2PYAA

Ultra-high resolution structure of p. abyssi rubredoxin w4l/r5s/a44s
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
52
structure length
52
Chain Sequence
b'AKLSCKICGYIYDEDEGDPDNGISPGTKFEDLPDDWVCPLCGSPKSEFERIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rubredoxin
publication title Ultrahigh-resolution study on Pyrococcus abyssi rubredoxin: II. Introduction of an O-H...Sgamma-Fe hydrogen bond increased the reduction potential by 65 mV.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Electron transport
total genus 10
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2007-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2pyaA00
1YUXA 2RDVA 3PZAA 3KYUA 1LKOA 4AR6A 2M4YA 3KYWA 1BQ8A 1E8JA 1R0GA 1S24A 3PWFA 1R0FA 2MS3A 4POGA 4TPUA 1C09A 1S30A 1R0JA 8RXNA 5IY0A 1RWDA 1BRFA 1T9OA 1YK4A 1CADA 1T9QA 1SMWA 2QL0A 2K2DA 4AR3A 2KN9A 6RXNA 5RXNA 2GMGA 1JYBA 4K9FA 1BE7A 1QCVA 4POFA 1YV1A 1DX8A 1H7VA 1IU5A 2PYAA 1QYBA 4ME3A 2HR5A 1FHHA 2DSXA 1RDVA 4YWMA 2LCQA 1DVBA 1LTLA 1CAAA 3KYVA 1B2OA 3SS2A 1YK5A 1LKPA 1T9PA 1RB9A 1YUZA 1B71A 4YWLA 1ZRPA 1R0HA 2V3BB 1R0IA 1S2ZA 3KYYA 3RZTA 4AR5A 5AI3A 3A44A 1BFYA 7RXNA 1IRNA 1B13A 1IROA 3QVDA 4AR4A 1B2JA 3RZ6A 2VL6A 1RDGA 2PVXA 1SMMA 3MPSA 1IU6A 4RXNA 3KYXA 1LKMA 1FHMA 2KKDA 2PVEA 3RYGA 1VCXA 1NNQA 1RYTA 5AI2A 1BQ9A 1SMUA
chains in the Genus database with same CATH superfamily
1YUXA 1LKOA 4AR6A 2M4YA 2XJRA 3S14L 5JVG1 2AQCA 1E8JA 3LNLA 2CR8A 5EIOC 3FKIL 4POGA 2R7ZL 1OWBA 3IU3I 1BRFA 1YK4A 5H1Sc 3GTGL 4A3CL 2JI1A 1VZIA 3HAXC 4AR3A 5RXNA 3HJYB 2GMGA 1JYBA 3HOYL 4K9FA 5C4XL 2M6OA 2WB1P 4BBSL 1QYBA 2B5ID 1FHHA 5C4JL 5M5XL 1PFVA 3HJWB 1DVBA 4Y52L 2CKAA 2Z3QB 3H0GL 3KYVA 5MFZA 3PIP1 3H9BA 3RZOL 3LWVB 2HVYC 1NXGA 1WCML 2V0FA 3H97A 1R0IA 3S15L 4A93L 2JA6L 3S16L 4AI0A 3GTML 1IRNA 1IROA 1PZXA 4AR4A 4WFN1 5FLML 2J9UB 2APOB 1QQTA 1Y1WL 3H3VM 1IU6A 5MGNA 2XJTA 1F4LA 1LKMA 5GADc 3RYGA 3S1QL 3HKZP 3PKJA 1R9TL 1SMUA 1IW7D 2RDVA 3PIO1 1BQ8A 3M3YL 1S24A 3HOVL 4C2M1 4TPUA 2XJUA 5IYCL 1S30A 1R0JA 8RXNA 1T9OA 4A3JL 2H12A 2RFKB 2QL0A 3WWLA 1PFUA 1VZGA 5IP7L 3K7AL 2AUSB 2M4VA 5JVH1 3I4ML 1QCVA 4A3ML 3H99A 4E6YA 1ODHA 1NXEA 4ME3A 5IYBL 4AHYA 3LWQB 5M3ML 5M5WL 4A3IL 3S17L 3QQCE 1RYQA 2NVYL 5GAEc 1RB9A 4X6AL 4QIWP 4YWLA 1R0HA 4A3EL 3I4NL 5MFPA 2A6ED 4AR5A 1P7PA 5AI3A 3A44A 1BFYA 2EY4E 1B13A 3P2AA 2B63L 3QVDA 3LWOB 2XJQA 1I3QL 3RZ6A 5FJ8L 3CQZL 3S1RL 2BE5D 4C3IL 2KKDA 3LWRB 3HOUL 4ZN1B 2JI3A 2XJSA 3KYUA 5DM71 2ZIXA 5M5YL 4AI2A 3HOWL 3M4OL 4BXXL 1TWCL 3LPEB 3PWFA 5IYDL 1OWCA 2CKCA 4A3KL 1C09A 3PO3L 4V196 5IY0A 1RWDA 1T9QA 1SMWA 4AYBP 2K2DA 4LHLA 1TWHL 2E2HL 1WJVA 4TVMA 2XJPA 4AHWA 4A3GL 5M3FL 3PL5A 1BE7A 2PMZP 4XXBB 4POFA 3GTJL 2E2JL 2ERJA 3S2DL 1H7VA 2PYAA 4A3DL 3S1NL 1Y1VL 1RDVA 2LCQA 2JA5L 4BBRL 4A3FL 3H9CA 5AN9H 2NVXL 4A3LL 3PKIA 5GAHc 4B8CD 3RZDL 4C3JL 2C6BA 3MSUA 1YUZA 3GTPL 3MQKB 2PSMC 5C44L 1TWAL 1S2ZA 3B0AB 2ERSA 3RZTA 4AHXA 3NFPI 4AI1A 4LHNA 2A68D 1K83L 3ZG6A 3HOZL 1RDGA 3PO2L 3J7Y1 5MLC3 2PVXA 3MPSA 2NYDA 4Y7NL 5EINC 3VPBE 2WAQP 1VCXA 2JA7L 1NNQA 1RYTA 4U671 2VUML 1I6HL 5AI2A 1BQ9A 2L0ZA 3PZAA 4JAGA 2E2IL 5GAGc 3KYWA 2JA8L 4JAFA 2C6AA 4JAEA 1R0GA 5DM61 2A69D 3GTOL 1R0FA 2MS3A 2A6HD 3P8BA 1CADA 3WWNB 2V0EA 4A3BL 3GTQL 2KN9A 1VZHA 6RXNA 4GS7D 3LWPB 1SFOL 4ZN3B 4AI3A 1TWGL 1YV1A 2R93L 1DX8A 1IU5A 4AHZA 2HR5A 2DSXA 3JR7A 3S1ML 3GTLL 4YWMA 3K35A 4G6BA 1I50L 2M6PA 1LTLA 1CAAA 1Z92B 4C3HL 5K2ME 1B2OA 3SS2A 3GTKL 1YK5A 1LKPA 5MF6A 1T9PA 4BY1L 2YU9L 1PFYA 5IP9L 2Y0SP 2O5JD 2NVTL 1B71A 4BY7L 1ZRPA 2NVQL 2V3BB 3KYYA 2Z3RB 4JADA 3B08B 3HOXL 2PPTA 7RXNA 4UY81 1B2JA 2VL6A 3S2HL 2AYJA 5C3EL 1SMMA 3FDJA 3J7Z1 2JI2A 4XGHA 4RXNA 3KYXA 1FHMA 2PVEA 2XJVA 2R92L 1TWFL 1PFWA
chains in the Genus database with same CATH topology
2XJSA 1IW7D 1YUXA 2RDVA 3PZAA 3KYUA 1LKOA 4JAGA 5DM71 4AR6A 5GAGc 3PIO1 2M4YA 2XJRA 3KYWA 5JVG1 2ZIXA 4AI2A 1BQ8A 1E8JA 3LNLA 2CR8A 4JAFA 2C6AA 4JAEA 1R0GA 1S24A 5EIOC 5DM61 2A69D 3LPEB 3PWFA 1R0FA 2MS3A 1OWCA 2CKCA 4POGA 4TPUA 2XJUA 1C09A 2A6HD 1OWBA 1S30A 1R0JA 3IU3I 8RXNA 5IY0A 1RWDA 4V196 1BRFA 1T9OA 1YK4A 1CADA 3P8BA 1T9QA 2H12A 3WWNB 1SMWA 5H1Sc 2QL0A 3WWLA 2JI1A 2K2DA 1VZIA 4LHLA 4AR3A 2V0EA 2KN9A 1VZGA 1VZHA 6RXNA 5RXNA 2GMGA 1WJVA 1JYBA 4GS7D 4TVMA 2XJPA 4AHWA 2M4VA 4K9FA 4ZN3B 4AI3A 5JVH1 1BE7A 1QCVA 4XXBB 4POFA 1YV1A 2M6OA 2ERJA 1DX8A 1H7VA 1IU5A 4E6YA 2PYAA 1QYBA 2B5ID 1ODHA 1NXEA 4AHZA 4ME3A 2HR5A 1FHHA 4AHYA 2DSXA 1RDVA 4YWMA 2LCQA 3K35A 4G6BA 2M6PA 1DVBA 1LTLA 2CKAA 1CAAA 2Z3QB 5AN9H 1Z92B 5K2ME 3PKIA 3KYVA 1B2OA 3QQCE 3SS2A 5MFZA 3PIP1 5GAHc 1RYQA 4B8CD 1YK5A 1LKPA 5MF6A 1T9PA 5GAEc 2C6BA 1RB9A 3MSUA 1YUZA 1NXGA 2PSMC 2O5JD 1B71A 4YWLA 1ZRPA 1R0HA 2V3BB 2V0FA 1R0IA 1S2ZA 3B0AB 3KYYA 5MFPA 2ERSA 3RZTA 2A6ED 2Z3RB 4AR5A 4JADA 5AI3A 3A44A 3B08B 4AHXA 2PPTA 3NFPI 4AI1A 4AI0A 1BFYA 7RXNA 1IRNA 1B13A 3P2AA 1IROA 4LHNA 4UY81 3QVDA 4AR4A 4WFN1 1B2JA 2XJQA 3RZ6A 2A68D 2J9UB 3ZG6A 2VL6A 1RDGA 3J7Y1 2AYJA 5MLC3 2PVXA 1SMMA 3MPSA 3J7Z1 2JI2A 2NYDA 1IU6A 4XGHA 2BE5D 4RXNA 5EINC 3KYXA 2XJTA 3VPBE 5MGNA 1LKMA 1FHMA 2KKDA 2PVEA 5GADc 3RYGA 1VCXA 2XJVA 4ZN1B 1NNQA 1RYTA 4U671 5AI2A 1BQ9A 3PKJA 2JI3A 2L0ZA 1SMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YUX A;  2RDV A;  3PZA A;  3KYU A;  1LKO A;  4AR6 A;  2M4Y A;  3KYW A;  1BQ8 A;  1E8J A;  1R0G A;  1S24 A;  3PWF A;  1R0F A;  2MS3 A;  4POG A;  4TPU A;  1C09 A;  1S30 A;  1R0J A;  8RXN A;  5IY0 A;  1RWD A;  1BRF A;  1T9O A;  1YK4 A;  1CAD A;  1T9Q A;  1SMW A;  2QL0 A;  2K2D A;  4AR3 A;  2KN9 A;  6RXN A;  5RXN A;  2GMG A;  1JYB A;  4K9F A;  1BE7 A;  1QCV A;  4POF A;  1YV1 A;  1DX8 A;  1H7V A;  1IU5 A;  2PYA A;  1QYB A;  4ME3 A;  2HR5 A;  1FHH A;  2DSX A;  1RDV A;  4YWM A;  2LCQ A;  1DVB A;  1LTL A;  1CAA A;  3KYV A;  1B2O A;  3SS2 A;  1YK5 A;  1LKP A;  1T9P A;  1RB9 A;  1YUZ A;  1B71 A;  4YWL A;  1ZRP A;  1R0H A;  2V3B B;  1R0I A;  1S2Z A;  3KYY A;  3RZT A;  4AR5 A;  5AI3 A;  3A44 A;  1BFY A;  7RXN A;  1IRN A;  1B13 A;  1IRO A;  3QVD A;  4AR4 A;  1B2J A;  3RZ6 A;  2VL6 A;  1RDG A;  2PVX A;  1SMM A;  3MPS A;  1IU6 A;  4RXN A;  3KYX A;  1LKM A;  1FHM A;  2KKD A;  2PVE A;  3RYG A;  1VCX A;  1NNQ A;  1RYT A;  5AI2 A;  1BQ9 A;  1SMU A; 
#chains in the Genus database with same CATH topology
 1YUX A;  1LKO A;  4AR6 A;  2M4Y A;  2XJR A;  3S14 L;  5JVG 1;  2AQC A;  1E8J A;  3LNL A;  2CR8 A;  5EIO C;  3FKI L;  4POG A;  2R7Z L;  1OWB A;  3IU3 I;  1BRF A;  1YK4 A;  5H1S c;  3GTG L;  4A3C L;  2JI1 A;  1VZI A;  3HAX C;  4AR3 A;  5RXN A;  3HJY B;  2GMG A;  1JYB A;  3HOY L;  4K9F A;  5C4X L;  2M6O A;  2WB1 P;  4BBS L;  1QYB A;  2B5I D;  1FHH A;  5C4J L;  5M5X L;  1PFV A;  3HJW B;  1DVB A;  4Y52 L;  2CKA A;  2Z3Q B;  3H0G L;  3KYV A;  5MFZ A;  3PIP 1;  3H9B A;  3RZO L;  3LWV B;  2HVY C;  1NXG A;  1WCM L;  2V0F A;  3H97 A;  1R0I A;  3S15 L;  4A93 L;  2JA6 L;  3S16 L;  4AI0 A;  3GTM L;  1IRN A;  1IRO A;  1PZX A;  4AR4 A;  4WFN 1;  5FLM L;  2J9U B;  2APO B;  1QQT A;  1Y1W L;  3H3V M;  1IU6 A;  5MGN A;  2XJT A;  1F4L A;  1LKM A;  5GAD c;  3RYG A;  3S1Q L;  3HKZ P;  3PKJ A;  1R9T L;  1SMU A;  1IW7 D;  2RDV A;  3PIO 1;  1BQ8 A;  3M3Y L;  1S24 A;  3HOV L;  4C2M 1;  4TPU A;  2XJU A;  5IYC L;  1S30 A;  1R0J A;  8RXN A;  1T9O A;  4A3J L;  2H12 A;  2RFK B;  2QL0 A;  3WWL A;  1PFU A;  1VZG A;  5IP7 L;  3K7A L;  2AUS B;  2M4V A;  5JVH 1;  3I4M L;  1QCV A;  4A3M L;  3H99 A;  4E6Y A;  1ODH A;  1NXE A;  4ME3 A;  5IYB L;  4AHY A;  3LWQ B;  5M3M L;  5M5W L;  4A3I L;  3S17 L;  3QQC E;  1RYQ A;  2NVY L;  5GAE c;  1RB9 A;  4X6A L;  4QIW P;  4YWL A;  1R0H A;  4A3E L;  3I4N L;  5MFP A;  2A6E D;  4AR5 A;  1P7P A;  5AI3 A;  3A44 A;  1BFY A;  2EY4 E;  1B13 A;  3P2A A;  2B63 L;  3QVD A;  3LWO B;  2XJQ A;  1I3Q L;  3RZ6 A;  5FJ8 L;  3CQZ L;  3S1R L;  2BE5 D;  4C3I L;  2KKD A;  3LWR B;  3HOU L;  4ZN1 B;  2JI3 A;  2XJS A;  3KYU A;  5DM7 1;  2ZIX A;  5M5Y L;  4AI2 A;  3HOW L;  3M4O L;  4BXX L;  1TWC L;  3LPE B;  3PWF A;  5IYD L;  1OWC A;  2CKC A;  4A3K L;  1C09 A;  3PO3 L;  4V19 6;  5IY0 A;  1RWD A;  1T9Q A;  1SMW A;  4AYB P;  2K2D A;  4LHL A;  1TWH L;  2E2H L;  1WJV A;  4TVM A;  2XJP A;  4AHW A;  4A3G L;  5M3F L;  3PL5 A;  1BE7 A;  2PMZ P;  4XXB B;  4POF A;  3GTJ L;  2E2J L;  2ERJ A;  3S2D L;  1H7V A;  2PYA A;  4A3D L;  3S1N L;  1Y1V L;  1RDV A;  2LCQ A;  2JA5 L;  4BBR L;  4A3F L;  3H9C A;  5AN9 H;  2NVX L;  4A3L L;  3PKI A;  5GAH c;  4B8C D;  3RZD L;  4C3J L;  2C6B A;  3MSU A;  1YUZ A;  3GTP L;  3MQK B;  2PSM C;  5C44 L;  1TWA L;  1S2Z A;  3B0A B;  2ERS A;  3RZT A;  4AHX A;  3NFP I;  4AI1 A;  4LHN A;  2A68 D;  1K83 L;  3ZG6 A;  3HOZ L;  1RDG A;  3PO2 L;  3J7Y 1;  5MLC 3;  2PVX A;  3MPS A;  2NYD A;  4Y7N L;  5EIN C;  3VPB E;  2WAQ P;  1VCX A;  2JA7 L;  1NNQ A;  1RYT A;  4U67 1;  2VUM L;  1I6H L;  5AI2 A;  1BQ9 A;  2L0Z A;  3PZA A;  4JAG A;  2E2I L;  5GAG c;  3KYW A;  2JA8 L;  4JAF A;  2C6A A;  4JAE A;  1R0G A;  5DM6 1;  2A69 D;  3GTO L;  1R0F A;  2MS3 A;  2A6H D;  3P8B A;  1CAD A;  3WWN B;  2V0E A;  4A3B L;  3GTQ L;  2KN9 A;  1VZH A;  6RXN A;  4GS7 D;  3LWP B;  1SFO L;  4ZN3 B;  4AI3 A;  1TWG L;  1YV1 A;  2R93 L;  1DX8 A;  1IU5 A;  4AHZ A;  2HR5 A;  2DSX A;  3JR7 A;  3S1M L;  3GTL L;  4YWM A;  3K35 A;  4G6B A;  1I50 L;  2M6P A;  1LTL A;  1CAA A;  1Z92 B;  4C3H L;  5K2M E;  1B2O A;  3SS2 A;  3GTK L;  1YK5 A;  1LKP A;  5MF6 A;  1T9P A;  4BY1 L;  2YU9 L;  1PFY A;  5IP9 L;  2Y0S P;  2O5J D;  2NVT L;  1B71 A;  4BY7 L;  1ZRP A;  2NVQ L;  2V3B B;  3KYY A;  2Z3R B;  4JAD A;  3B08 B;  3HOX L;  2PPT A;  7RXN A;  4UY8 1;  1B2J A;  2VL6 A;  3S2H L;  2AYJ A;  5C3E L;  1SMM A;  3FDJ A;  3J7Z 1;  2JI2 A;  4XGH A;  4RXN A;  3KYX A;  1FHM A;  2PVE A;  2XJV A;  2R92 L;  1TWF L;  1PFW A; 
#chains in the Genus database with same CATH homology
 2XJS A;  1IW7 D;  1YUX A;  2RDV A;  3PZA A;  3KYU A;  1LKO A;  4JAG A;  5DM7 1;  4AR6 A;  5GAG c;  3PIO 1;  2M4Y A;  2XJR A;  3KYW A;  5JVG 1;  2ZIX A;  4AI2 A;  1BQ8 A;  1E8J A;  3LNL A;  2CR8 A;  4JAF A;  2C6A A;  4JAE A;  1R0G A;  1S24 A;  5EIO C;  5DM6 1;  2A69 D;  3LPE B;  3PWF A;  1R0F A;  2MS3 A;  1OWC A;  2CKC A;  4POG A;  4TPU A;  2XJU A;  1C09 A;  2A6H D;  1OWB A;  1S30 A;  1R0J A;  3IU3 I;  8RXN A;  5IY0 A;  1RWD A;  4V19 6;  1BRF A;  1T9O A;  1YK4 A;  1CAD A;  3P8B A;  1T9Q A;  2H12 A;  3WWN B;  1SMW A;  5H1S c;  2QL0 A;  3WWL A;  2JI1 A;  2K2D A;  1VZI A;  4LHL A;  4AR3 A;  2V0E A;  2KN9 A;  1VZG A;  1VZH A;  6RXN A;  5RXN A;  2GMG A;  1WJV A;  1JYB A;  4GS7 D;  4TVM A;  2XJP A;  4AHW A;  2M4V A;  4K9F A;  4ZN3 B;  4AI3 A;  5JVH 1;  1BE7 A;  1QCV A;  4XXB B;  4POF A;  1YV1 A;  2M6O A;  2ERJ A;  1DX8 A;  1H7V A;  1IU5 A;  4E6Y A;  2PYA A;  1QYB A;  2B5I D;  1ODH A;  1NXE A;  4AHZ A;  4ME3 A;  2HR5 A;  1FHH A;  4AHY A;  2DSX A;  1RDV A;  4YWM A;  2LCQ A;  3K35 A;  4G6B A;  2M6P A;  1DVB A;  1LTL A;  2CKA A;  1CAA A;  2Z3Q B;  5AN9 H;  1Z92 B;  5K2M E;  3PKI A;  3KYV A;  1B2O A;  3QQC E;  3SS2 A;  5MFZ A;  3PIP 1;  5GAH c;  1RYQ A;  4B8C D;  1YK5 A;  1LKP A;  5MF6 A;  1T9P A;  5GAE c;  2C6B A;  1RB9 A;  3MSU A;  1YUZ A;  1NXG A;  2PSM C;  2O5J D;  1B71 A;  4YWL A;  1ZRP A;  1R0H A;  2V3B B;  2V0F A;  1R0I A;  1S2Z A;  3B0A B;  3KYY A;  5MFP A;  2ERS A;  3RZT A;  2A6E D;  2Z3R B;  4AR5 A;  4JAD A;  5AI3 A;  3A44 A;  3B08 B;  4AHX A;  2PPT A;  3NFP I;  4AI1 A;  4AI0 A;  1BFY A;  7RXN A;  1IRN A;  1B13 A;  3P2A A;  1IRO A;  4LHN A;  4UY8 1;  3QVD A;  4AR4 A;  4WFN 1;  1B2J A;  2XJQ A;  3RZ6 A;  2A68 D;  2J9U B;  3ZG6 A;  2VL6 A;  1RDG A;  3J7Y 1;  2AYJ A;  5MLC 3;  2PVX A;  1SMM A;  3MPS A;  3J7Z 1;  2JI2 A;  2NYD A;  1IU6 A;  4XGH A;  2BE5 D;  4RXN A;  5EIN C;  3KYX A;  2XJT A;  3VPB E;  5MGN A;  1LKM A;  1FHM A;  2KKD A;  2PVE A;  5GAD c;  3RYG A;  1VCX A;  2XJV A;  4ZN1 B;  1NNQ A;  1RYT A;  4U67 1;  5AI2 A;  1BQ9 A;  3PKJ A;  2JI3 A;  2L0Z A;  1SMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...