2PYFA

Crystal structures of high affinity human t-cell receptors bound to pmhc revealnative diagonal binding geometry unbound tcr clone 5-1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
205
structure length
205
Chain Sequence
KQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGSSTLYIAASQPGDSATYLCAVRPLLDGTYIPTFGRGTSLIVHPYIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPDTFFPSPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of high affinity human T-cell receptors bound to peptide major histocompatibility complex reveal native diagonal binding geometry
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords T-Cell Receptor, Alpha Chain
total genus 37
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2007-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2pyfA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2pyfA02
2G2RB 1T20A 2D0GA 3TO2B 3IKCB 1V7NH 4PJAB 4X5WA 3P9WB 3WIIL 5IR1A 1WICA 5IKCB 1M6OB 4XTRC 4DTGH 5ILTL 4HWZB 3ARXA 1HXYB 1HXYA 1PEWA 1BVZA 4G8FB 5KOMC 3LVEA 3P4LA 4NSKA 3GSQB 1JHLL 3BWAB 1DVFD 1XH3A 3KJ6L 2FZ3A 4V1DD 3IKCA 5I71B 2HMIC 1WQVT 4OZGF 4NJ9H 4P2QD 1SY6A 2YUZA 3FOLA 3B5HA 2AEPL 1BBDH 3SN6N 2VAAB 3N1PC 4ACPA 5AYUL 5LGJA 1CN4A 3MC0A 4UTBH 4UV7H 1I9IL 2E8YA 4HG4J 3BT2H 5A2JH 1FVDA 3LKOB 4QRPD 3UTPE 5C07D 5C0BB 2FBOJ 3M45A 3MJ7B 3D2UB 4JFEE 4YQXL 2AGJL 4ZS7L 1DQQB 3NABH 3W39A 3OKOB 3B9KA 5DK3A 1VKXA 4M1DL 4QTIH 5KSUB 4LCUA 3I02B 1PSKL 5EBLB 4ONHA 2P8PA 3NGBC 5MI0B 4MNGB 2VJXA 4LSTL 5A2IH 4HV8B 5CAYB 4GMSH 4JHAL 4JM2D 1IEHA 2YKLH 2R0KH 3VFMA 1CDHA 1DQML 3LS5L 4OKVB 4HFWA 4Z95L 1DUZB 1AGCB 5DQ9B 1MHCB 2KQMA 4QHMB 2CDEB 5IMLA 3KXFE 1MHPH 4HQQH 1JL8A 5B3NA 1KTDA 4JANA 4K07A 3CLFL 3B2VL 2WIIA 5EBGA 4J1UB 5F7EL 2E5EA 1QA9B 3GUTB 2P45B 1KG0A 1MFEH 3RWDA 1ORQB 3MNVA 1UM5H 2GSGA 3QNYB 3PWNA 2Y5EA 3MV7E 1H3VA 4BQ8A 2FJHB 4N8CL 3RVTC 1P84J 4HT1H 4ONFH 3FO9A 2C7UA 2XV6B 5ELIA 3C8HA 4X9IA 3SDCD 1Q9KB 2PNDA 5FGBA 1LK3H 1ZA3B 4K3EH 4LRNH 3BE1H 1ZVSA 3LB6D 4NZTH 3PV7A 3RVVC 1K6QH 2XFXB 5FF6B 5GGSB 4D2NA 2ITDB 4NKOB 1RZ7L 3K8KA 4U6VH 2A2QT 5C08B 3O8XA 1OGAA 1OW0C 4HKZB 2AP2A 4ZNCD 4P5KA 1C5CL 1OARH 3FCTB 4OLVL 4ISVB 5SWZB 2CXKA 5T1KD 4OFVA 3KGRA 2BNRD 3LCYA 3UTSE 4EDXA 2DYPD 3KPLB 4YHIA 2ICWA 5C0CB 4KY1H 1J88A 8FABB 3VXMA 3HRZA 2R2CA 2VXSL 5EZOH 1WT5C 2XQBH 1A1MB 4EQ3A 1EFXD 1ZA6A 5CSGA 3HB3C 4N5UA 5KW9L 4PJFA 1FFPA 1KCRL 1YYLL 5D1QD 3SPVB 5DRXA 4I13B 4V2CB 4JM4H 4R4BA 5IB4A 3LEYL 1M7DA 5CGMA 3IJHB 4NO0D 43C9A 1A7RL 2F9BT 4AEEA 4H25B 4Z7OF 3MLRL 3S5LA 1AP2B 4L9LA 2RFXA 3EJYD 1I9RH 1QRNE 4NQCB 4UQ3B 3HNVH 3CVHB 1OPGL 3KLAA 3QQ3A 4FQHB 1IBGH 2QKIB 4PRPB 1RUPL 2WLZA 3OGCA 4JN2B 1F8TL 2Z0BA 1F13A 3QAZC 2RGSA 4XWGH 1IM3B 3LMJL 4M4PA 4AQ1B 2PTTB 1H0DA 5GGVH 2UWEB 1FIGL 1UCTA 2GTWB 4DWHA 2ITCA 3GRWL 1S7SB 4D9LH 3WNMA 2DQTH 4NRZA 4IOFC 4JHBA 2PXYD 5L2JB 3DX6B 2AJZB 1T0NA 4UOW0 2WBJC 3OKLA 2VLRE 4XP6H 3P9MA 3NCFB 5TFSL 4ZFZB 1VFOA 4K7PH 2V2TB 3DVGA 1KIQA 3AS0A 4P23D 4IMKC 1HYRC 2N1KA 1B4JL 4L4TA 5TF1L 3VMPA 1XCTB 3R0MA 4WFHE 1U2HA 4U1JA 4X7CC 3FQNA 1UQSA 1KB5L 3VWJD 1UB6B 3QUYB 1H3XA 1XGYH 2D03H 2QQKH 1BFSA 1AO7D 3DYOA 2H9GA 4U6HA 1T6VN 1UXWB 4M6MH 1JZ8A 3GSXB 4HKBB 1X5GA 1WIOA 2HRLA 3UCRA 4NYLA 3ARBC 1F58H 1G1CA 2CRYA 4EIGB 5TE7H 2NX5E 4RNRB 3E6FA 1UWEL 2DDQL 5IV2A 5KZCD 3PQYD 5JIKA 1GCFA 3CSYA 5F9WB 5EDXA 4AT6A 4HUNB 1KTLA 3NH7H 3KXFD 1FO0L 4PGBB 5TE6L 4G6KH 5AAWA 1BFVH 4FFVC 4PGDB 1WITA 4YE4L 3S97C 4TTGA 2X89D 4HIXL 3KXFA 3RZCC 3IXAA 3OX8A 3LKSA 1MCKA 4MNGE 2VXUL 2BVOB 1HZHL 5D5MA 5CBEB 1TCRB 3GDBA 4HEME 3CCHB 3RFZC 3IJSA 1OM3H 4ZO8A 5GZOC 3KYOA 4XXCA 2HJKA 1KSRA 1DBKL 2BJML 5J1SC 2W60B 3EDFA 1HHJA 4PRHD 4WFGE 3OKMB 1T03L 1EXUA 5T3XE 1FZOB 4Q6IC 4OTXH 3DI2B 1ZLWH 2QADB 4C59B 5GS1B 1H9VA 3D0LA 4LL9A 4QOKE 3RKDD 4CJ0A 1Y18B 2PW1B 3WD5H 3MLSL 1B2WL 3R4DA 4NHCL 5F6IC 4UNTA 5GRVK 4Z7VF 4OZFG 1KIUA 4EN3B 1BVKA 2GK0A 2J4WH 4NM4H 1CFSB 4OJFH 3B9KD 3MUGB 4GO6B 3RKDC 4AEHL 3W5MA 1SJXA 1CZ8L 1NDMA 3H9ZA 1LO3H 3O4LE 3QCTH 4DJMA 2D7OA 2ZSWA 3QIUD 4HIJA 4HEPG 5EPMA 1YPZE 5ISZD 3HAEG 4POYA 2RAMA 3TNNA 3B6SA 3PF2A 3TYGL 1E28B 3B2VH 2F53E 2R4SH 3IU4L 1KIRB 5HI5C 4KUZL 1I4FB 5IESH 3REWA 3T65B 4A6YA 5BRZA 4KKCD 3F62A 2DQGH 3QIBC 3CZFA 5D2NA 4MXQD 4Q2ZB 1FG2B 5J9PB 3IETA 4WUKL 3CDCA 4I3RL 3V5KA 2ZOLB 4PY7A 1QPPA 2O61B 2N7AA 3ARDD 1NAKH 4U3CA 4RMQA 4XP6L 1WBZB 3M07A 1QSFB 1UWGH 3CVIL 2NY4D 4J4PD 3TT3L 5ANME 2VXQH 4QRPB 1NL0L 3C09B 5KJRH 2X1XR 1IAKA 3QEGL 4L3EB 5F3HA 4BUHA 1BBJA 2UVFA 2XWTA 4TSCH 3BXNB 5JDSB 3SEPA 5JPNA 4E41A 2EYRB 3GI8H 1INQB 4HGWB 4KKAC 1I1CA 4J8RA 3UO1H 4I0PB 1CR9H 4OQ1A 1FN4A 2DKUA 5MERA 3O8XD 1J7VR 2BNQA 4BYHA 3QIUC 2X89A 4M43H 3H9YA 5I73B 3RNKA 1INDH 2HWZL 2MCPH 3KVQA 3GMPB 4PRHA 4Z78B 2X10A 5HD8D 1AXTL 2WUBH 3PWPE 3L7EB 3FB6B 4P2OC 4HUUB 4OQTH 5DJYA 3CUPA 5EOCL 5C86A 5HPMB 2GJJA 4XPHL 1RIHH 1VACB 3VRLF 5EUKB 1XCQA 2OX5A 1DLHA 5DJXB 1TPXB 3TNMB 4LSRL 4M43L 5AG9A 1A7NL 4ZO9A 2EYTB 5EZLA 5CKGA 2HKFL 3TH2T 4M9PA 3WKMH 2GITB 4BZ2H 3Q5TA 1FFQA 2YSSB 1KPRB 1K5NA 1VEMA 2IQ9L 3KPPA 1RZFL 3DBXA 4PRNA 4X4YA 4OBSA 2Q6WA 4KQ4H 4XP9L 3TBSB 5D7LE 4YR6A 1TZGL 1MH5B 4F3FA 2I5YL 1I8MA 2NY7H 2VZOA 4OIAA 2VZVA 3MRPA 2AQ1A 4DGVL 1M7IA 1U3YA 5H37G 4YC2C 3FFCA 5D72H 3VXUB 2F8XC 1JNJA 1XIWB 2HT3C 4N90E 3SKNB 4WWKB 3ZDZF 1ZT4A 2X7LA 1T21A 2CK0L 4JDVA 2B5IB 2BVEA 2ICES 4OGXL 1T22A 3MBXL 3EYQC 3HC4L 2FATL 5ITBL 1D6EA 3WFEH 5E5RB 2AV1B 4Z7NF 1MCJA 4JFYA 1UACH 3C8DA 4PV9A 1UH4A 5MEPA 1OWRM 4MD0B 3IFOB 2XRAH 2W1NA 7FABH 4P2OB 5FA4A 3S96B 1CTNA 2YRLA 4CVUA 1A9EA 5IB2A 3V95A 2EDWA 3E1F1 3TYGH 1MOEA 4IJ3B 1FVCA 2C3XA 2Z4QB 4JZJC 1WAAF 1KN4H 3SGJC 4X98A 1E4KC 4Y2DD 3ZDYE 1YN7B 5I1IL 1I9RL 5F89B 4P2OA 4JVPA 1WZ1H 3MRJA 5MEPB 2AW2A 4WWID 2NY2B 4UV4L 4GRMA 1EJOH 3U1SH 4HCRA 1VGEH 1PKQB 5AG8A 4PRIA 1R3LB 3T0ED 2A77H 3QCVL 4OI8A 1G9ML 2X7LB 4KKLD 3O6KL 4JQXA 4MQXD 5EFIB 3U83A 2VDKL 5E2UH 1S7QB 4E41D 3K2MC 2WBJD 3TCXA 5HHOA 4XCYB 4EUPG 4F3FB 5FUZL 2G75B 4X5XA 3X13B 5CIPH 2XQYG 4JRYD 4PRNB 3G5YB 3N9GL 1QSFE 3MRCB 3OAZH 4N8PA 4UINL 3PP4L 2DLHA 1FVEB 4JFOB 5BXFB 4IDJH 5L2KD 3QDMB 3PDGA 3K2UL 5B3JF 4PJAF 4YXKL 2F5BL 3SE3A 4G6AD 5I66B 3CC5B 5BW7C 2FX8H 5I74B 3O3DB 1JE6A 4C83A 4O2EB 4OZIE 1VACA 4OLUH 4GUPA 3VRIB 4A2MA 1LK3L 4WNQB 4NPYA 2DB8A 4MGXA 2L7JA 3GSOA 3HC0A 3FT3A 1F6FB 4ORGB 5LGHH 5BMFL 3D3VE 1NBVH 4XBEH 1RAMA 4LSUL 4HZAA 5L7XL 4X6CB 3DVNA 3RNKB 3D69B 1X5KA 3KNBB 1I3GH 3EYVA 2A0LC 5EZJB 3EGSA 3QO0B 5BRZE 1FZMB 1C5CH 4AMKH 3IDJB 4Y4FD 5I8KH 3MLZH 2DTSA 4JDTL 1HSAB 5DURD 4OSUH 1B0RB 2V9RA 1X4ZA 4U33A 3NPSB 1PLGH 5KW9H 3SKOA 1IAKB 3GMMB 1TPXC 2GUOB 4P9ML 5HHXH 3QRFM 3BWUC 1UADC 1NDGB 1V3LA 3VRJB 4IEFB 2UZYB 2K7PA 3UZQA 1WBZA 5JMRA 1AXSA 3LZFL 3RWEB 4HK3J 3T0BA 4X7TB 1JZ6A 4IM8A 4OLXH 4QF1B 1QSEA 4DOHE 4X6EA 3JV6B 5FOBA 2IAMB 3EHBD 4XNUH 1OP5K 4CNIA 2Y4SA 3UX9B 2YHGA 4OTXL 2LVCA 2BNQE 3KJ4C 3LN4A 4D8PA 3WXVL 4QTHA 2OP4L 1KJ3H 3B6SB 3AROA 4LKCA 4NKDA 4YHPA 2X4OB 5DK2A 3R8QA 1KEGL 3V4VH 3QH3A 1B2WH 3GMRA 3BGMB 5GGVL 5B22A 3BEWA 5KVMC 4JY5L 2ZSWB 1EEYB 5C0AB 3QWOA 1DE4A 1YEIL 3ARBB 3QNXA 3IDGA 4R2GD 4MDIB 5GJSH 1Z5LA 4PJEF 2FECI 3OAUH 1IM9A 3ABZA 1WUNT 3D87B 1BVKB 1KJ3L 2GK0B 4DUXA 1JPSL 1RK1B 1DDHB 1CE6A 3FQXA 1EO7A 5KS9F 1I8KA 4XC1H 2VABA 5GZNC 3QUMH 4GKNA 4DGYH 1WWBX 3ARYA 2OK0H 1EGJL 2ZSVB 3NPZB 3U0PB 3HUJA 4G9FB 4QOKB 2E7BA 2FYYA 2X70B 3DRQB 1JRHL 5H2BB 4HLZG 4Z7UE 3MRNB 4JRXE 3JV4A 3G6JF 4B0MM 4MZ3A 2YKLL 2WWMD 1IILE 2R9HC 2CUHA 4PJ5B 3W0WB 4LMQI 2PTUA 2WANA 5JMOC 2YK1L 5F7UA 4IMKA 4OF6A 3MREA 4LCYB 3H6JA 4TYUA 3B5GA 3EOYG 2EC9U 2IGFH 5BVJB 1RU9H 4LLWB 4M7LL 2HTKC 3QUXA 1MPAH 4Y4HD 1RZ8B 5IVXB 5I1GH 5T5FL 2XPGA 4Y4FC 1VPOL 5J11B 4GXVL 1TZGH 4G8GB 4I8DA 1OTUD 4PGDA 1CT8A 3T77B 5C0JB 1K4DB 5CSZA 5FDWA 4KDWA 2JCCB 1MVUA 5FYJL 4L3ED 3QISA 2D03L 2QQKL 1FFOA 2RR3A 4HT1L 4OM0L 5IV2B 1Q9WA 4AL8L 2FL5A 2GJ6A 4WFHD 4RNRA 4OZHF 1NCDL 2CIKB 4WFFD 1ZV5A 3TO4C 2GFBA 3NAAL 5J89A 3N9GH 5ENWA 1ZSDA 5CJQL 1IGCL 4LPVA 3QEQE 4OF3A 4N8VG 5E5MA 5BS0B 1EBPA 4WCYH 5HSFA 3I3BA 3X11A 4CADA 2ESVD 3KYKL 3DGGA 4V2BA 3CXHK 4DKFL 2MOVA 4LEOB 3O3AA 3D3VD 4I18A 3U4EB 1UM4H 1C12B 1CVSC 4JKWA 4R4FH 4XMLH 3VGEA 2QSQA 3RL1B 4G6FB 3I84A 1QFWI 3X12A 4MCYA 4Y0GA 1NMBL 4OZFH 4XAWL 2A6KB 5EU6E 3KDMA 3CJJA 3MXVL 4KROD 2Y7QB 4O4YL 4GBXB 3JXAA 4ZFZA 3QULB 4ZUVA 1U3HB 1CGXA 4TVPE 4XMPH 1E4WH 3NA4A 4MQ7A 1KXVC 4AQOA 2AJ3A 4PGCA 3BQUD 3WFZA 1RUML 2DTMH 4Y5XB 2EDRA 4RBPH 3WFHA 3MYJB 2BVYA 1CXIA 4GXUM 1ZLWK 5AYQA 1KIPA 3S4SB 4WHYG 4RDQF 3T0WA 4C56E 4OZ4A 2ITCB 5I8KL 4KRLB 2J7LA 1DUYA 4Y4KD 1F90L 1MFDL 1RJYB 1JTPA 43CAB 3P0YL 2J8OA 3AREB 1E4XL 1WBYA 4KDTC 1KIPB 4KJQD 3FQRB 1NC4D 2Z31D 1GGBL 4YUEL 4Y5XA 4POZD 2BRRH 4PGCB 2AJ3B 2NY1B 4HLJA 4MQ7B 3LSOA 3MRLA 1AP2A 1I3VA 4P5MA 4BFIA 1PG7L 3F58H 1JN6A 2R1XA 4DKDC 3QIBA 4H25A 3IDXH 2KZ1B 1BP3B 5JNYB 2V9TA 4D3CL 5I1HL 5IQ7L 1G9NL 2IF7A 4NKIL 3VJ6A 1UB5A 3IS0X 1IRAY 4QO1A 3SPVA 2JB6A 4KGJA 4P2OD 1C12A 1MREH 1REIA 4MA3A 2YPKB 3FN0H 5E9DB 4ZUSB 5IW6A 3GIVA 4N9OB 1I1FB 5E8DH 3DGGB 3LKRA 4AEHH 3H7BB 1J18A 3HRZB 3ULVC 1UXSB 4Z18A 3K80A 3H9HA 1QOKA 3DI3B 2EDDA 3D85D 4JREC 2EZ0D 4M5YL 3OGOE 1T80A 2GSIB 3NZ8B 2NY2D 3ZLQC 5JIPA 1A9BB 1GAFH 1V8HA 1WCBB 1XAUA 2ADIB 5FO9A 5IG7B 4TSAH 12E8H 1MVUB 3G6DH 2JCCA 1NGPH 4I2XB 1PG7X 2EDKA 2P5WA 1T03H 2ZNWA 1U8QA 4APQA 2P5EE 1Q1JH 2ENSA 4CAGA 3ESUF 1ZA3A 4XAKD 3BKYH 1JGEB 1NKRA 3BPOB 4PBWD 3VXTB 1LQSR 3BHBB 5HYQA 2IH1A 3K1DA 5B8CA 5K9QI 5ALBL 4PY8I 2XZCL 4I9WE 4LIQL 4XXCC 5DJDB 5MENE 2WP3O 3P0VL 1W0VA 4XVSH 4ZPTA 2XT1B 4YGVB 1QA9A 1IGML 3GUTA 4WHDA 1RURL 2OTPA 3BW9A 4HIEA 3U30B 2EDHA 2P5ED 4UTBL 4J1UA 3MODL 5DUMH 4CBPA 3MV7D 4JFXA 4F15C 1T04A 4JANB 3VH8A 4K7FB 2FYYB 5GS0H 2CK0H 1GC1L 2ILLA 5F8RC 3AY4A 2EDYA 4YDKH 5DQ9A 1XGUB 2UYLB 3GK8H 2HN7A 5C6WH 3TJEH 4HFWB 4JHWH 5I75C 3V5DB 1RK1A 3RDTC 3HZYA 3RZCD 1IM9B 1T6WA 2XRAL 1QNZL 4LLUB 4MDIA 3T3MF 1Q0XL 1L7TL 4MNQE 4UNVA 4ONHB 4G6JL 4Y5YB 1TVHA 3ARBA 4LSPL 2FH6A 1OB1B 3ROLB 1MJ8H 2RB8A 3QWOB 4P9MH 2HRPL 2GTZA 4PREB 5FECA 3W39B 1DQQA 3QI9C 1L6ZA 3BEWB 3DNKA 3TBTB 3WL9B 5BVPH 2EE2A 1KELH 3F6LA 1XF5B 4ZYKA 4LKCB 4NKDB 3PNWA 2HVKB 4FXGA 3FT4B 4KV5F 4Z7QE 5I1CL 3ORJA 4N0YL 3P4OA 3S9DB 3U2SA 3WYRA 5HYJE 1MI5B 5D72L 4Q0XH 5D96C 4L4VD 5JIHA 2R23A 2HT2D 1N3NB 1XH3B 4KZEL 1B0GB 2BX5A 5CP7B 3MNZB 1LHZA 1JTTA 4Z7UB 2FSEB 5D7SH 4W70A 1GYAA 1AXSB 5F7NC 1Q0YH 3VXPB 4M62H 4E5XA 4GLRH 4DQOL 5HYEA 2QHLA 1GZPB 4F37K 3TCLB 4HUMB 4HG4K 1IARB 4WWKC 2JJVA 3BGFB 3RBSA 3VWJC 4I4WA 1ZS8B 2VLLA 1NAMA 1A1NA 4OQTL 4XNZC 1HDMA 5BJTB 2I9LA 1I7ZB 4L1HA 4PB9H 1B0RA 1NBZB 4MVBC 1AKJD 1VFAB 2BVUA 4EI5C 4FABH 2DI9A 4AG4H 4L9LC 4KQ3L 3ZTNL 4GW1A 5CEZH 1NGPL 3KNBA 3D69A 1UENA 5KJRL 4W4NA 4FXKB 5FXCH 3F7YA 4FS0A 1AD9B 2E6JA 3GI8L 4ORGA 3D85A 4G9FD 4NKIH 4JY4B 4ZXBA 3O6KH 5L6YL 1BQLH 1JWMA 4JR9H 3WHXB 5C1MB 4GUPB 1K4CA 3TLRA 3VRIA 1UG9A 1RUKL 1NCNA 1SEBA 3AXLA 4LHQB 2HFEA 4C83B 5DD1H 5DA4A 1IEBA 3EHBC 4XVSL 1OSZB 1C1EL 5FYKD 2Y5TB 4FQXD 4FQ2L 4LHUG 5DFTA 4WFEE 1FV1A 3A6BH 1TZHB 3BIBX 3OZ9H 3VXRB 4L8SC 1WGOA 1YEDB 1C5BL 3MRCA 5EO1B 5SWQA 3AS3A 4H88H 1YC8A 3NCJH 3VFGH 4C56D 5I15H 4HULB 4O58H 3SBWC 4K3HA 4JQIL 2H6PA 2FJGA 5GGVY 3GJEA 1AGEA 1SMAA 3VFWB 4R97C 5CMAB 2CMRH 1FLRH 1AGFA 3DXAA 2VLJD 3LKPA 4WU5A 4R4NC 4HWBA 1A4KB 1QLFA 3HCVB 3RX8A 4IIQB 1R3LA 1RZFH 4BKLB 1BLNA 3NFSH 4GRLB 1CLZL 3U7YH 2X9YA 3C9NB 3JV5A 3KHOA 3PGCB 2NY3B 1OL0A 1LEGA 1EA9C 5CEXB 1MHEB 3HMXA 4U1HA 3MRJB 4EKXA 2X1PA 2NCMA 2BCKB 1JRHI 2IJ0C 2QV2A 4U1LB 5BV7B 1KPVA 4K9EH 4O2FA 5E2WH 3HPJA 5HHVH 1J1XH 3BPCA 5DWUH 4IRSB 3LPFA 1I7RA 5IIEB 4R0LC 3MXWL 1A9EB 5IB2B 2R8SH 3UAJD 4PJXA 2QQQA 3KPRD 3QEQA 2XIDA 5CUSL 1BIHA 2V5SA 4OLYH 5EUOB 3QJHB 4XNMB 3JWDL 3H2WA 4KDTA 1DBMH 3SKMB 4YO0A 2AV1A 4QEGA 4IHOA 1W8OA 2YZ8A 5F6IB 3EJZC 1EGJH 5D7LA 5DMKB 5DQJB 1E0OB 1E4JA 3UTSD 1T0PB 1ZT1B 3NCCB 3C5ZA 4DTGL 1FFNA 4XZUA 3JUZA 3FFCB 3IAGC 1SJVA 2VDLL 2J8UF 2NY1C 5GQBA 2ZOKA 4HUWB 3MJ9L 2W9DL 2Y06L 1G0DA 2C4FT 4JKPL 3MMEA 4KMLB 4WU7A 5IUSA 4HJJL 5FB8A 5IJKC 1DFBL 4DKAA 3F12A 3MRHB 4D3CH 1WK0A 3RQ3A 2P24A 3HN3A 3QIWC 2QR0B 1OCWL 5FCUH 5F7DA 3UO1L 3U36B 4MNQB 1S9VB 5JPMB 5FO7A 3PUCA 3LQZB 4GS7B 4PJEE 5I1GL 4D0DB 2DWDB 5HDBE 1ZHLB 3PL6D 1XCQB 5GISL 4M7LH 1FNGA 4H1LG 5DGRA 3QQ9C 1DCLA 3NN8A 4QKXB 5HD8C 3T1FB 1QD0A 4WW2A 1AY1L 1OAQH 4YZFF 1W2KT 4U6VL 3ZKSD 4X9HA 3ZKQD 3QA3B 5IFAH 1NFDF 2FGWH 4LVNC 2X4SB 1CLOL 1CDJA 2HJFB 3G6JE 4R7DA 3HC3L 3RX5A 12E8L 1X7QB 4AL8H 1EZVX 5HHME 1A6WL 3JWOL 5T1MB 4Y4FA 4PRHE 4WFGD 3QT2A 3MV01 1Q0XH 4IMLB 3IDUA 5I8CA 1MCQA 1R3KB 2XWTB 4W68A 2UVEA 4YNYB 1PY9A 3T2NH 4NNYB 4NKQB 4QRPA 3DO3A 1MF2H 3PGDA 4JRWA 4OCLC 1CICD 4L8BB 1S7XB 3EO9L 3N85H 5DD5L 3T2PA 4HK0B 4FQCL 5K9QG 2OR9L 3I75A 5T5FH 4W4OC 5D5MF 4NUJA 2BVQB 3DUUA 4IS6A 2Z35B 4YHZH 5TDNB 2ZOLA 4PY7B 5M94B 2PO6D 1MHHA 1YC7A 5DUBB 4Q2ZA 5D2NB 1UWXK 3AC0A 3ARPA 3BE1L 5F72S 2BFVH 1E4WL 5CIPB 3ZMRA 4L3AA 1J0YA 4NBZB 4A6YB 1QQDB 1CVRA 5J6HB 4HAGA 1NUFA 1B90A 2OLDA 3C5JA 1KLGB 1YNTA 2F5BH 1HHHB 4FQCH 2XZAL 4ZUWB 3DO7A 2P5EB 4B53A 5JLZA 1PX3A 2VXSH 5D1ZC 1RIVH 4LAJH 3ULVH 3BZ4B 2MMXA 3ULVD 3VD9A 5I18L 4NM8H 2JE8A 5J06A 1KCRH 4DKFH 1JNLH 3BT2L 3HAEB 2VLKE 1RY7B 3U9UA 5MEOA 5E95B 3BRFA 3SDAB 3RIFF 2ZCHL 5ITFA 3E8UL 4NJ9L 5KVEH 5F44A 1D9KC 1CI5A 1CR9L 1XGRA 4Z7UF 1IM9D 3MACH 3RNQA 4JB9L 5GSVA 3QXVA 4P2RA 5I1LB 5T1LA 1QP1A 2PW1A 5EULV 2J2ZA 2AJSH 1SM3H 5IQ7H 3VI4E 2XN9D 2DLGA 2VLKD 2XXMB 5DSCA 1LO2L 4PJBE 1P6FA 4E0RA 4D9RD 4KRPB 3MR9A 2ZCHH 4RGNC 4TULL 2X4QA 3SBWA 3QUZB 2BK8A 3MV11 4HAFA 3LHPH 1NSNH 3I50H 4PRDA 3SDXF 3TBVA 1HHJB 4OV5B 4KKBD 3MOAL 4ODTH 4XPBH 1F58L 2HJKB 5EIQA 3DO7B 4WV1C 1KLGA 1QBLL 1BF2A 3Q3GA 5FCUL 1TCRA 3LEVL 5F7EH 2P44B 3NIFF 1YEJL 1SJHB 5B39A 1MCPH 3IXAB 2NYYC 3MRFB 1MFEL 1IQWH 3FRPG 5I9QC 5DUBA 1M4KA 1IC7L 4LVOB 3JWNC 4LKXB 2NY5H 1ZHNB 3MRKB 5DHXB 2Z35A 2ENYA 4IRZL 4U2ZA 5FUCC 3I75B 3VE0A 4NZRH 2YA0A 3CH8A 1XGQA 1KTLB 4KK6D 5CSBA 4NN7C 4ZAKD 5SWSD 5HXMA 1AY1H 2ESVA 1CICC 1NLBH 3CSYB 5CJOL 1LWRA 4NQDB 4AH2B 2C3HA 4JO1L 4F8QA 3ARSA 1I1RA 1U8HA 4KPHH 1R3KA 1DQMH 4OCRH 2AVGA 3TA3A 4LNVA 2JLLA 4NYLB 2A6DA 3QHZH 4GT7A 1DANT 1X7QA 1HE7A 1T5XB 2OL3H 1WT5A 4J7RA 2HJFA 4DN3H 3G6JB 4KI1A 3VDCA 4XCFH 1UB6A 4LK4A 4N68A 4PBVC 5EC2A 2XXCB 5IHLB 3UPAA 1QLEL 2ZCKH 5IBUB 2WLYA 3T1FA 1AR1C 1FFRA 3DXAE 2DKMA 4DN4L 3LQAH 1MCWM 3QCUL 1LGVA 1HI6A 2CDFB 1N6QH 3KYKH 4Y4KA 3BN9D 3OKLB 5F9DC 2ZWLT 4FQXB 2C4XA 1FNFA 1ZHLA 3SE8L 2VWEC 3QQ4A 4OAWA 1KB5B 2BXYA 5HGDB 1H3WM 4XGZA 5DSCB 5C70A 1F2QA 1U6AH 3HC3H 2XY1A 1R0AH 1S7SA 3WN5B 4NGHL 5TGBA 2BNRE 1YYMH 3U4AA 5I1LA 1CE1L 5IT2L 1H0DB 4KZDL 3F12B 3HC4H 4LF3A 5F1OB 3MJ6A 4MLIA 2R9HD 4LEXL 1RUQH 3LS4H 2XTJB 4XT1C 4POZC 1GJIA 1AJ7L 5LWYL 3HAEA 3DYPA 4K8RC 2RFXB 3ZE0E 3NCYS 3PP4H 3C5ZB 1A0QL 4ZFOL 4YHLL 1KJ2B 2EIDA 1YMME 2NY3D 3BI9X 43C9B 4S1DC 4OJFL 4CN6A 2YXFA 4IHOB 4JB9H 1U92B 1I9EA 3C5JB 3LAFA 3P11L 2PR4L 3QJHA 4XNMA 5F7LB 4K7PX 2DJSA 3WSQL 3AS2A 2H32A 1LK2B 2PXYC 4UOJA 1S9YA 5I1DB 5EU7C 4P2YA 4LLVA 2ICWB 4KXZH 4EDXB 4Y5YC 5F1NA 1V3MA 3L9RB 4FQ1H 4P57B 4R2GC 3GSWA 4HK0A 1KEGH 4UDTA 5B21A 3QP3A 1G6RB 2CLRB 3CSGA 3MRDA 3MLZL 2OI9C 3GBML 4HKZA 1F4YL 3ZE1E 1INDL 5JW4M 4HXBL 4QTIL 2HLFC 4WDIA 4LGRB 5FF6A 3QIWD 5I8CB 2YUXA 5F6HI 3DSFL 3FFCD 1RUKH 5T1MA 3VFPA 4APQC 3RY6C 3MO1B 4UT7H 3BX7C 1HHIA 5L6YH 4NO3B 5DDHA 5FM4A 4I3RH 1EFXA 5CMAA 5F7FA 2YN5A 3G04A 1Q9LB 3O9WB 3TZVA 3WJJC 2C7UB 1AHWB 3S36X 2NY6C 3FO9B 1GOFA 4WJ5A 3RVUC 3MBEB 4LFHD 5F7MC 3V8OA 2IPUG 3QPQD 2FO4B 3L5WB 2HKFH 3PWNB 3VXSD 2DQFA 3O6ML 4G6ML 3SQOH 5T1KA 1K8IA 1MY5A 4QRSB 1ED3A 2QLVB 2BSTA 5JHDD 1W72B 3BKYL 4I3SL 4GKSA 1FV1B 3UYRH 1JWUB 1A5FL 5ANMB 4ZFFA 1OSZA 2ATKA 5K9KB 4OZIB 4D0DA 1G7IB 5AZ2L 1DR9A 2HYMA 1CLOH 3ARGB 2HFEB 1C7TA 2GT9B 4ODXB 5FYJU 1CL7L 1U36A 2JCCE 3WNPA 1T83C 3FRUA 4M5ZL 1MHCA 3AB0B 4RAUB 4Q9QH 3S3JA 4JY4A 3D25B 4UZGA 1BQLL 4YHNA 4EQ2A 2IBZX 1WZMA 5C0BE 4P5TD 4FXKA 2AV7A 4HUWA 5CHNB 3A67H 4LCUB 2BC4B 3QHFH 1G6RH 1GOHA 3PWVA 5ICXA 5DJ8A 4FQ2H 3RHWF 4Y2DC 5DHYA 3RGVD 4XC3H 4R26L 2WK2A 4PJGB 1J1XL 4F8TA 1CYGA 5HGBB 1YEEH 4K9EL 5E2WL 5F7HA 1I7ZA 3ZSTA 3LKOA 3TYFA 5KVDL 4OF0A 1U8PB 4FZEH 4GG6E 3RZWA 3S37X 1ZS8A 3DIFB 4KTEH 5KVFL 5HBBA 4OLYL 2NX5A 3UXFA 5CZXC 3EYUL 3BZEB 4J3TA 1GZPA 3QEQB 4ZNEE 1FLRL 5D1ZB 1I7RB 4C58B 5IIEA 4NSKB 3REVA 4OF5A 3MNZA 1WLHA 4IRSA 5ICYA 5IKCA 5IR1B 2R4SL 3SKJL 3HG1D 5C3LD 1MI5A 3LEXB 1S7UA 1LE5B 3FQTB 3STLA 4LQFH 3U2SB 4P3DA 2FDBP 1D9KB 3TP4A 5AD0A 25C8L 5GGTA 4XHJC 1OP3H 5JHLH 3HRPA 1TIUA 2Q8BL 5J13B 4IBLT 1QLFB 3AREC 3GBNH 3P4NA 1B0WA 4GRWF 3HR6A 1ZWIB 1Q0YL 3LMJH 2YPLA 3GRWA 3EOTH 4PREA 4HIHA 1S9XA 4U1SB 1KGCD 2HH0H 5B8CC 1TVHB 4RIRA 1B88A 2GY7B 4G43B 3BOVA 3DVIA 3QUYC 1CD9B 3MRGB 4QXWA 3OKNB 5A40E 2I25N 2B20A 2OR8A 3N50A 1ACYL 2AAVA 4ODUB 5KAQG 3WDJA 3TPUB 1I9JH 2XN9B 1XGUA 2UYLA 3EYSL 3IU3B 3EO1A 4K8RD 3QDAA 1MCIA 1E4XI 3QFJD 2GAZA 2M8XA 4PJAE 3DUHA 1BJMA 5JTWA 4OUUB 1JIBA 5FYLL 3JWOH 3CDGB 4ELMF 5HI4C 5TDOA 5BZDA 4NZJA 4TNWF 1J8HE 2CGRH 1MCDA 1JWMB 4MJ5A 1IQWL 4U1NB 1YNLL 3U4BH 1JPGA 3GMQB 2OXGA 1RURH 4WO4A 1B9ZA 1A21A 2BOCA 1AD9A 4Y8DC 1U2CA 3HE7D 4KVNH 2OZ4H 1GZQA 5HGHA 3BP7B 5D70L 3VXTA 5D2LF 1P6AB 3V0WL 1JYXA 3DURB 4P9HC 2Q3ZA 4NBYB 5C9JA 5ETUA 3SJVE 4OCXL 3UDWC 1BQUA 4Y8AA 1QACA 2VE6B 3PXJA 4NQDD 6FABH 5DD6B 3C60A 4FNLL 2DIJA 4YBHA 1PG7H 3F58L 4PRID 2WWKT 3IDMA 3TCLA 3RKPA 2AK4E 3SCMA 1A3LL 3O0RH 5EB9A 4ONFL 1BZQK 3QQNA 5FA3A 1BPVA 4YXHH 2J88L 5FGSA 4OD1H 3U48A 1L0QA 4I9WD 1C5DA 2Z92A 3FO0H 4K2UH 4P2CG 5C2BL 1KBGH 1QHOA 5I19L 2UUDK 1KFAH 1L9NA 4CVXB 1JNLL 4MJ2A 1JGVH 5FO8A 4KVCH 4TUJB 3STBA 5IOPB 2JJWA 1AC6A 3GHBL 4ONGL 4WEBH 3TWCL 3H9SD 1D5BB 1U93A 1NGYA 2I60L 3OAUL 4RQQB 4FXGB 3PNWB 3EYUH 5D71L 2ATPB 1RULL 4DEPB 3VDAA 1QG3A 4BSVA 4HK3N 1ZT7A 1WBXB 2XA3A 3HZKA 4QRUB 4X99A 5IFJB 1OB1A 2AK1L 5AWNL 1A6PA 3U1SL 2Z93A 3N1MC 4LLUA 5F9OH 3CFEB 5J6GA 3SDDB 4OM1L 1OGAD 4M7LT 4PLJC 1FJ1A 4UT7L 5KG9B 4PS4L 4HX1A 1HOCA 1LEKB 1A22B 2DQCL 1EO5A 1KLUB 2H26B 4R6UA 3UPRA 3WLWD 5DJ0A 2VOTA 3MRBB 1LVEA 2ARJB 1U3JA 3VH8B 3UJIL 3HHRB 1NAMH 1EDQA 3EYFB 3G08A 5F9JA 1WWAX 3QDGE 3HFMH 4ZOCA 3ULUF 1S5HB 3QULA 4JFPA 3ULSA 4IRJD 2DQUL 5DUPL 1A14H 3MRRA 4PIRF 4KKAD 3OHXB 3GSRA 5C0DB 3V52L 5HYJB 3IAPA 3RL1A 1FORH 2B2XH 4NOFA 5B8CB 1ZGLM 1O0VA 4YHKH 3GBMH 2PYEA 4OI7A 4LEOA 5DJ2B 5BO1H 3BUYA 5C07B 4PG2C 1LO3L 4APQB 2CRMA 1U8QB 4Z76A 5ENWB 1F42A 4FFYH 3V7MA 4PJ9B 4QY8A 2CIKA 1OTSD 4XP9H 4I2XA 5GS3A 1RFDH 1RQ5A 5M95B 3FAXA 5E00A 2FL5B 2GJ6B 5GS0D 3AAZB 4JLRB 5ACZB 1JF1A 2IPTL 4ETQB 1RHHB 2JF1A 4OT1L 5ESQB 5B39G 4Q9RH 5I1JH 5DJCB 1FYHB 4JVUA 2IADA 1KB9J 15C8H 3SDYL 1TTGA 4UB0L 2GKIA 1OP5H 4J4PA 1DL7H 1EHXA 4PJIB 4QXGH 4WI9A 5JW5B 3MCG1 2YOCA 5C07A 3ZE2E 4U3HA 2DMBA 1U91B 1YDPB 4NZRL 1LP9B 3SGKA 1I1FA 3GIVB 1WFUA 2V2XA 3J7HA 3FFDB 1S9WA 2PYEB 2JK5B 2YPKA 5IB5A 1ZVHA 2JB6B 4RMVA 4EIZC 4K94H 4NO2A 4LCYA 3NH7L 3W5NA 4I77H 3VJ6B 4O9HH 5I17A 2D7PA 4PJ5A 3J8F7 4OFYA 4F33B 2XY2A 1OAUH 4G3YH 3FOMB 3JV4B 3LY6A 3AS1A 4JO2L 3CSPA 3OXSA 3WS6A 1MELA 1RZJC 4QWWD 4DW2L 2X70A 4UAOB 4OB5L 4AMKL 1WBYB 3BDYL 5LWYH 1JGLH 2R1WB 3O2DH 4IIQC 5I2IB 1DUYB 3EJZD 3FB5A 4UIKH 1BGXH 4MXWH 1P5UA 2XZZA 1EHAA 1FJ1B 4K3EL 5KG9A 3PL6A 2E6QA 3WFHB 2FHFA 4PPTA 2Z93B 3QNXB 3C5SB 3FRPA 5DVMA 5C0FA 2MQCA 5IFJA 1J05A 4AEIH 2IANA 2CXGA 5DJZB 1DQLH 3HZKB 1FNLA 4IRJA 4PJFE 4U4BA 2DYPB 3SJVB 3T0XA 1BVLA 3FT2B 4YHML 4DFIA 4G8EB 1QBBA 4BSVB 1YJDC 2GI7A 1YQ2A 3QH3B 3WO4B 1TJGH 4YHPB 2ADJA 1X5IA 3O4OC 4WI7A 1P7HL 1NGYB 4JO1H 1ZKAA 4D8PB 2QQLL 4G8IB 3CFKB 3MNWB 5T5NG 5FFLA 1X44A 5F1KC 1F11A 4TUJA 5IOPA 3PWLB 5GGTH 2IAMA 4DCQB 1IGFH 4CADB 5AUMA 2YUVA 3MOQA 4PJ8D 1A0QH 1NSNL 5BS0A 4PJDE 4P46A 2JIXA 4L3EE 2R39A 2GFBB 1C5DB 2Z92B 4JCLA 2CPCA 4KHXH 2E7LA 2ORBL 3IDIB 2J12B 1AD0B 4XCCL 2CKBA 2VTFA 3MLTB 1N64H 2AXJA 4NFDA 3RU8L 3FQUA 5I8OH 5IGXH 5FDWB 2R0KL 2YD6A 1CIDA 3SKOB 3OJVC 3T77A 2X42A 5EU6A 1W0WA 3S37H 3ZL4L 1RZGA 5C9JB 2LU4A 4RFNC 4YFEA 3OAYH 2E8ZA 3HR5A 2HJLB 2FX8L 3CXDL 1YY8B 3UYRL 1FZMA 2PXYB 5I75B 3MOBL 1ORSA 1J8KA 3WFCH 1HKFA 4OM0H 1GZQB 2R15A 4X7DC 3WO4C 5KN5A 2BOCB 1FNAA 4H0GA 4KY1L 4F9LA 2WUCH 5DQDH 3FO2B 3TZVC 3BH9B 15C8L 2IG2H 3SDYH 4WW2F 2F53A 1A6UL 5HVHC 3FT3B 3HC0B 1LILA 3QDJD 4R0LA 2HLAA 5D7JB 2NZ9C 2A77L 1OF2B 4O2EA 5I6XC 2ZJSH 3A6OA 4OD2B 3CC5A 4PJ8C 5I66A 3HUJB 4QOKA 3HI1A 3ZKMD 3EO1B 3QDGA 1I3GL 4JREB 3U9PL 1VPOH 5E5UB 4XMLL 4NQXB 4JY6A 4O5LH 4BSJA 4DN4H 2XN9A 3K8LA 4UIMA 3TPUA 1OAZL 5HY9B 3R1GH 2AJVL 2DQIL 5A2KH 5KZCB 5E0QA 3VI3F 2ZUVA 4ZS6C 3BP6A 2D7NA 4X5XB 4F57L 1TQBC 4GG8A 1H5BA 1ND0A 2YUWA 4G43A 4XP1L 4WO4C 2E3VA 2A0LD 2O5ZH 3NACH 5KVEL 5D7IE 3VXOA 2VITB 3BPOC 4PRIB 4Z7NE 1OT2A 1D9KA 1N7MH 4FZ8H 1W0YT 2E7CA 3GSNH 1BD2D 4DOHB 1QSEB 3KYAA 5ICYB 5A16A 4Q6YA 1WAAE 3KG5A 3REVB 4EN3C 4C57C 3VU2A 3X3GL 5D1ZA 4YQXH 4LSDA 1RHFA 5DRWB 3G5XB 3O6FA 1T1WA 2VZTA 1DP0A 4OIIH 5C0RL 2IPKA 4DW2H 4JG1H 5I16B 1YNKH 4HJJH 1JGUH 4M4RA 3HE7A 3EYSH 1D6EB 1DSFL 4XMKH 1T22B 2IEPA 1HSAA 2H32H 3B8SA 3RWHB 5F97E 2Z91B 4HS3B 1V3KA 2Y6SC 3LZFH 1RI8A 1UWGL 1T1ZA 3CVIH 4W4OA 4XRCA 3BP5B 1SVCP 5HHOE 2Q7YB 1UA6L 2MNUA 1MEXH 5SV4A 4MX7A 5HDOA 4CDGC 3DVNB 4JJHA 4X6CA 4WTZA 1LEIA 1DVFC 5LGHL 1NCWL 3OR7A 3C6LB 3PDOB 4YR6B 3QFJA 5HDBF 1QO3B 1MWAA 3AFLA 2FH8A 3FHAA 2CDGB 1NMAH 5DF0A 1TJHL 2YR3A 3RWCA 4PLKC 1IAMA 4I2XE 3SGDH 1OAQL 2GITA 4M3JA 1OLZA 3T09A 5K9JL 5DJXA 2ZKHH 1G7IA 4OZIA 1JPTH 5ANMA 1JWUA 2ED7A 3QDMA 1CGYA 3X3FL 1FVEA 1L7IH 3L7FA 2KQNA 5HPMA 1H15A 4P4RB 3G5YA 1K8IB 5C7XL 3MLYL 2CDGA 3IDNB 1W72H 2JJUA 2EDJA 4PP2A 4AM0B 4L5FL 2L4OA 1WV7T 3OR7B 5D2NC 4XTRD 4DEPC 1XZ0B 1FDLH 3BN9C 3RVUD 2OL3A 2W0FB 1JV5A 4R9HA 5D6DC 4WJ5B 5K9JH 3MLSH 4F7CA 1RZJL 5I1JL 1J86A 3O0RL 5CBAA 2E27L 1BX2A 4P2QA 2EZ0C 2P4AB 1JFQH 2CGRL 4PJ9D 4NO3A 1YEGH 4I0PA 3N1QC 4I0PD 4J8RB 5TE4L 3NIDF 3MLWL 1INQA 3FQWA 4O58L 4YZFE 4PV8B 3HNTL 1PKQA 3MLYH 5F70A 1RZKH 4GRMB 1QPXA 1DVFB 4S0SD 1HILB 4ETYA 2HRPH 4L4VE 4KHTL 4X6BB 3LN9A 5GS2H 2IPKB 3ARGC 5CD5C 2B0SH 1T1WB 3OMZA 1WSST 3G5XA 3O6FB 3LHPL 5JW3H 5F89A 1C16A 1QSFA 1YN6B 3L9RA 2GCYB 1MRDH 1CFTA 1FVCB 1FPTL 4LVNB 1YJDL 4LU5L 4N0RA 1FG2A 1RUMH 3BIKB 5CCKL 1LK2A 2XG4A 5IBTL 1MFNA 4ZMAT 5HHQA 2OCFD 2ZP0T 3IFOA 4PJ7A 1UACL 2I07B 3REWB 3T65A 1XGPB 3OJDB 4MA7H 1A7QL 1KIRA 2IANE 3VFOB 2N56A 3OAYK 3O2DA 5ALCL 4JDVB 2JELH 4NUGH 4BQ9A 4JDZA 1OP9A 3SKNA 4Z8FH 3JTSB 4AIXA 3VXOB 3KPMB 5GIRA 4XNUL 3L3KB 1M7IB 3MRPB 3MV9D 4XPAH 1NDMB 4JO3L 3Q6FB 4QHLA 3UZVB 5GS0C 1H5BB 3ZKXB 4G9FE 2OI9B 1BQHA 1A3RL 1I8MB 3C2AL 5C0RH 4M7JL 4PJHA 3TBSA 1IL1B 4FA8A 1S3KH 4X4YB 4M3KB 1T0MA 3NIGE 1L9MA 5D1XD 3BPNC 4OGZA 1BREA 3WN5A 5EZLB 1K2DA 5E2UL 1CD0A 3QI9D 4WI3A 3HI1B 1J12A 3TNMA 3D0LB 4PD4K 4FQLH 3RWFA 4ZAKC 4D0BB 1KB5A 4O02L 1DLHB 1OF2A 3VA2C 4FQXA 3QDJE 5A43C 2HLAB 4R0LB 2JCCF 1ACYH 5J13C 5BQ7A 1F4XH 3SDCB 4LDLB 2FWOB 4I0KA 4RGOL 3BH9A 2E9WA 3L5HA 3KJ4B 5FHBH 3IJSB 2Q76A 5DUML 3B2UD 1M1SA 5E99H 5IEKA 5CBEA 3S35L 2DL9A 2BNQB 5LAXB 1CXEA 4H8WC 3RUGE 3LKSB 3OX8B 3HR5B 5EOQL 1R3IH 2DQUH 2NLJB 1M05A 2A6DB 1MRCH 1F4XL 1W0WB 4P9HH 3T2OA 4DZ8B 5E4IA 1NEZG 3DRTB 4E41B 1FDLL 1YMHB 1CK0L 1Y6MR 2CSPA 5C0CD 4JQIH 4PJEB 3QUKA 5M7QA 3VFSB 4NQDA 1CGUA 3V7AG 2BXZA 4AT6B 3WFCL 3NCJL 2LQRA 5TF1H 1OM3L 3WBDA 2XI9A 4JPWH 4J3WA 2YPVH 3E6FB 32C2A 1R24B 3CK0L 1IAII 1ZHNA 3HZVA 2JIXB 4HWBH 3V5KB 4C4KO 5MHSD 2CMRL 2H2PD 5L2KB 1DQTA 2DMKA 3S6CA 1GGIH 3SQOL 5JOFB 5I6XB 3SE9H 1IGMH 1FL5B 4JG0L 2H9GB 1F11B 4X7SL 4MD5B 4Y5VA 1IGYB 1YEKH 3MODH 1C7SA 2IMNA 3L3HA 3Q3GB 4WTWA 4Z9KB 4U1JB 2YD1A 1XCTA 1E28A 2YD3A 5IMMA 5TH2B 1G0YR 4Y19A 4PJIE 4NQVB 5IBTH 2APWA 3U46B 5HHVL 1TCMA 1YPZB 3WNOA 2FX9H 4XP5L 4G8EA 4HIJB 4OD3H 4G7YH 4QRRD 2ZUUA 1PQZA 3I6KB 1FHGA 3DX6A 2R69H 5L2JA 4NWUL 1MCBA 4R3SA 2X4RB 1GIGL 1CFSA 5TQ0H 5HTSA 1A7QH 3PWUA 1ODAA 3ULVF 4U49A 3F6IA 4CW1B 1DTUA 1NCTA 4DVBB 5CILH 1EBAA 2K3TA 1XFPA 1Y18A 3MUJA 2Z8VC 3P11H 3DHJA 3WLWC 1MQKH 4G80A 4LVHB 1G84A 4PRPA 1IGFL 4WGWB 5GS1A 4UT6L 3WSQH 4UQ3A 3OXSB 1FZOA 1DZBA 2A6JB 1AO7B 3HNVL 3DPBA 5D7IF 3GSNL 3WNNA 4W6YB 1CDCA 3QRGH 1MIML 2IAND 3RDTA 1NGXA 4Q0XL 5L0QC 1OTTD 5JLZB 4PP1D 2IAMD 3GRWH 5I71C 3KYOB 1HHHA 4HQQL 1LO2H 1IGIL 3OF6D 4UAOC 3CCHA 5D4QA 5FYKU 2GYSA 3WN5C 3JWDC 3S88H 3PQYB 1NUDA 1WFTA 3UTOA 4Q9QL 4M7KH 4DQOH 5IBLD 3TBYB 1DANU 4JHZA 1U91A 1YDPA 1E6OH 1W72L 1FRGL 4A6YH 5A1AA 3KXFB 2ZNXA 5JW5A 3H8NA 2MJWA 4GMTH 1AE6H 2XTJC 2H1PH 4WV1A 3TIDA 1TTFA 1KCSL 2DQDH 4JN1L 4U1IA 2VH5H 5EORH 3VFGL 4ZS7H 4HSQA 5I15L 4K94L 4N8CH 2H8PA 3VD3A 4Y16B 4D0CA 4L8BA 2P47B 3H0TA 3PGDB 1RHHA 5D93C 3I6LE 4NNYA 1FNSL 3AAZA 4CUCA 1BMGA 4FQXC 4GQ9L 2MCPL 2X9WA 4X0KB 2F8OA 1HIMH 4IMLA 4KK8C 4ZDHB 1XMWA 1WEJL 1X4YA 1ZVSB 4XVUD 3R8BB 5I1EL 2G60H 1AGBB 5FOJA 4HKBA 3NZHL 1K3ZA 1OAYL 3BEVB 2VZUA 4U6HB 3T1WA 1P7KA 3C6LD 3C87A 1T1XA 4G6KL 1S7VB 1AO7E 1UQSB 5ADPH 1TLKA 4PJCE 1R3JB 5EUOE 5C0DA 2GSGB 3QNYA 5AEAA 5C9KA 5MEQB 4DGIH 1UZ8B 1MIEH 3NFPA 5TE6H 4K3GA 4S10A 4EI5A 1S5HA 1UKQA 3ULSB 4XCNA 4OCRL 1J9CT 2FBJL 1UC6A 4G7VL 2X05A 1UJ3C 3QXAB 3OG6B 2DWDA 1EFQA 5FO7B 1DBKH 3PWPA 1S9VA 4I0PC 1C08B 5HJ3A 5J57B 2H26A 3UPRB 2MQ0A 3RVWC 5F7DB 2QR0A 3B83A 1LEKA 3H3PL 4R8WL 3MRHA 2ADFL 3MLWH 3JSSA 4KJPD 4KUZH 1QRKA 1GGUA 3SDDA 1EX0A 1XF2B 4MNGA 3KPNB 3KLAB 3QQ3B 3V4UH 2ADGA 1ZHBA 2MPAL 1T66D 4FOMA 1BD2A 2BHZA 4KK8D 2AK4D 4K23H 3S5LB 1WBXA 1NMCB 2FB4L 1JHKL 3MJ7A 1RIUL 4ZO7A 2ATPA 3R1GL 4PJDF 4NFCA 5IB4B 2ADFH 5EU5A 4RQQA 1LO5B 1IT9H 4KZDH 1CXLA 2AJSL 2XQBL 4PJFB 4U1MB 2R2BA 1SQ2N 2AKRA 3IXTB 4PUBL 4F57H 1ZXQA 2DQJL 3H42H 1MAJA 3ARRA 1AI1H 1ZLSL 4YWGL 4M6OH 5FHBL 1UM4L 4S1QL 1IJ9A 3CFIC 3GSQA 3LN5A 1MCOH 2NW2A 3CH1B 3QDJA 3KPLA 1U3HD 4KJWC 4EDWL 4WW2C 5HHMB 4X5WB 1B4JH 3KPRE 4O2FB 1MPAL 4NN5B 2VO5A 5DHVB 3BKMH 1GPOH 3O8XB 3MJ9A 1LEGB 5ADOH 1HXMA 3OSKA 4GAGL 5DD6A 1EERB 3ME0A 4ELMA 1CDIA 3C9NA 2ITDA 3K7UA 3LDBC 2VE6A 5KBNC 3CVHL 4PB0L 4ZSOA 3WNLA 4ZTPL 3O6MH 4G6MH 4HXAL 4IOSD 4JFHE 1MCPL 1A4KA 5D1QA 4H20H 2YBRA 1AGFB 1ADQA 1NC4B 4YDVA 1KENH 2W59A 2EEBA 2ZUXA 2F53D 2VDML 3GJEB 5FCSH 1JRHH 5AZ2H 1IE5A 4AENB 1OD9A 1UM6L 2FECL 4G6AC 3CXHJ 1KGCE 3RWDB 1TVDA 3GMQA 4JAMA 5SWQB 3VGFA 4U1NA 5DVNA 1TETL 4RMUA 3P30H 1CF8H 1M71B 4XBGA 4JFDA 1X6LA 4JRYA 2Y5TA 1NGWA 4BJLA 4WUUD 5CWSA 5EOTA 1IEBB 5SWSE 4EUPA 2A6IB 5E08H 2GAZB 1MIEL 3EYQD 1N2RB 2VNCA 3T04D 3ZHKA 1SEBB 4XBGB 2QQLH 2CJUL 5DR5L 5CGYD 1AGCA 4P49A 2Y9RT 1XIWD 3D85B 3ARVA 2BNQD 1A6WH 1UEMA 1DQJA 3F7YB 5FYJH 1SJEB 1P84K 1JTOA 2P8PB 4JPVH 5KSUA 4GW1B 1FL6A 5C2UB 1BQHG 4W6XB 3ULUC 3EO9H 1NEUA 4YDVB 4EI5D 1EK3A 3QXDB 4LRIC 2YBRB 4Z7VB 2NY5C 5JDJA 3DETD 4F7PA 1CDYA 1NBZA 2NY6D 2I9LB 2A1WH 2I5YH 3SGEI 1A1NB 5BJTA 3QNZA 5AD0B 1HXMB 4NM4L 2YN3A 3QPQC 4MD4A 1LO0H 3FQTA 3STLB 3TC9A 4DGVH 1YEKL 3FOLB 4XVUC 4RISH 1A14L 1RZIA 2JIXD 2FZ3B 2QJDA 2DWEA 1CQKA 4HFUL 3VXPA 1OY3B 4R96A 2FSEA 3WLBB 2V5TA 3MOAH 3VG9B 1B0GA 5HYFA 1M6OA 4M7ZC 1N3NA 4JVWA 2A73A 1U3ZA 1DLFH 4G7VH 4H1LB 3E8UH 5C09A 4HLZH 3SE8H 2AKRB 2DM3A 3LRSA 3P4OB 4X4ME 3DIFA 1FBIH 4Z7WA 1WZKA 1ITCA 1U8PA 2X1OA 2HVKA 3PJSA 3QIUA 4XB7A 1FL3B 1ZLVK 3MV7A 4NKMA 3B9EA 1JHTA 1FZJA 2QTEA 1X5AA 5CCKH 2W07A 1MQKL 2VISB 3C6SB 3JTTA 4JFFB 5J11C 4L9DA 4HIIA 4V1DA 3IJYB 3ROLA 3QDMD 2BC4A 4KU1A 1NFDB 4K94C 5D7IA 1JP5A 1YY9D 3KYNB 1SBBA 3KPNA 4Y1AE 3OWEA 1WEJH 4UV4H 2BFVL 1FYTD 1BFTA 4QXGL 5E4EC 3QEGH 1R6VA 2NYYD 4MSWA 2H3NB 3WEXB 4X5LA 4Z8FL 4PJDA 3S34L 1OGAE 3FRUB 4LSSH 4XBEL 2XICA 2OR7A 4NN5C 1EGJA 2XA8L 1N5AB 3DHMA 3PWPB 4HH9A 2IC2A 2IGFL 2P8MA 5JXEC 1R3IL 4IRSC 2C5DC 4M7KL 1T04B 4M02A 4PJ7F 4ZFFB 2A9MH 3VFRA 1XGTB 1JZ4A 3DX8B 3D2UD 1HQRB 2DQGL 1Y0LB 5B38A 1FRGH 2BSTB 4XCNB 2LE9A 3QO1A 3NFPB 1RUAH 4P3WA 2EE9A 3N1GC 1F45A 1R3JA 4NHUA 1RIHL 1YEHL 2OR9H 4HS8H 4JM2B 3QEHA 1VEOA 3TVMC 1P7KB 1AHWA 5DZNA 1LP9E 1PYWB 3X3FH 1Q9LA 2RJMA 3BEVA 2IFGA 3K4ZA 5C3TA 1X5LA 1OGTB 1AGBA 3SQBA 3MO1A 3VGGA 3P9LB 4Y19D 1S78D 1QYGL 5I1KL 4RRPG 4U6XB 4AIOA 3UZEA 2BERA 2P5WB 1TNNA 2G5BB 4ORZC 4NCC1 4X4XB 1MJ8L 1U95A 2BSSA 5EO0A 4JGMA 3RBGA 3FN9A 1RV6X 2O5ZL 1RVFH 3S4SG 4FFWD 1EHLH 4PRBA 1MJ7H 4LVHC 5H35B 2W65B 4QHUA 4OF7A 4JDTH 4O4YH 4FFVD 4OGXH 3H9HB 3U30C 1X5ZA 1K3IA 5D7JC 1S9YB 5SX4I 1HSBA 3H7BA 2D0HA 3UJTH 4MZ2A 4RAVB 4NDMA 3V0VB 1X3DA 4ZUSA 5D2LB 1MJUH 1OWWA 4MA3B 4YXLH 3AMLA 4JFZL 4NHCH 4RGNE 1DEEB 3VXRD 5C09D 3SOBL 3CLEH 1F4WH 3MUHL 2J88H 4MXVF 3RDTB 3NPSC 3HE7C 2IQ9H 3L5IA 4WI6A 5JR1L 2BVTA 1PKQE 2EO1A 4P5MB 2AJYH 3MRLB 3FO0L 4WEBL 2FR4A 3M17A 1MUJB 4JFHD 2G9HA 3CVHH 5EWIH 4LCCC 1H3PH 2YD8A 3WFDH 4Z77B 1DBBH 1S78C 2FNBA 4PJIF 4ZNEA 1CFQB 1CL7I 4RGND 3VXRE 4LF3B 1VGEL 4HKJA 1YEEL 2DIAA 1RIVL 2V9QA 3CFDB 4UTAH 2BSRB 4NOBA 1U8JA 2R2HB 3W0WD 1QSEE 5DT1L 1K8DA 1MI5E 5DMIH 3MYJA 3PGFL 4G42A 1ZLSH 2VL4A 1ZLUH 1PQZB 2DQJH 3H42L 5D1XA 3RVTD 4M61A 5C0IA 1WJ3A 1NEZA 4GAJH 3F7VB 2UWEE 5KSVA 2DQHH 2UWEF 3L3IA 5INCA 4HWNA 4G8GD 3KDMB 1CD1B 1CDUA 3ZKNC 5CD3A 1G7QA 2D7TL 5TH2A 1AXIB 3DV6B 5IB1B 4RFNB 4MAUH 2DRUA 2YS4A 4OZFB 2DLFH 4MS8C 1G6VK 3U4EA 3G6JA 4MD5A 4O02H 5J1AB 4MA8H 5C0GA 1JPTL 5D2LE 4FTVD 3GB7A 3PHQA 5HHMD 4MAYC 2HP4A 4JFDD 4AK1A 2F15A 4ODBD 3RGVA 2HFFB 5FM5M 1VFMA 1B4RA 1A4JA 2B7DT 1J11A 3BDBA 4ESKA 3BO8A 4MAUL 3T4AA 2X4NA 5FHAH 2ESVB 3FTGB 1VERA 4Y1AA 5LCVL 3K81A 4X4MA 4PJEA 1TJIL 3VE0B 5L0QB 5T3XD 1YMHA 4BZ1H 1UCBH 5C0JA 2CK2A 2A74B 4MNQD 3UTTA 3QUYD 3B8YA 4TVPD 5HGGS 2XPGB 5DEFB 2R1YA 1U8IA 2VR4A 3ZE2F 3QUXB 2MCG1 2RCSL 4UINH 1BOGA 3B4NA 3DYMA 4CU8A 2B1AL 3KLDA 2VL5A 1FZKB 4JPWL 1T2XA 4OZGB 3GNML 1I7UB 5DVKA 2R0LH 1IGTB 1EHNA 2O5YL 3QBTB 1DBJL 4CMMB 2OTWB 4M1GL 3FO1B 4LBEA 4UUJB 3PWJB 5F96H 3TBVB 4OV5A 3RVWD 3SDCA 2B5IC 3NZHH 3T3PE 1QFUL 2X4QB 1C8PA 4R4FL 4L8CB 1MCCA 4E0RB 3DRQA 1HKLH 4Q7DA 3GMLB 1TTUA 1OAXH 4G9FA 1QLRB 4OZIF 5JQ6H 3D5OF 5KVGL 3CMGA 4P2RB 4JFZH 5GSVB 1BZ7B 2HG5A 4LP5A 5GRJL 4YHOL 1XGRB 4JZJA 1IL1A 2GIYA 4WFED 4RFEB 3RX7A 1A2YB 2ESVE 1CFNA 5CS7A 4H1LH 1HN1A 1Z5LB 3FB8A 5ITFB 1MSPA 3U9UB 2X09A 2CH8A 1JUFB 4LHUD 4RISL 1CGSL 4N0FA 2XYCA 4PUBH 3QG6A 5C0AE 2P5WE 3UTQB 4GAYA 7FABL 4JDZB 5DT1H 4XPGH 5DK2B 4W81A 4X6DE 2X4OA 2P5EA 2QADD 5EC1A 4ZUWA 2M2DA 3D18A 3TT1L 4JJ5A 1U8KA 1KJ2H 4LRIA 2SEBB 3TBWA 5BOZG 2Y25A 5MP6H 1SY6L 3TESA 4FQLL 1J0JA 3DETC 4POUB 4YUEH 5I1HH 4EVNA 3LEYH 1G9EA 1FAKT 1BFOB 5D2NE 5F88A 4NJAH 5EBMA 5E03A 4OBRA 3ZL4H 5JR1H 2DLFL 4IS6B 2NXZD 3DUUB 1JYVA 3CPLA 3KLHD 3MCKA 3IAQA 5J12B 1S7XA 2FLBT 3NCYP 1A7BA 5ID0A 2GUOA 3IU4H 4JY5H 2HH0L 3QHTC 2YD4A 1KB5H 1HILA 2ERJC 3ECBB 2KDGA 3GMMA 3K0WA 4BH7A 3V6ZA 1HQ4A 3IRZA 2VIRB 4JFFD 4MA1C 4PV8A 3FQWB 1NANI 1PD6A 5IQ9A 5E6ZA 3OQ3B 1HHGB 2VLKB 1MHPL 1D5XA 4LSQH 1VB9A 3EGSB 5IM7B 5EZJA 4RWYL 2W0FA 4NNPH 2X4SA 4G9DA 5BV7L 3QUZD 1XZ0A 3T8XA 2W9EH 3SDCC 5HHOD 4QWWC 4BELD 4LCIL 4AM0A 3FB7A 3RUGA 1Q1JL 4OQTA 1ONQA 2YWZA 3DSFH 3IDNA 3X17A 1G7HA 2VDNL 3D0VB 1IGCH 5D1QC 4NPYB 4WNQA 4CRPA 4P3CL 5I30L 4FQIL 3UBXB 1SYVB 3RIFK 3RZCB 1I85A 3KYMB 1P5VA 3RY4A 2P49B 1X5FA 3LQZA 2Q86A 1ITBB 2X44D 4OSUL 2IBGA 3QJFA 4FZEL 4AY0A 2XOTA 2FIKA 5KS9B 4NQSA 1TETH 3QZWA 1MWAB 4Z7VE 4PGEA 4EXPX 3QDHA 1K6QL 5FB8B 4XCYA 3EOAA 2NQCA 4MB4A 2F74A 4LHUA 2VN4A 2COQA 2FX7L 3BP5A 4GH7B 4EDWH 5I0DA 4Y89A 3MGOB 1FFNB 5INDB 3IFPB 4KKCC 1KF9B 3WIIH 2EDTA 4FQPA 3LQMA 2CIIB 4OCMC 5D7LB 4YFLI 1GXEA 1V5JA 4H26A 1YECH 3TJHD 4YO0B 5GSRB 4LSPH 2D31B 1U8NA 1YUHB 3JBG7 3D39B 5I16A 3ZE0F 4NNXB 3V79C 2IFFH 1G6RL 1PDKA 2OQJA 3MGTB 4KVNL 1RPQA 1DN0B 2EKJA 4BK5A 3EIFA 2X1WL 1KELL 1RJLB 4NZUL 2Z4QA 1RJLA 2VDMH 5E6IA 4LLAA 3GSNB 4QHNA 2C4FU 3UTTE 1AKJB 1DN0A 3S96A 2OMNA 3MGTA 5FA4B 1N5YH 2AJYL 4U1LA 3SDAC 4OZGE 4NIKB 4WWKD 5C0EA 4HUVA 2Y06H 1JPFB 3PGCA 4NC2B 4LSTH 1YEIH 4GFTB 3SCMD 1UGNA 2K9UA 1BEYH 4IIQA 3T0EE 2XKSA 2NY3C 2J6EL 3OJ2C 2VITA 5DMGD 3DXAB 3D6GA 2D3VA 4LLYB 3IFPA 4YX2H 3SDXB 4MJ6B 1T3FB 4KK5D 2VDPL 5LGKA 3RTQA 4JN1H 4URTB 3VFWA 1YNKL 5KSAA 2I26N 3BESR 3WS6C 3M8OL 4N0UE 4WEUD 4XPTL 2H41A 4O2CB 1G7PB 1VADB 2B8OT 4Y1AD 1Q38A 3HUJF 2P8LA 3BP6B 4XCEA 4JKMA 4PGEB 5J7CC 3V52H 5GJTL 5KS9A 3BYYA 1BEYL 3KAAA 1YEDA 3IF1A 4JY6B 2AQ2A 2IWGA 3H9SE 3QJFB 4DZBB 2G60L 1TZHA 4RWYH 2NMSA 3GFUA 1ZHKB 3QDGB 4O51B 2EYTA 3CFJB 1IAOB 4L3CB 2IQAA 1AR2A 4S1DD 4ODVH 3BKJH 5EUKA 3UBXA 2V7NB 3VW3H 5D7JA 1K4CB 4MA1B 2HT4D 5E8PA 4ENED 4K8RH 4ZXBB 1GGTA 3EDDA 2F54B 4WW1A 3CZJA 4HGMA 1ONQB 3U0TA 4EJ1C 1MFCH 2EH7H 4Z78A 3NIDE 3U79A 5IEHB 4JGUA 1VHPA 1T7VA 3EBAA 4FTVB 1IKFH 4OD1L 1ORSB 2XWJB 4NQCE 5JA9A 2PXYA 5T1DH 1HHGA 1FN4B 5F1SA 2H45A 1YY8A 3QR2A 3RIAK 4AIZB 4WHCA 1VFAA 5IQ9B 3LPGA 3FAWA 4X8JB 5EG6C 4I48B 2VZ1A 3U9PH 3TFKC 5JPNB 3O2VL 3KHQA 1MFBH 1BBJB 1C5BH 4L3EA 2FX7H 3VXQB 3BP4B 2DI8A 3EYOA 2UZXB 4TSBH 5T33L 4F2MB 3MLTA 5K9OA 2CKBB 3C08H 5D70H 3MCKB 3IS1X 4L8SA 4GG6B 3CPLB 1XT5A 3ARFA 5DFWH 4HWUA 2XN9E 3QUXD 4NRYA 5CP7A 2MFNA 4P46B 4MWFB 5HPOA 3VFTA 4BFBD 3IETB 5FYKL 4HDIB 4P3CH 5I30H 1IKNC 2JB5H 1U42A 4UBDC 5LXGH 5FUOH 3GZKA 1UYWL 4KKBC 4PJCB 4XWOC 4JFEA 1IT9L 4A6YL 5GRVL 1MFAH 2R2EB 4CJ1A 3ZDXF 3STZB 3FT4A 4QXUH 3NOIA 3TNNB 3UTZA 5JQ6L 3BJ91 1XF5A 2LAGB 2D7QA 1X9QA 1ZTXL 5EPMB 2EXWC 4QRQA 3RGHA 4N0FB 3CLFH 2WQ8A 5F7WC 2VLMD 5DJZA 3X14B 4RSVA 3C8KB 4OIBA 3C5SA 4OGYL 4N0CD 1BQSA 2QSCL 4RZCB 2PO6C 3MUGA 4DUVA 2ID5A 3MRIA 3BGFC 1G9MH 3PL6B 4RFEA 2OSLA 4XNZB 3QFDB 1IKNA 2A83B 3I6GA 5K93A 3GBNL 2R1WA 3RY5A 1A6ZB 1JHKH 3WUZA 3WNKA 4NO5B 1PSKH 1V7MH 3HUJE 4K7FA 4X6FA 5ISZA 5I1KH 3QEUA 5TPWL 3QUXC 2YEZA 4OCYH 3W9DA 1OT1A 1BAFH 5GGTL 1CICA 4LPXA 2HT4C 2CR3A 3RUGF 4F33A 5JW4Q 2IH3B 1ADQH 5I17B 3FO1A 4IRZH 4LBEB 4ZSOE 1IC4H 5DJDA 1IGTA 4YIQA 1EZVY 1G0XA 5IMKA 4NO2B 1S8DB 2IH1B 5IB5B 3BHBA 1V7ML 3DARA 2HA1A 3FFDA 2V2XB 4HPYH 4JM2F 4ZQKA 5JORB 2R1YB 2V2WB 4DVRL 1NBVL 1HIML 3UTTB 1RMFL 3MV8D 3KPSA 5GGRY 2DQIH 4CN4A 4GAJL 4U0RB 1WAAA 2PO6B 4Q6IA 4HMCA 4RGOH 2UV3A 5F7YC 1IC1A 5IK3B 5IG7A 4XC3L 1MFCL 2DAVA 2EH7L 5D6CB 5DJCA 1UJ3A 4KQ3H 4WI2A 1I75A 4F15B 5ADPL 4AG4L 1KT2B 1HK6A 5ICZB 3L5XL 2GSIA 5FDYA 5FUZH 2EICA 3BVNA 5GGRA 3MLUH 5IMOA 4XVTL 3F5WA 2AI0H 4MYWB 3ULVL 2WP3T 3EFFB 4FRWA 3P77A 4N8VA 1A1OA 4LGSB 2ZG2A 3NFSL 3PHQB 3GSXA 3GB7B 3W11C 3LKRB 1F6AB 3IYLW 4Y4HB 4B41A 5FGCE 4F7TB 3O41A 3FQNB 4PLOB 4UTAL 3EDKA 5IHUH 2DBLL 2DD8L 3I6LD 4P23C 3GSRB 4L29A 1H3GA 2YD7A 1T7XA 3MRRB 4OGAC 5JNYA 4NC1E 3L3IB 2EIZA 2OYPA 5C2BH 3BKML 3QIBB 4P2RE 2R1XB 2V5RA 1JN6B 2VXVH 4H5SA 4HMEA 4QRPE 5IFHL 1UVQB 4WENB 3ZKMC 2APVA 4KRPD 4WHTB 3GJFB 3AREA 4Z5RB 1HOCB 2VLRA 4LSVH 5F1IB 2WWMC 5I9QB 2FATH 4XH2B 1XF4A 5BZWA 4MAYD 4QGTA 4OFDA 2EDNA 2A1WL 2G9HB 4CMHB 4G7YL 4NQCA 3MGAA 2FR4B 4RA0C 4KK9C 3RJDA 4UI2A 1ZT7B 2AXFB 3EDJA 4Y7MA 1GC1C 4GBXA 3C60D 1CD8A 2A6KA 1M7DB 3GMOA 4R4BB 1CLCA 4QYOA 5EN2A 4BZYA 1QTYT 4ODVL 3G6AA 4CU7A 2PYEE 2NTFB 5ESVB 5KSAD 1HH9A 2C26A 1A1MA 3TN0D 3LH2L 4ZAKB 5SWSB 4Y88A 4CVXA 4HCRL 4JZOB 4HHAB 3X11B 1IC4L 5GGQL 1EIBA 4TSCL 1ZMYA 5IVNA 1T5WB 1ZSDB 3SE4C 5KSBB 2Z31B 1EUTA 4Y5XC 3S35H 2NY1D 1Q9WB 4PRBB 5SWZA 1HINL 3SCMB 4XPTH 3WIHA 4KRPC 3MLRH 5EO0B 1OGAB 3S98A 3TH4T 3V6FA 1CLYL 3HG1E 4HBCH 2UZIL 4NKOA 4J6RL 1K4DA 5CSZB 4WUKH 2YMXH 5EWIL 2XFXA 4X7FC 1CT8B 1MWAL 5HHNB 2XZQL 2DJ4A 4KTYA 2HTLC 1FSKC 3KPOB 3HNTH 4BQBA 1RZ8A 2AEQL 4OCNC 1NUGA 3KWWB 3MV8A 3O6LL 1P4IL 1PGRB 4LLWA 2PUQT 5L8JB 3BP7A 3Q6GL 3QZWG 3MREB 5JW3L 4M5ZH 2BP3A 4YK4B 5IWLA 4LVOC 4QRRE 2BNRA 3MNVB 2AABL 4PB9L 1D7FA 3SY0B 1JPGB 4MHHI 2CQVA 4KVCL 3WFBL 2AXGA 2RCSH 3CDGA 2Q8AL 5H2BA 3B9DA 3A67L 1N6VA 5E1AB 4HUXA 3RL2A 2Q3AA 1JYWA 4LCWB 1IFHL 1QBAA 3O6FC 4DVRH 1LO4L 5KSBE 4PJDB 3TF7C 1I8KB 1IQDA 4M1GH 3ULVE 3IB4A 2HT3D 2BDNL 2H3NA 5MHSE 4ODUA 2GJ6D 5C6TH 2G5RA 6FABL 3OKNA 1AIFB 2QL1A 4HV8A 3FONA 1R0AL 3KYNA 4YDIL 4RIRB 3WE6A 1MF2L 4V1DB 3L5XH 4HIHB 1EEYA 4OCWH 3OKOA 3C6SA 3JTTB 1DBBL 4JFFA 3HNSH 3RJQB 3QUML 4DGYL 1NFKA 1QBMH 1EVTC 3GMRB 3MV7B 4NKMB 5C0BA 3RHWK 3C6LC 5EOCJ 1FVDB 2F19L 1U58A 4D9LL 4XNQA 4QTHB 4LSVL 3LN4B 3HMXL 1GRWA 1CZ8H 1U0QA 5LGJB 4R7NB 3WJLC 1FGVL 3V4PH 1KN2L 1LE5A 3SO3B 5FGBC 1CXFA 1FH5L 1F2XK 4QRTA 4U05A 5I1AA 4OFIA 3BUTA 1IEAA 1LMKA 2X4UA 4WEMB 4G8FA 3GJFH 5JIIA 4X9BA 4P59L 2W0PA 3GNMH 2EE6A 4ODTL 3MA9H 4R96B 4E41E 3S7GA 1WC7A 2VLJA 4DUWA 2ZUTA 3T2QA 4R97B 2G2RA 3RP1A 4PJGF 4B7IA 4IOIB 1KTRL 4OGAD 5GJSL 4PRAA 2D9QB 4MD4B 4FFZL 1QZ1A 5DRZA 2O26U 3HE6D 4Z95H 3UTPD 3G5ZB 2WZPD 4KAQL 4F7PB 4HJGA 5HGBA 3QXDA 4PJGA 3IDJA 3ILPA 3MACL 3NIGF 2AEIT 3V8CA 5DJ8B 1FL6B 3HPLB 3WE6B 1NMCC 4PTTB 3L6FA 2AV7B 2BSED 5CJBA 4X6DB 1GGCH 4K7PL 3ILQC 5LJYH 3ARGD 2FRGP 3ETBF 3I3DA 5E8EA 5ADOL 4YHNB 4TUKL 2J6EH 2DM7A 4QHKI 1WIPA 3D25A 4J6RH 2Y1VA 4FG6D 2PETA 3ISWA 4YXLL 5DVLA 1SBSL 4OLWH 2AJUH 4JQVA 2BMKA 3ARGA 4Y5VC 2FD6H 5H37H 1JFQL 2CKBL 3DMMC 3EOBB 3QDME 5EOTB 3UP1A 2I9TB 3MYZA 4GRLC 2ATKB 1YEJH 3BDXA 4K9EC 4GKSB 5BXFA 5KVDH 3MJ8A 4P4KD 4RMSA 1ED3B 4JRYE 2IBBA 5SWZD 3GKWH 1IGJB 2C3VB 5T1KB 2BNRB 5J4MA 4PD4J 3OKKA 2DQFB 4M5YH 3VWKB 2G75A 3X13A 1SHMA 3OBAA 5DEGB 2NW3A 3DROB 5HVGB 1SEQL 3PV6B 3QXTA 5FKAA 3GHEL 4S1RH 4WI4A 3MBEA 3NCEB 3WUWB 3O2DL 3KWWA 3MV8B 3O9WA 3G04B 1S7QA 3TZVB 5CD5D 1EFXB 4GRWH 2P1YA 3AY4C 1L7IL 1JWSA 1U8MA 2NY0B 1N8ZA 5D1QB 5HGAA 5D1ZD 4LIQE 1CDBA 4JZNA 5H94A 2XQYK 5BMFH 3RTQD 5IF0A 3BD3A 5F71A 4Y2OA 4MS8D 4ZUTB 4ELMB 4OZHB 4DKEH 2C1OB 5IROA 4GW4A 3ES6B 3HG1B 3MRDB 4KMTL 3LIZH 5DHVA 4TOYH 1G6RA 2OL3L 2C3GA 2BHUA 4I3GA 1YN7A 3ZSSA 2E27H 4MCZA 3MOBH 4JFQB 3E6HB 3WS3A 5CINL 3QDJB 1A6TB 4GG6F 4LLVB 3A0OA 1T5WA 3QCUH 2O5YH 4KK6C 2FLRT 3ZT6A 5EU4B 4QCIB 5HI3C 2H32B 3BPLB 1HNGA 2Z8RA 4ZAKA 5SWSA 2GJ6E 4MD0A 3ARDC 1FCCA 4U1MA 4P23A 4QT5A 4PV9B 5EIVA 4JFYB 2J5LC 3G6AB 4TNVK 3T0EA 1U92A 1N0XH 1ULVA 3B43A 4Z0BL 3EO0B 5ECJE 1CQYA 3U6RB 1KJ2A 2P43B 1PZUB 4ODWA 2Z8SA 2JB5L 2R8SL 1TXKA 3DX7A 3C2SA 3LKNB 1I1AD 5GZOD 3OXRA 3VI4F 25C8H 1D5MB 1UYWH 1XF2A 1Z9OA 5FM5O 1WWWX 3VWJB 1OOAA 4GQ9H 1U8LB 4RRPA 3HS0A 2PW2A 3Q48A 3WO3B 3GHBH 4ONGH 3TWCH 2Q6WB 2VUYA 3KPRB 4ZG1A 2VLRB 4MAYB 3KPPB 1KPRA 2YSSA 3KPSD 4Z5RA 4NRXB 1P9MC 4LVEA 3O45A 1X6NA 4WHTA 4U6YB 2BZDA 1FGNH 3MRMB 1R5IA 3VXME 4QNPE 4XGZB 3QXAA 3FN0L 4F58L 3M1BB 4LQ1A 1AI1L 4P9HL 3MA7A 5GHWL 4BSWA 5T1LD 3FB6A 3GO1H 1MCOL 1A6AB 4GXVH 1KEMH 1NCBH 3ARTA 1A3QA 4FFWC 4CN1A 1FIEA 4PTUA 1QR1B 3TN0B 2YC1A 3W81A 5GGUB 2IPTH 5EORL 4KFZC 4OLZH 5FKPB 5E94B 4YXKH 5H8DA 2A9NH 1KJMA 3I3EA 5T3ZH 4F7TA 4KPHL 3BMWA 2JKXA 5MERB 4Y4HA 1OAZH 3VXNA 3SDXE 1NLBL 1UM5L 5JA8B 3P77B 3EFFA 3BAEL 4ODHL 2EYRA 4X0KA 2LFGA 3GHEH 2X4PA 4S1RL 4HS8L 1U8HB 2YK1H 1KENL 4JPVL 1IC5L 5HYSG 4LSUH 2VQUA 1OAYH 3MLPA 3RPIB 5ICZA 4PJ8A 4TQEL 4XP4H 4U1GC 3H0TB 3IGAA 1UJ3B 2C9AA 3BKCH 3KPTA 4Y16A 3TM6A 4D0CB 1RULH 2WIMA 2L7UA 2H8PB 3L3GA 3VCLB 1ROWA 3H9SB 3G9AB 2PO6A 4GSDH 1S7WB 1BM3H 1QHPA 4J3OC 1KCVH 2OXHA 3BD5A 4LCCB 5TJWK 2O61A 3FZUC 4LKXA 1QFWM 1HH6A 4OCSH 4NQTA 3CZFB 2DLIA 1B6DA 2V2WA 2BOBB 5DFVC 3WUWG 4I1NB 5B39B 3TBYA 1P4BH 2BVPA 1HKLL 5BRZB 1H3TA 5EA0H 1JPSH 2XTLA 3MV8E 4FQIH 4EN3D 2VN7A 3L3JB 3W9EB 4FG6C 5LG1A 1E6JL 4DAGH 2PCPA 3TO4A 3L3OA 4PJ9C 1JGLL 3QIWA 3BDYH 1VA9A 1A3LH 3MQIA 5EBWA 4PRDB 1KLFA 4YFDB 2VQ1B 4P5TC 4OIIL 1HEZA 4GRWE 1CICB 4XBPB 3SE9L 5CINH 3D9AL 3QEUB 4X6FB 5ISZB 3BGAA 3HFML 1ZK9A 1PFCA 4XNYH 2ED8A 3T0AA 1N0XL 5EZOL 1XF3A 2IALB 5IHZA 2I60H 3ROOA 1NAML 4NO5A 5C8JA 2XTJE 4MQSB 5JHLL 4G80B 1EJOL 4XVJL 5J3HC 3AM8C 4DVBA 1URLA 4CW1A 3MPCA 4BFEA 2A83A 1GOGA 1RJZA 2OSLB 1OLLA 3N0PB 3ARDB 3MRIB 3UC0H 4R3SB 1FGVH 3V4PL 2QSVA 5MEOB 1QSFD 1QVOB 3C8KA 1RK0B 1RSFA 2VDNH 1EXUB 5AAMA 2H1PL 1LD9A 1MJJB 3OKMA 1WISA 2AXHA 1YPZA 4M6OL 3RAJH 4MLSA 4BQ6A 1ZANL 5D7SL 4Q9RL 2ORBH 5HVFB 5IMMB 1YNTB 1X5JA 2WINB 3L3JA 5D5MB 2EEDA 1MAMH 1QQDA 3HMWH 4JFEB 1FL5A 4GQPH 4WGVB 5JOFA 5L2KA 4K8RL 2MKWA 5TDNA 2FJFA 4E42B 3QQ9D 4PJHE 4FABL 3MSPA 2W38A 2LV4A 5EU3A 2VB5A 2BVQA 1EJ6A 4ALAL 3ZDYF 3H9SA 1MCEA 4JRXB 4PGBA 3IT8D 1AGDA 1FC1A 3PP3K 2OZ4L 1FE8L 3HE6B 2VDKH 4F2MA 4M03A 2AEQH 3BP4A 3EYOB 2ICWJ 3VFSA 3QUKB 1T4KA 2J8HA 4HC1H 3OB8A 5ALBH 4QGYA 1BWWA 1KJVB 3T08A 4FN0A 1HNFA 5CKAA 5CLTA 2BY1A 3DRTA 2QBWA 2E9IA 2AJXH 4X8JA 5L9DH 5DJ6B 1VEPA 1XR9B 4LOUD 4J3VA 1F3DH 4KZEH 4OV6F 1UXWA 5IP4A 1FO0H 4YBQD 4M8VA 5LAXA 3ZE1F 1O7VA 4X6CF 5E94A 3AU1B 5FYLE 1CGVA 3QA3A 3VH8G 4HC1L 1F3JB 1PKOA 4ODSL 5T5NF 3CFBB 4EEEA 4N5ED 4Y19E 3F65A 4JKKA 2XZQH 3PABA 2FWOA 3VXUD 4F9LC 3R0NA 2D2OA 3P9MB 5E8PB 2YMXL 1T0NB 1YNLH 5HDQL 3MA7B 2V7NA 4DAGL 3OJMB 2IQAB 4PJBB 3RWGB 2R0LL 3K3QA 1R5IB 4RFOH 3BH8A 1I8IB 3UJTL 2HTLD 3WXVH 3LPWA 4WO4D 5JPMA 3HI6H 3CFJA 5C08E 4O51A 2O5XL 5DO2C 3I2CH 4P99A 4DZBA 1PLGL 5DJAB 2P24B 4MMZC 5IJVB 1T0MB 3TVMA 3VRLE 4PJHB 2D4FA 4WFFE 4JN2A 4PR5A 4XXDB 2WBWB 4RMRA 1BQHB 1D5MA 3MMEB 5HYSB 2LABA 3OXRB 3CVHA 4M48H 2FGZA 5E2VH 4TOYL 1JBJA 3RTQB 3KPMA 5GIRB 5E2JA 4XZUB 4N1EA 4ODWB 2NXYB 3SDXA 3JTSA 4LLYA 1KNOA 1ZT1A 1FIGH 1JK8B 1HYSC 1MCSA 3H7LA 1X5XA 4JEGB 3RVXD 3BRDA 1TITA 4XWOD 3DMMA 5DMIL 3CFCH 5DRXB 3T0EB 4ZFOB 4YHOH 4HUVB 1BGXL 4MXWL 1HCFX 1ZA6B 5EUOA 1KBGL 2CUMA 4PJ7B 1AQKL 5HHQB 2EXYD 2VC2L 4QLRA 1DN2A 3VXMB 4PJXB 1V3JA 8FABA 2WBJB 4C54A 1KJ2L 3I9GL 4YHIB 1CFTB 2XTJD 4ZOAA 3LV3A 4JFQA 2DBLH 2VYRE 1J8HB 2ARJQ 1YN6A 3S35X 2VDOL 1MLBB 1UM6H 4S2SA 4UU9B 1GGCL 4MB5A 3WIHL 5I0ZA 4NNXA 2XZCH 4LIQH 3HG1A 1HHKB 1H3PL 4X6BA 4HCRH 3DTXA 3UTSA 4BH8A 3LH2H 2X5PA 4GRLA 1AC0A 5B4MD 3S34H 4ALAH 4JZNB 5H94B 4PRIE 4OLWL 1JVK