTA 4EN1A 2AWJA 4LW5A 1JC0A 4JGEA 2O2BA 4W75A 4W6SA 4EDSA 2ARLA 4GF6B 3P28A 3CD9A 4DKNA 4PPLA 2H5QA 3ST3A 4KW4A 1F0BA 3BXCA 1YHIA 3DQFA 5DTLA 2H5PA 2WHSA 2RH7A 4H3LA 4IK9A 2G6EA 3EK7A 5DRGA 2P4MA 2G2SB 2WURA 2A52B 3DQJA 4W6AA 4EMQA 5HZOA 4W6CA 1Q4EA 3SSLA 4J89A 1XSSA 4IK5A 4PPJA 5DPIA 3I19A 2AWMA 3M22A 2QLHA 4W72A 3EVUA 5DPHA 3DQLA 4IK3A 2VADA 1EMCA 3ADFA 4W6LA 3DQ2A 4W76A 1HUYA 4B5YA 4DXNA 4UTSA 4J88A 2B3PA 1UISA 1EMKA 2DUHA 4B30A 3DQAA 1F09A 1RRXA 3O77A 4B30B 4R6BA 1BFPA 4ZF3A 3DQOA 4I2YA 3DQ6A 3DQ9A 4KW9A 5HZSA 2YE0A 4IZNA 3ZULA 1Q73A 2H5OA 2V4EC 3DQIA 5BTTB 4KAGA 4W6RA 3VICA 3OGOA 3ST4A 2HRSA 1QYQA 5FVIA 1OXEA 3WCKA 2GW4B 3ZUFA 3SVNA 4ORNA 3SG2A 3SVRA 3NEZA 2AWLA 3DQDA 3CFAA 3U0MA 3AI4A 4IK8A 1B9CA 4AS8A 1RMPA 4KGFA 4JF9A 2DUEA 2POXA 2GX2A 2V4EA 3DQ7A 4W7RA 2V4EB 1Z1PA 2ZMWA 4W74A 5DPJA 3LVAA 3SG7A 3DQKA 1EMFA 2H8QA 4W7CA 3W1CA 2IE2A 2IB5A 4IK1A 4PPKA 5T3IA 4OGSA 1RM9A 3SG5A 4Q7UA 1Q4AA 3SS0A 2VVIA 4XOVA 1CV7A 4P76A 1YZWA 4HQ8A 3SVDA 5HBDA 3LA1A 3E5TA 5EXCI 4LJDC 3WLCA 1C4FA 1EMLA 4ZBLA 3UFZA 2O29A 2ZO7A 5DU0A 3E5WA 2HQKA 4HQCA 3ST0A 2AHAA 2QLIA 2Q6PA 4DXOA 1EMBA 1QY3A 4RTCA 5KTGA 3A8SA 2H5RA 1XQMA 1YFPA 2DDCA 5J2OA 3EKHA 4LJDA 3SSVA 2WSNA 3WLDA 3EK8A 2QLGA 3H1OA 2QLGB 5DY6A 4HVFA 2HCGA 1YHGA 2YFPA 5EB6A 4KW8A 2HFCA 3KCTA 5LTQA 5AQBB 2FL1A 2HGDA 3DPWA 3LF4B 1Q4DA 3DQ1A 2DUGA 2IOVA 5DTZA 5H87A 3PJ5A 3LF3A 1KP5A 3DQMA 4PFEA 3SSKA 2DD9A 2EMOA 4KEXA 4W6IA 5EHUA 2WHTA 4P1QA 4W6PA
chains in the Genus database with same CATH superfamily
5H88A 4KF4A 4Q7RA 4Z4KA 4W6NA 5DQMA 3G9AA 3EVVA 1KYRA 1Q4BA 3V3DA 5EBJA 4W7FA 3OSQA 3U0KA 3GEXA 1ZGOA 2H6VA 1XA9A 2DUIA 1YJFA 4ZFSA 4DXIA 1XMZA 2WHUA 3U8CA 3GL4A 2QLEA 2Y0GA 4ZF5A 4L13A 2JADA 3ZUJA 3SVCA 4W7EA 4W6OA 4W7DA 4KPIA 2A53B 4W6UA 5LTPA 4H3NA 5EJUA 1YJ2A 3IP2A 2O24A 1XAEA 2Z6ZA 4EULA 1HCJA 4W6DA 4W6MA 1EMAA 1H6RA 4DKMA 2IB6A 3DQHA 3DQ4A 4Q7TA 3DQNA 1KYPA 5HZTA 2DDDA 3NT3A 3RWTA 1MYWA 2ICRA 3PIBA 4OJ0A 2ZMUA 3SVOA 2G3OA 3GB3A 4XGYA 4W6TA 3U8AA 2OTBA 4U2VA 3EK4A 3SSHA 5FVFA 1EMGA 4LJCA 1GGXA 3M24A 3PJ7A 1RMOA 4DXMA 5BQLA 3DQUA 3AI5A 3DPXA 4AR7A 3U0LA 3MGFA 2A47A 3LVCA 1Q4CA 4W69A 3U8PA 2G6XA 4LJBA 4LQTA 5DTXA 4L1IA 4N3DA 1W7TA 4BDUA 1Z1QA 3CD1A 4EDOA 3CBEA 3ZTFA 4ZINA 1OXDA 2VVHA 2OJKA 3DQ5A 2HJOA 4H47A 2HGYA 3U0NA 3DQ3A 2QU1A 5EB7A 2PXWA 4W6JA 2A54B 2FZUA 3SVBA 3BX9A 1H4UA 2G3DB 3E5VA 2AH8A 3GJ2A 1YHHA 3OSRA 2VAEA 4IK4A 1W7SA 2HQZA 5FVGA 5BT0A 2WISA 4GESB 5EXBA 1MOVA 3DQCA 3ED8A 4ZIOA 4GOBA 1ZUXA 3KCSA 5HGEA 4JEOA 3SSTA 1JBYA 4L12A 2QZ0A 3SG6A 3LSAA 4XL5A 2Z1OA 1GL4A 4JFGA 3CFFA 4RYSA 2ZO6A 4W6FA 3K1KA 2EMDA 2OTEA 3S05A 2G5ZB 4NWSA 4Z4MA 4W6GA 3SVEA 2Q57A 2AWKA 3SSYA 2G6YA 5F9GA 5DTYA 1EMEA 2EMNA 4XOWA 4W7AA 2BTJA 5DPGA 3ST2A 2GX0A 3BXAA 1OXFA 2PXSA 1GFLA 2Z6YA 2Z6XA 4ZB1A 3DQ8A 2WSOA 3P8UA 3LS3A 4OHSA 4H48A 1QYFA 1MOUA 4XVPA 3SVUA 2YDZA 4ZF4A 2OKWA 4W7XA 1RMMA 2DUFA 3CFHA 3W1DA 5FHVA 2B3QA 1JBZA 2FWQA 1ZGQA 4KF5C 4HQ9A 3TMRA 4KGEA 4TZGA 2A46A 3BXBA 3DPZA 3EKJA 5BTTA 2A50B 4H3MA 1W7UA 3NT9A 2YE1A 3SSPA 5HZUA 3AKOA 3VK1A 5HW9A 4HE4A 3NEDA 3CGLA 4RYWA 2HPWA 4KF5A 4OY4A 4R6DA 2GW3A 2VVJA 3RWAA 4TZAA 4W6HA 3PJBA 4J8AA 4LQUA 2C9IA 3H1RA 5LK4A 1JC1A 3TMTA 5DQBA 3NF0A 1G7KA 3IR8A 1QYOA 4ANJA 2OKYA 2VZXA 3CB9A 4JRBA 5LTRA 2G16B 1S6ZA 2C9JA 4Q9WA 4DXQA 3DQEA 4KA9A 3SV5A 4W77A 4JC2A 2WIQA 4W73A 2DD7A 1EMMA 3VHTA 3VHTB 3EVPA 2H9WA 3UG0A 3EVRA 3O78A 2A48A 4W6BA 2QRFA 5DRFA 5H89A 4OQWA 1ZGPA 2A56B 4DXPA 2QT2A 3GJ1A 4Q9XA 2OGRA 3SRYA 1KYSA 3SG4A 5EXUA 3LVDA 3SVSA 3SG3A 4W6KA 1QXTA 4EN1A 2AWJA 4LW5A 1JC0A 4JGEA 2O2BA 4W75A 4W6SA 4EDSA 2ARLA 4GF6B 3P28A 3CD9A 4DKNA 4PPLA 2H5QA 3ST3A 4KW4A 1F0BA 3BXCA 1YHIA 3DQFA 5DTLA 2H5PA 2WHSA 2RH7A 4H3LA 4IK9A 2G6EA 3EK7A 5DRGA 2P4MA 2G2SB 2WURA 2A52B 3DQJA 4W6AA 4EMQA 5HZOA 4W6CA 1Q4EA 3SSLA 4J89A 1XSSA 4IK5A 4PPJA 5DPIA 3I19A 2AWMA 3M22A 2QLHA 4W72A 3EVUA 5DPHA 3DQLA 4IK3A 2VADA 1EMCA 3ADFA 4W6LA 3DQ2A 4W76A 1HUYA 4B5YA 4DXNA 4UTSA 4J88A 2B3PA 1UISA 1EMKA 2DUHA 4B30A 3DQAA 1F09A 1RRXA 3O77A 4B30B 4R6BA 1BFPA 4ZF3A 3DQOA 4I2YA 3DQ6A 3DQ9A 4KW9A 5HZSA 2YE0A 4IZNA 3ZULA 1Q73A 2H5OA 2V4EC 3DQIA 5BTTB 4KAGA 4W6RA 3VICA 3OGOA 3ST4A 2HRSA 1QYQA 5FVIA 1OXEA 3WCKA 2GW4B 3ZUFA 3SVNA 4ORNA 3SG2A 3SVRA 3NEZA 2AWLA 3DQDA 3CFAA 3U0MA 3AI4A 4IK8A 1B9CA 4AS8A 1RMPA 4KGFA 4JF9A 2DUEA 2POXA 2GX2A 2V4EA 3DQ7A 4W7RA 2V4EB 1Z1PA 2ZMWA 4W74A 5DPJA 3LVAA 3SG7A 3DQKA 1EMFA 2H8QA 4W7CA 3W1CA 2IE2A 2IB5A 4IK1A 4PPKA 5T3IA 4OGSA 1RM9A 3SG5A 4Q7UA 1Q4AA 3SS0A 2VVIA 4XOVA 1CV7A 4P76A 1YZWA 4HQ8A 3SVDA 5HBDA 3LA1A 3E5TA 5EXCI 4LJDC 3WLCA 1C4FA 1EMLA 4ZBLA 3UFZA 2O29A 2ZO7A 5DU0A 3E5WA 2HQKA 4HQCA 3ST0A 2AHAA 2QLIA 2Q6PA 4DXOA 1EMBA 1QY3A 4RTCA 5KTGA 3A8SA 2H5RA 1XQMA 1YFPA 2DDCA 5J2OA 3EKHA 4LJDA 3SSVA 2WSNA 3WLDA 3EK8A 2QLGA 3H1OA 2QLGB 5DY6A 4HVFA 2HCGA 1YHGA 2YFPA 5EB6A 4KW8A 2HFCA 3KCTA 5LTQA 5AQBB 2FL1A 2HGDA 3DPWA 3LF4B 1Q4DA 3DQ1A 2DUGA 2IOVA 5DTZA 5H87A 3PJ5A 3LF3A 1KP5A 3DQMA 4PFEA 3SSKA 2DD9A 2EMOA 4KEXA 4W6IA 5EHUA 2WHTA 4P1QA 4W6PA
chains in the Genus database with same CATH topology
5H88A 4KF4A 4Q7RA 4Z4KA 4W6NA 5DQMA 3G9AA 3EVVA 1KYRA 1Q4BA 3V3DA 5EBJA 4W7FA 3OSQA 3U0KA 3GEXA 1ZGOA 2H6VA 1XA9A 2DUIA 1YJFA 4ZFSA 4DXIA 1XMZA 2WHUA 3U8CA 3GL4A 2QLEA 2Y0GA 4ZF5A 4L13A 2JADA 3ZUJA 3SVCA 4W7EA 4W6OA 4W7DA 4KPIA 2A53B 4W6UA 5LTPA 4H3NA 5EJUA 1YJ2A 3IP2A 2O24A 1XAEA 2Z6ZA 4EULA 1HCJA 4W6DA 4W6MA 1EMAA 1H6RA 4DKMA 2IB6A 3DQHA 3DQ4A 4Q7TA 3DQNA 1KYPA 5HZTA 2DDDA 3NT3A 3RWTA 1MYWA 2ICRA 3PIBA 4OJ0A 2ZMUA 3SVOA 2G3OA 3GB3A 4XGYA 4W6TA 3U8AA 2OTBA 4U2VA 3EK4A 3SSHA 5FVFA 1EMGA 4LJCA 1GGXA 3M24A 3PJ7A 1RMOA 4DXMA 5BQLA 3DQUA 3AI5A 3DPXA 4AR7A 3U0LA 3MGFA 2A47A 3LVCA 1Q4CA 4W69A 3U8PA 2G6XA 4LJBA 4LQTA 5DTXA 4L1IA 4N3DA 1W7TA 4BDUA 1Z1QA 3CD1A 4EDOA 3CBEA 3ZTFA 4ZINA 1OXDA 2VVHA 2OJKA 3DQ5A 2HJOA 4H47A 2HGYA 3U0NA 3DQ3A 2QU1A 5EB7A 2PXWA 4W6JA 2A54B 2FZUA 3SVBA 3BX9A 1H4UA 2G3DB 3E5VA 2AH8A 3GJ2A 1YHHA 3OSRA 2VAEA 4IK4A 1W7SA 2HQZA 5FVGA 5BT0A 2WISA 4GESB 5EXBA 1MOVA 3DQCA 3ED8A 4ZIOA 4GOBA 1ZUXA 3KCSA 5HGEA 4JEOA 3SSTA 1JBYA 4L12A 2QZ0A 3SG6A 3LSAA 4XL5A 2Z1OA 1GL4A 4JFGA 3CFFA 4RYSA 2ZO6A 4W6FA 3K1KA 2EMDA 2OTEA 3S05A 2G5ZB 4NWSA 4Z4MA 4W6GA 3SVEA 2Q57A 2AWKA 3SSYA 2G6YA 5F9GA 5DTYA 1EMEA 2EMNA 4XOWA 4W7AA 2BTJA 5DPGA 3ST2A 2GX0A 3BXAA 1OXFA 2PXSA 1GFLA 2Z6YA 2Z6XA 4ZB1A 3DQ8A 2WSOA 3P8UA 3LS3A 4OHSA 4H48A 1QYFA 1MOUA 4XVPA 3SVUA 2YDZA 4ZF4A 2OKWA 4W7XA 1RMMA 2DUFA 3CFHA 3W1DA 5FHVA 2B3QA 1JBZA 2FWQA 1ZGQA 4KF5C 4HQ9A 3TMRA 4KGEA 4TZGA 2A46A 3BXBA 3DPZA 3EKJA 5BTTA 2A50B 4H3MA 1W7UA 3NT9A 2YE1A 3SSPA 5HZUA 3AKOA 3VK1A 5HW9A 4HE4A 3NEDA 3CGLA 4RYWA 2HPWA 4KF5A 4OY4A 4R6DA 2GW3A 2VVJA 3RWAA 4TZAA 4W6HA 3PJBA 4J8AA 4LQUA 2C9IA 3H1RA 5LK4A 1JC1A 3TMTA 5DQBA 3NF0A 1G7KA 3IR8A 1QYOA 4ANJA 2OKYA 2VZXA 3CB9A 4JRBA 5LTRA 2G16B 1S6ZA 2C9JA 4Q9WA 4DXQA 3DQEA 4KA9A 3SV5A 4W77A 4JC2A 2WIQA 4W73A 2DD7A 1EMMA 3VHTA 3VHTB 3EVPA 2H9WA 3UG0A 3EVRA 3O78A 2A48A 4W6BA 2QRFA 5DRFA 5H89A 4OQWA 1ZGPA 2A56B 4DXPA 2QT2A 3GJ1A 4Q9XA 2OGRA 3SRYA 1KYSA 3SG4A 5EXUA 3LVDA 3SVSA 3SG3A 4W6KA 1QXTA 4EN1A 2AWJA 4LW5A 1JC0A 4JGEA 2O2BA 4W75A 4W6SA 4EDSA 2ARLA 4GF6B 3P28A 3CD9A 4DKNA 4PPLA 2H5QA 3ST3A 4KW4A 1F0BA 3BXCA 1YHIA 3DQFA 5DTLA 2H5PA 2WHSA 2RH7A 4H3LA 4IK9A 2G6EA 3EK7A 5DRGA 2P4MA 2G2SB 2WURA 2A52B 3DQJA 4W6AA 4EMQA 5HZOA 4W6CA 1Q4EA 3SSLA 4J89A 1XSSA 4IK5A 4PPJA 5DPIA 3I19A 2AWMA 3M22A 2QLHA 4W72A 3EVUA 5DPHA 3DQLA 4IK3A 2VADA 1EMCA 3ADFA 4W6LA 3DQ2A 4W76A 1HUYA 4B5YA 4DXNA 4UTSA 4J88A 2B3PA 1UISA 1EMKA 2DUHA 4B30A 3DQAA 1F09A 1RRXA 3O77A 4B30B 4R6BA 1BFPA 4ZF3A 3DQOA 4I2YA 3DQ6A 3DQ9A 4KW9A 5HZSA 2YE0A 4IZNA 3ZULA 1Q73A 2H5OA 2V4EC 3DQIA 5BTTB 4KAGA 4W6RA 3VICA 3OGOA 3ST4A 2HRSA 1QYQA 5FVIA 1OXEA 3WCKA 2GW4B 3ZUFA 3SVNA 4ORNA 3SG2A 3SVRA 3NEZA 2AWLA 3DQDA 3CFAA 3U0MA 3AI4A 4IK8A 1B9CA 4AS8A 1RMPA 4KGFA 4JF9A 2DUEA 2POXA 2GX2A 2V4EA 3DQ7A 4W7RA 2V4EB 1Z1PA 2ZMWA 4W74A 5DPJA 3LVAA 3SG7A 3DQKA 1EMFA 2H8QA 4W7CA 3W1CA 2IE2A 2IB5A 4IK1A 4PPKA 5T3IA 4OGSA 1RM9A 3SG5A 4Q7UA 1Q4AA 3SS0A 2VVIA 4XOVA 1CV7A 4P76A 1YZWA 4HQ8A 3SVDA 5HBDA 3LA1A 3E5TA 5EXCI 4LJDC 3WLCA 1C4FA 1EMLA 4ZBLA 3UFZA 2O29A 2ZO7A 5DU0A 3E5WA 2HQKA 4HQCA 3ST0A 2AHAA 2QLIA 2Q6PA 4DXOA 1EMBA 1QY3A 4RTCA 5KTGA 3A8SA 2H5RA 1XQMA 1YFPA 2DDCA 5J2OA 3EKHA 4LJDA 3SSVA 2WSNA 3WLDA 3EK8A 2QLGA 3H1OA 2QLGB 5DY6A 4HVFA 2HCGA 1YHGA 2YFPA 5EB6A 4KW8A 2HFCA 3KCTA 5LTQA 5AQBB 2FL1A 2HGDA 3DPWA 3LF4B 1Q4DA 3DQ1A 2DUGA 2IOVA 5DTZA 5H87A 3PJ5A 3LF3A 1KP5A 3DQMA 4PFEA 3SSKA 2DD9A 2EMOA 4KEXA 4W6IA 5EHUA 2WHTA 4P1QA 4W6PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H88 A;  4KF4 A;  4Q7R A;  4Z4K A;  4W6N A;  5DQM A;  3G9A A;  3EVV A;  1KYR A;  1Q4B A;  3V3D A;  5EBJ A;  4W7F A;  3OSQ A;  3U0K A;  3GEX A;  1ZGO A;  2H6V A;  1XA9 A;  2DUI A;  1YJF A;  4ZFS A;  4DXI A;  1XMZ A;  2WHU A;  3U8C A;  3GL4 A;  2QLE A;  2Y0G A;  4ZF5 A;  4L13 A;  2JAD A;  3ZUJ A;  3SVC A;  4W7E A;  4W6O A;  4W7D A;  4KPI A;  2A53 B;  4W6U A;  5LTP A;  4H3N A;  5EJU A;  1YJ2 A;  3IP2 A;  2O24 A;  1XAE A;  2Z6Z A;  4EUL A;  1HCJ A;  4W6D A;  4W6M A;  1EMA A;  1H6R A;  4DKM A;  2IB6 A;  3DQH A;  3DQ4 A;  4Q7T A;  3DQN A;  1KYP A;  5HZT A;  2DDD A;  3NT3 A;  3RWT A;  1MYW A;  2ICR A;  3PIB A;  4OJ0 A;  2ZMU A;  3SVO A;  2G3O A;  3GB3 A;  4XGY A;  4W6T A;  3U8A A;  2OTB A;  4U2V A;  3EK4 A;  3SSH A;  5FVF A;  1EMG A;  4LJC A;  1GGX A;  3M24 A;  3PJ7 A;  1RMO A;  4DXM A;  5BQL A;  3DQU A;  3AI5 A;  3DPX A;  4AR7 A;  3U0L A;  3MGF A;  2A47 A;  3LVC A;  1Q4C A;  4W69 A;  3U8P A;  2G6X A;  4LJB A;  4LQT A;  5DTX A;  4L1I A;  4N3D A;  1W7T A;  4BDU A;  1Z1Q A;  3CD1 A;  4EDO A;  3CBE A;  3ZTF A;  4ZIN A;  1OXD A;  2VVH A;  2OJK A;  3DQ5 A;  2HJO A;  4H47 A;  2HGY A;  3U0N A;  3DQ3 A;  2QU1 A;  5EB7 A;  2PXW A;  4W6J A;  2A54 B;  2FZU A;  3SVB A;  3BX9 A;  1H4U A;  2G3D B;  3E5V A;  2AH8 A;  3GJ2 A;  1YHH A;  3OSR A;  2VAE A;  4IK4 A;  1W7S A;  2HQZ A;  5FVG A;  5BT0 A;  2WIS A;  4GES B;  5EXB A;  1MOV A;  3DQC A;  3ED8 A;  4ZIO A;  4GOB A;  1ZUX A;  3KCS A;  5HGE A;  4JEO A;  3SST A;  1JBY A;  4L12 A;  2QZ0 A;  3SG6 A;  3LSA A;  4XL5 A;  2Z1O A;  1GL4 A;  4JFG A;  3CFF A;  4RYS A;  2ZO6 A;  4W6F A;  3K1K A;  2EMD A;  2OTE A;  3S05 A;  2G5Z B;  4NWS A;  4Z4M A;  4W6G A;  3SVE A;  2Q57 A;  2AWK A;  3SSY A;  2G6Y A;  5F9G A;  5DTY A;  1EME A;  2EMN A;  4XOW A;  4W7A A;  2BTJ A;  5DPG A;  3ST2 A;  2GX0 A;  3BXA A;  1OXF A;  2PXS A;  1GFL A;  2Z6Y A;  2Z6X A;  4ZB1 A;  3DQ8 A;  2WSO A;  3P8U A;  3LS3 A;  4OHS A;  4H48 A;  1QYF A;  1MOU A;  4XVP A;  3SVU A;  2YDZ A;  4ZF4 A;  2OKW A;  4W7X A;  1RMM A;  2DUF A;  3CFH A;  3W1D A;  5FHV A;  2B3Q A;  1JBZ A;  2FWQ A;  1ZGQ A;  4KF5 C;  4HQ9 A;  3TMR A;  4KGE A;  4TZG A;  2A46 A;  3BXB A;  3DPZ A;  3EKJ A;  5BTT A;  2A50 B;  4H3M A;  1W7U A;  3NT9 A;  2YE1 A;  3SSP A;  5HZU A;  3AKO A;  3VK1 A;  5HW9 A;  4HE4 A;  3NED A;  3CGL A;  4RYW A;  2HPW A;  4KF5 A;  4OY4 A;  4R6D A;  2GW3 A;  2VVJ A;  3RWA A;  4TZA A;  4W6H A;  3PJB A;  4J8A A;  4LQU A;  2C9I A;  3H1R A;  5LK4 A;  1JC1 A;  3TMT A;  5DQB A;  3NF0 A;  1G7K A;  3IR8 A;  1QYO A;  4ANJ A;  2OKY A;  2VZX A;  3CB9 A;  4JRB A;  5LTR A;  2G16 B;  1S6Z A;  2C9J A;  4Q9W A;  4DXQ A;  3DQE A;  4KA9 A;  3SV5 A;  4W77 A;  4JC2 A;  2WIQ A;  4W73 A;  2DD7 A;  1EMM A;  3VHT A;  3VHT B;  3EVP A;  2H9W A;  3UG0 A;  3EVR A;  3O78 A;  2A48 A;  4W6B A;  2QRF A;  5DRF A;  5H89 A;  4OQW A;  1ZGP A;  2A56 B;  4DXP A;  2QT2 A;  3GJ1 A;  4Q9X A;  2OGR A;  3SRY A;  1KYS A;  3SG4 A;  5EXU A;  3LVD A;  3SVS A;  3SG3 A;  4W6K A;  1QXT A;  4EN1 A;  2AWJ A;  4LW5 A;  1JC0 A;  4JGE A;  2O2B A;  4W75 A;  4W6S A;  4EDS A;  2ARL A;  4GF6 B;  3P28 A;  3CD9 A;  4DKN A;  4PPL A;  2H5Q A;  3ST3 A;  4KW4 A;  1F0B A;  3BXC A;  1YHI A;  3DQF A;  5DTL A;  2H5P A;  2WHS A;  2RH7 A;  4H3L A;  4IK9 A;  2G6E A;  3EK7 A;  5DRG A;  2P4M A;  2G2S B;  2WUR A;  2A52 B;  3DQJ A;  4W6A A;  4EMQ A;  5HZO A;  4W6C A;  1Q4E A;  3SSL A;  4J89 A;  1XSS A;  4IK5 A;  4PPJ A;  5DPI A;  3I19 A;  2AWM A;  3M22 A;  2QLH A;  4W72 A;  3EVU A;  5DPH A;  3DQL A;  4IK3 A;  2VAD A;  1EMC A;  3ADF A;  4W6L A;  3DQ2 A;  4W76 A;  1HUY A;  4B5Y A;  4DXN A;  4UTS A;  4J88 A;  2B3P A;  1UIS A;  1EMK A;  2DUH A;  4B30 A;  3DQA A;  1F09 A;  1RRX A;  3O77 A;  4B30 B;  4R6B A;  1BFP A;  4ZF3 A;  3DQO A;  4I2Y A;  3DQ6 A;  3DQ9 A;  4KW9 A;  5HZS A;  2YE0 A;  4IZN A;  3ZUL A;  1Q73 A;  2H5O A;  2V4E C;  3DQI A;  5BTT B;  4KAG A;  4W6R A;  3VIC A;  3OGO A;  3ST4 A;  2HRS A;  1QYQ A;  5FVI A;  1OXE A;  3WCK A;  2GW4 B;  3ZUF A;  3SVN A;  4ORN A;  3SG2 A;  3SVR A;  3NEZ A;  2AWL A;  3DQD A;  3CFA A;  3U0M A;  3AI4 A;  4IK8 A;  1B9C A;  4AS8 A;  1RMP A;  4KGF A;  4JF9 A;  2DUE A;  2POX A;  2GX2 A;  2V4E A;  3DQ7 A;  4W7R A;  2V4E B;  1Z1P A;  2ZMW A;  4W74 A;  5DPJ A;  3LVA A;  3SG7 A;  3DQK A;  1EMF A;  2H8Q A;  4W7C A;  3W1C A;  2IE2 A;  2IB5 A;  4IK1 A;  4PPK A;  5T3I A;  4OGS A;  1RM9 A;  3SG5 A;  4Q7U A;  1Q4A A;  3SS0 A;  2VVI A;  4XOV A;  1CV7 A;  4P76 A;  1YZW A;  4HQ8 A;  3SVD A;  5HBD A;  3LA1 A;  3E5T A;  5EXC I;  4LJD C;  3WLC A;  1C4F A;  1EML A;  4ZBL A;  3UFZ A;  2O29 A;  2ZO7 A;  5DU0 A;  3E5W A;  2HQK A;  4HQC A;  3ST0 A;  2AHA A;  2QLI A;  2Q6P A;  4DXO A;  1EMB A;  1QY3 A;  4RTC A;  5KTG A;  3A8S A;  2H5R A;  1XQM A;  1YFP A;  2DDC A;  5J2O A;  3EKH A;  4LJD A;  3SSV A;  2WSN A;  3WLD A;  3EK8 A;  2QLG A;  3H1O A;  2QLG B;  5DY6 A;  4HVF A;  2HCG A;  1YHG A;  2YFP A;  5EB6 A;  4KW8 A;  2HFC A;  3KCT A;  5LTQ A;  5AQB B;  2FL1 A;  2HGD A;  3DPW A;  3LF4 B;  1Q4D A;  3DQ1 A;  2DUG A;  2IOV A;  5DTZ A;  5H87 A;  3PJ5 A;  3LF3 A;  1KP5 A;  3DQM A;  4PFE A;  3SSK A;  2DD9 A;  2EMO A;  4KEX A;  4W6I A;  5EHU A;  2WHT A;  4P1Q A;  4W6P A; 
#chains in the Genus database with same CATH topology
 5H88 A;  4KF4 A;  4Q7R A;  4Z4K A;  4W6N A;  5DQM A;  3G9A A;  3EVV A;  1KYR A;  1Q4B A;  3V3D A;  5EBJ A;  4W7F A;  3OSQ A;  3U0K A;  3GEX A;  1ZGO A;  2H6V A;  1XA9 A;  2DUI A;  1YJF A;  4ZFS A;  4DXI A;  1XMZ A;  2WHU A;  3U8C A;  3GL4 A;  2QLE A;  2Y0G A;  4ZF5 A;  4L13 A;  2JAD A;  3ZUJ A;  3SVC A;  4W7E A;  4W6O A;  4W7D A;  4KPI A;  2A53 B;  4W6U A;  5LTP A;  4H3N A;  5EJU A;  1YJ2 A;  3IP2 A;  2O24 A;  1XAE A;  2Z6Z A;  4EUL A;  1HCJ A;  4W6D A;  4W6M A;  1EMA A;  1H6R A;  4DKM A;  2IB6 A;  3DQH A;  3DQ4 A;  4Q7T A;  3DQN A;  1KYP A;  5HZT A;  2DDD A;  3NT3 A;  3RWT A;  1MYW A;  2ICR A;  3PIB A;  4OJ0 A;  2ZMU A;  3SVO A;  2G3O A;  3GB3 A;  4XGY A;  4W6T A;  3U8A A;  2OTB A;  4U2V A;  3EK4 A;  3SSH A;  5FVF A;  1EMG A;  4LJC A;  1GGX A;  3M24 A;  3PJ7 A;  1RMO A;  4DXM A;  5BQL A;  3DQU A;  3AI5 A;  3DPX A;  4AR7 A;  3U0L A;  3MGF A;  2A47 A;  3LVC A;  1Q4C A;  4W69 A;  3U8P A;  2G6X A;  4LJB A;  4LQT A;  5DTX A;  4L1I A;  4N3D A;  1W7T A;  4BDU A;  1Z1Q A;  3CD1 A;  4EDO A;  3CBE A;  3ZTF A;  4ZIN A;  1OXD A;  2VVH A;  2OJK A;  3DQ5 A;  2HJO A;  4H47 A;  2HGY A;  3U0N A;  3DQ3 A;  2QU1 A;  5EB7 A;  2PXW A;  4W6J A;  2A54 B;  2FZU A;  3SVB A;  3BX9 A;  1H4U A;  2G3D B;  3E5V A;  2AH8 A;  3GJ2 A;  1YHH A;  3OSR A;  2VAE A;  4IK4 A;  1W7S A;  2HQZ A;  5FVG A;  5BT0 A;  2WIS A;  4GES B;  5EXB A;  1MOV A;  3DQC A;  3ED8 A;  4ZIO A;  4GOB A;  1ZUX A;  3KCS A;  5HGE A;  4JEO A;  3SST A;  1JBY A;  4L12 A;  2QZ0 A;  3SG6 A;  3LSA A;  4XL5 A;  2Z1O A;  1GL4 A;  4JFG A;  3CFF A;  4RYS A;  2ZO6 A;  4W6F A;  3K1K A;  2EMD A;  2OTE A;  3S05 A;  2G5Z B;  4NWS A;  4Z4M A;  4W6G A;  3SVE A;  2Q57 A;  2AWK A;  3SSY A;  2G6Y A;  5F9G A;  5DTY A;  1EME A;  2EMN A;  4XOW A;  4W7A A;  2BTJ A;  5DPG A;  3ST2 A;  2GX0 A;  3BXA A;  1OXF A;  2PXS A;  1GFL A;  2Z6Y A;  2Z6X A;  4ZB1 A;  3DQ8 A;  2WSO A;  3P8U A;  3LS3 A;  4OHS A;  4H48 A;  1QYF A;  1MOU A;  4XVP A;  3SVU A;  2YDZ A;  4ZF4 A;  2OKW A;  4W7X A;  1RMM A;  2DUF A;  3CFH A;  3W1D A;  5FHV A;  2B3Q A;  1JBZ A;  2FWQ A;  1ZGQ A;  4KF5 C;  4HQ9 A;  3TMR A;  4KGE A;  4TZG A;  2A46 A;  3BXB A;  3DPZ A;  3EKJ A;  5BTT A;  2A50 B;  4H3M A;  1W7U A;  3NT9 A;  2YE1 A;  3SSP A;  5HZU A;  3AKO A;  3VK1 A;  5HW9 A;  4HE4 A;  3NED A;  3CGL A;  4RYW A;  2HPW A;  4KF5 A;  4OY4 A;  4R6D A;  2GW3 A;  2VVJ A;  3RWA A;  4TZA A;  4W6H A;  3PJB A;  4J8A A;  4LQU A;  2C9I A;  3H1R A;  5LK4 A;  1JC1 A;  3TMT A;  5DQB A;  3NF0 A;  1G7K A;  3IR8 A;  1QYO A;  4ANJ A;  2OKY A;  2VZX A;  3CB9 A;  4JRB A;  5LTR A;  2G16 B;  1S6Z A;  2C9J A;  4Q9W A;  4DXQ A;  3DQE A;  4KA9 A;  3SV5 A;  4W77 A;  4JC2 A;  2WIQ A;  4W73 A;  2DD7 A;  1EMM A;  3VHT A;  3VHT B;  3EVP A;  2H9W A;  3UG0 A;  3EVR A;  3O78 A;  2A48 A;  4W6B A;  2QRF A;  5DRF A;  5H89 A;  4OQW A;  1ZGP A;  2A56 B;  4DXP A;  2QT2 A;  3GJ1 A;  4Q9X A;  2OGR A;  3SRY A;  1KYS A;  3SG4 A;  5EXU A;  3LVD A;  3SVS A;  3SG3 A;  4W6K A;  1QXT A;  4EN1 A;  2AWJ A;  4LW5 A;  1JC0 A;  4JGE A;  2O2B A;  4W75 A;  4W6S A;  4EDS A;  2ARL A;  4GF6 B;  3P28 A;  3CD9 A;  4DKN A;  4PPL A;  2H5Q A;  3ST3 A;  4KW4 A;  1F0B A;  3BXC A;  1YHI A;  3DQF A;  5DTL A;  2H5P A;  2WHS A;  2RH7 A;  4H3L A;  4IK9 A;  2G6E A;  3EK7 A;  5DRG A;  2P4M A;  2G2S B;  2WUR A;  2A52 B;  3DQJ A;  4W6A A;  4EMQ A;  5HZO A;  4W6C A;  1Q4E A;  3SSL A;  4J89 A;  1XSS A;  4IK5 A;  4PPJ A;  5DPI A;  3I19 A;  2AWM A;  3M22 A;  2QLH A;  4W72 A;  3EVU A;  5DPH A;  3DQL A;  4IK3 A;  2VAD A;  1EMC A;  3ADF A;  4W6L A;  3DQ2 A;  4W76 A;  1HUY A;  4B5Y A;  4DXN A;  4UTS A;  4J88 A;  2B3P A;  1UIS A;  1EMK A;  2DUH A;  4B30 A;  3DQA A;  1F09 A;  1RRX A;  3O77 A;  4B30 B;  4R6B A;  1BFP A;  4ZF3 A;  3DQO A;  4I2Y A;  3DQ6 A;  3DQ9 A;  4KW9 A;  5HZS A;  2YE0 A;  4IZN A;  3ZUL A;  1Q73 A;  2H5O A;  2V4E C;  3DQI A;  5BTT B;  4KAG A;  4W6R A;  3VIC A;  3OGO A;  3ST4 A;  2HRS A;  1QYQ A;  5FVI A;  1OXE A;  3WCK A;  2GW4 B;  3ZUF A;  3SVN A;  4ORN A;  3SG2 A;  3SVR A;  3NEZ A;  2AWL A;  3DQD A;  3CFA A;  3U0M A;  3AI4 A;  4IK8 A;  1B9C A;  4AS8 A;  1RMP A;  4KGF A;  4JF9 A;  2DUE A;  2POX A;  2GX2 A;  2V4E A;  3DQ7 A;  4W7R A;  2V4E B;  1Z1P A;  2ZMW A;  4W74 A;  5DPJ A;  3LVA A;  3SG7 A;  3DQK A;  1EMF A;  2H8Q A;  4W7C A;  3W1C A;  2IE2 A;  2IB5 A;  4IK1 A;  4PPK A;  5T3I A;  4OGS A;  1RM9 A;  3SG5 A;  4Q7U A;  1Q4A A;  3SS0 A;  2VVI A;  4XOV A;  1CV7 A;  4P76 A;  1YZW A;  4HQ8 A;  3SVD A;  5HBD A;  3LA1 A;  3E5T A;  5EXC I;  4LJD C;  3WLC A;  1C4F A;  1EML A;  4ZBL A;  3UFZ A;  2O29 A;  2ZO7 A;  5DU0 A;  3E5W A;  2HQK A;  4HQC A;  3ST0 A;  2AHA A;  2QLI A;  2Q6P A;  4DXO A;  1EMB A;  1QY3 A;  4RTC A;  5KTG A;  3A8S A;  2H5R A;  1XQM A;  1YFP A;  2DDC A;  5J2O A;  3EKH A;  4LJD A;  3SSV A;  2WSN A;  3WLD A;  3EK8 A;  2QLG A;  3H1O A;  2QLG B;  5DY6 A;  4HVF A;  2HCG A;  1YHG A;  2YFP A;  5EB6 A;  4KW8 A;  2HFC A;  3KCT A;  5LTQ A;  5AQB B;  2FL1 A;  2HGD A;  3DPW A;  3LF4 B;  1Q4D A;  3DQ1 A;  2DUG A;  2IOV A;  5DTZ A;  5H87 A;  3PJ5 A;  3LF3 A;  1KP5 A;  3DQM A;  4PFE A;  3SSK A;  2DD9 A;  2EMO A;  4KEX A;  4W6I A;  5EHU A;  2WHT A;  4P1Q A;  4W6P A; 
#chains in the Genus database with same CATH homology
 5H88 A;  4KF4 A;  4Q7R A;  4Z4K A;  4W6N A;  5DQM A;  3G9A A;  3EVV A;  1KYR A;  1Q4B A;  3V3D A;  5EBJ A;  4W7F A;  3OSQ A;  3U0K A;  3GEX A;  1ZGO A;  2H6V A;  1XA9 A;  2DUI A;  1YJF A;  4ZFS A;  4DXI A;  1XMZ A;  2WHU A;  3U8C A;  3GL4 A;  2QLE A;  2Y0G A;  4ZF5 A;  4L13 A;  2JAD A;  3ZUJ A;  3SVC A;  4W7E A;  4W6O A;  4W7D A;  4KPI A;  2A53 B;  4W6U A;  5LTP A;  4H3N A;  5EJU A;  1YJ2 A;  3IP2 A;  2O24 A;  1XAE A;  2Z6Z A;  4EUL A;  1HCJ A;  4W6D A;  4W6M A;  1EMA A;  1H6R A;  4DKM A;  2IB6 A;  3DQH A;  3DQ4 A;  4Q7T A;  3DQN A;  1KYP A;  5HZT A;  2DDD A;  3NT3 A;  3RWT A;  1MYW A;  2ICR A;  3PIB A;  4OJ0 A;  2ZMU A;  3SVO A;  2G3O A;  3GB3 A;  4XGY A;  4W6T A;  3U8A A;  2OTB A;  4U2V A;  3EK4 A;  3SSH A;  5FVF A;  1EMG A;  4LJC A;  1GGX A;  3M24 A;  3PJ7 A;  1RMO A;  4DXM A;  5BQL A;  3DQU A;  3AI5 A;  3DPX A;  4AR7 A;  3U0L A;  3MGF A;  2A47 A;  3LVC A;  1Q4C A;  4W69 A;  3U8P A;  2G6X A;  4LJB A;  4LQT A;  5DTX A;  4L1I A;  4N3D A;  1W7T A;  4BDU A;  1Z1Q A;  3CD1 A;  4EDO A;  3CBE A;  3ZTF A;  4ZIN A;  1OXD A;  2VVH A;  2OJK A;  3DQ5 A;  2HJO A;  4H47 A;  2HGY A;  3U0N A;  3DQ3 A;  2QU1 A;  5EB7 A;  2PXW A;  4W6J A;  2A54 B;  2FZU A;  3SVB A;  3BX9 A;  1H4U A;  2G3D B;  3E5V A;  2AH8 A;  3GJ2 A;  1YHH A;  3OSR A;  2VAE A;  4IK4 A;  1W7S A;  2HQZ A;  5FVG A;  5BT0 A;  2WIS A;  4GES B;  5EXB A;  1MOV A;  3DQC A;  3ED8 A;  4ZIO A;  4GOB A;  1ZUX A;  3KCS A;  5HGE A;  4JEO A;  3SST A;  1JBY A;  4L12 A;  2QZ0 A;  3SG6 A;  3LSA A;  4XL5 A;  2Z1O A;  1GL4 A;  4JFG A;  3CFF A;  4RYS A;  2ZO6 A;  4W6F A;  3K1K A;  2EMD A;  2OTE A;  3S05 A;  2G5Z B;  4NWS A;  4Z4M A;  4W6G A;  3SVE A;  2Q57 A;  2AWK A;  3SSY A;  2G6Y A;  5F9G A;  5DTY A;  1EME A;  2EMN A;  4XOW A;  4W7A A;  2BTJ A;  5DPG A;  3ST2 A;  2GX0 A;  3BXA A;  1OXF A;  2PXS A;  1GFL A;  2Z6Y A;  2Z6X A;  4ZB1 A;  3DQ8 A;  2WSO A;  3P8U A;  3LS3 A;  4OHS A;  4H48 A;  1QYF A;  1MOU A;  4XVP A;  3SVU A;  2YDZ A;  4ZF4 A;  2OKW A;  4W7X A;  1RMM A;  2DUF A;  3CFH A;  3W1D A;  5FHV A;  2B3Q A;  1JBZ A;  2FWQ A;  1ZGQ A;  4KF5 C;  4HQ9 A;  3TMR A;  4KGE A;  4TZG A;  2A46 A;  3BXB A;  3DPZ A;  3EKJ A;  5BTT A;  2A50 B;  4H3M A;  1W7U A;  3NT9 A;  2YE1 A;  3SSP A;  5HZU A;  3AKO A;  3VK1 A;  5HW9 A;  4HE4 A;  3NED A;  3CGL A;  4RYW A;  2HPW A;  4KF5 A;  4OY4 A;  4R6D A;  2GW3 A;  2VVJ A;  3RWA A;  4TZA A;  4W6H A;  3PJB A;  4J8A A;  4LQU A;  2C9I A;  3H1R A;  5LK4 A;  1JC1 A;  3TMT A;  5DQB A;  3NF0 A;  1G7K A;  3IR8 A;  1QYO A;  4ANJ A;  2OKY A;  2VZX A;  3CB9 A;  4JRB A;  5LTR A;  2G16 B;  1S6Z A;  2C9J A;  4Q9W A;  4DXQ A;  3DQE A;  4KA9 A;  3SV5 A;  4W77 A;  4JC2 A;  2WIQ A;  4W73 A;  2DD7 A;  1EMM A;  3VHT A;  3VHT B;  3EVP A;  2H9W A;  3UG0 A;  3EVR A;  3O78 A;  2A48 A;  4W6B A;  2QRF A;  5DRF A;  5H89 A;  4OQW A;  1ZGP A;  2A56 B;  4DXP A;  2QT2 A;  3GJ1 A;  4Q9X A;  2OGR A;  3SRY A;  1KYS A;  3SG4 A;  5EXU A;  3LVD A;  3SVS A;  3SG3 A;  4W6K A;  1QXT A;  4EN1 A;  2AWJ A;  4LW5 A;  1JC0 A;  4JGE A;  2O2B A;  4W75 A;  4W6S A;  4EDS A;  2ARL A;  4GF6 B;  3P28 A;  3CD9 A;  4DKN A;  4PPL A;  2H5Q A;  3ST3 A;  4KW4 A;  1F0B A;  3BXC A;  1YHI A;  3DQF A;  5DTL A;  2H5P A;  2WHS A;  2RH7 A;  4H3L A;  4IK9 A;  2G6E A;  3EK7 A;  5DRG A;  2P4M A;  2G2S B;  2WUR A;  2A52 B;  3DQJ A;  4W6A A;  4EMQ A;  5HZO A;  4W6C A;  1Q4E A;  3SSL A;  4J89 A;  1XSS A;  4IK5 A;  4PPJ A;  5DPI A;  3I19 A;  2AWM A;  3M22 A;  2QLH A;  4W72 A;  3EVU A;  5DPH A;  3DQL A;  4IK3 A;  2VAD A;  1EMC A;  3ADF A;  4W6L A;  3DQ2 A;  4W76 A;  1HUY A;  4B5Y A;  4DXN A;  4UTS A;  4J88 A;  2B3P A;  1UIS A;  1EMK A;  2DUH A;  4B30 A;  3DQA A;  1F09 A;  1RRX A;  3O77 A;  4B30 B;  4R6B A;  1BFP A;  4ZF3 A;  3DQO A;  4I2Y A;  3DQ6 A;  3DQ9 A;  4KW9 A;  5HZS A;  2YE0 A;  4IZN A;  3ZUL A;  1Q73 A;  2H5O A;  2V4E C;  3DQI A;  5BTT B;  4KAG A;  4W6R A;  3VIC A;  3OGO A;  3ST4 A;  2HRS A;  1QYQ A;  5FVI A;  1OXE A;  3WCK A;  2GW4 B;  3ZUF A;  3SVN A;  4ORN A;  3SG2 A;  3SVR A;  3NEZ A;  2AWL A;  3DQD A;  3CFA A;  3U0M A;  3AI4 A;  4IK8 A;  1B9C A;  4AS8 A;  1RMP A;  4KGF A;  4JF9 A;  2DUE A;  2POX A;  2GX2 A;  2V4E A;  3DQ7 A;  4W7R A;  2V4E B;  1Z1P A;  2ZMW A;  4W74 A;  5DPJ A;  3LVA A;  3SG7 A;  3DQK A;  1EMF A;  2H8Q A;  4W7C A;  3W1C A;  2IE2 A;  2IB5 A;  4IK1 A;  4PPK A;  5T3I A;  4OGS A;  1RM9 A;  3SG5 A;  4Q7U A;  1Q4A A;  3SS0 A;  2VVI A;  4XOV A;  1CV7 A;  4P76 A;  1YZW A;  4HQ8 A;  3SVD A;  5HBD A;  3LA1 A;  3E5T A;  5EXC I;  4LJD C;  3WLC A;  1C4F A;  1EML A;  4ZBL A;  3UFZ A;  2O29 A;  2ZO7 A;  5DU0 A;  3E5W A;  2HQK A;  4HQC A;  3ST0 A;  2AHA A;  2QLI A;  2Q6P A;  4DXO A;  1EMB A;  1QY3 A;  4RTC A;  5KTG A;  3A8S A;  2H5R A;  1XQM A;  1YFP A;  2DDC A;  5J2O A;  3EKH A;  4LJD A;  3SSV A;  2WSN A;  3WLD A;  3EK8 A;  2QLG A;  3H1O A;  2QLG B;  5DY6 A;  4HVF A;  2HCG A;  1YHG A;  2YFP A;  5EB6 A;  4KW8 A;  2HFC A;  3KCT A;  5LTQ A;  5AQB B;  2FL1 A;  2HGD A;  3DPW A;  3LF4 B;  1Q4D A;  3DQ1 A;  2DUG A;  2IOV A;  5DTZ A;  5H87 A;  3PJ5 A;  3LF3 A;  1KP5 A;  3DQM A;  4PFE A;  3SSK A;  2DD9 A;  2EMO A;  4KEX A;  4W6I A;  5EHU A;  2WHT A;  4P1Q A;  4W6P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...