2PYFA

Crystal structures of high affinity human t-cell receptors bound to pmhc revealnative diagonal binding geometry unbound tcr clone 5-1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
205
structure length
205
Chain Sequence
b'KQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGSSTLYIAASQPGDSATYLCAVRPLLDGTYIPTFGRGTSLIVHPYIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPDTFFPSPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-Cell Receptor, Alpha Chain
molecule tags Immune system
source organism Homo sapiens
publication title Crystal structures of high affinity human T-cell receptors bound to peptide major histocompatibility complex reveal native diagonal binding geometry
pubmed doi rcsb
total genus 37
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2007-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2pyfA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2pyfA02
3P30L 4JQIH 3VXTA 4FQHB 4M7JL 5DFTA 2Z93B 3W11D 3MV7B 3LQAC 1SM3L 1IZJA 4TQEH 2DQDH 1CZ8L 1FZMB 4I2XB 3MPCA 4TN9A 5CMAA 2IBBA 2YD5A 4BH7A 4XAWH 1QKZH 3VD4A 4HIJB 3OKDA 5GGTH 1U8QA 1MHPH 5AD0A 5MERB 2FEEL 1KIPA 4TUOB 3VXNA 3WNKA 3ARBD 3HI1B 2HTKC 4JR9H 1RIVL 2XN9E 3MLWH 4BUGA 1N5AB 1U91A 1XR8B 4JFED 4WUKL 4H20H 5C3TA 1JNHA 2VO5A 3OKKB 3V5KB 2GT9B 1MCJA 2PYEB 4WNQA 4PRHA 2ERJB 3FB8A 1ADQH 2J3SA 2R0KH 3MUGB 3DMMA 1P5VA 1HSAA 5F7UA 3CNKA 3GHBH 2ZJSL 4I3SL 5ITFB 5KSBB 1MH5B 5I74C 3QUYC 1IAMA 3O3BB 4XB7A 4M61B 3ARED 3ULUE 4JFZH 1OP5H 4NQED 5D7KE 1MREH 2FX8H 4PP1D 5C9KA 1IC5H 2WBJD 3C6LC 4RMRA 1U8IA 3PWPD 3SY0B 2RFXB 4NBXB 8FABB 3UTOA 3STLB 2HWZH 2UVEA 1KFAH 3D5OF 4U7SA 3GM8A 5DJ0A 3T77B 4ZOCA 1AJ7H 4HKJA 4X6EB 2NY0C 5DRZA 1CGVA 3G6JE 4X98A 4TTDD 3ECBA 3O4LE 1CDIA 1EAJA 3UMTA 2QEJA 2F53A 5DRWB 4LPUA 3RUGF 1E6JL 2PO6B 3RWEB 2IQAA 4P4KC 1RURL 2QSCL 4LLQB 3O2VL 3AROA 3JVGA 1NMCC 3BWAA 3RNQB 4XMPL 4PJCE 1EFXB 1JWUB 4MCZA 1S7XA 5D2NB 4DZ8A 2A6IA 2IJ0C 5FKPB 5LXGH 1XF4B 4AIXA 2D9CA 4JPKH 1NCWL 4O2FB 3JWOH 5CJQL 3ZKSD 3O8XB 1G6RH 4KTDH 4XAWL 4KMQA 3QUXD 3MCLH 4HS3B 2UWEB 1BAFH 5EZJB 4WWKD 5C0ND 3QZWB 2BFVH 3MYJB 2X44D 4XC1L 1OM3H 5JOFA 2KL6A 2YS4A 4JFFE 5FGBC 1KCUL 3LRSA 4CKVX 3SDAC 1JRHH 1R24A 1T66D 2E8ZA 3OPZH 4CVWA 2EXYC 1U2HA 4JVUA 3D18A 3DETC 1T83C 5FYKE 4AEIL 5JHLL 5KZCB 2PW1A 1YMMB 4X7CC 5HHOB 4XPTH 3UTSB 1G84A 2YA0A 3U7AA 2ORBL 5E2WH 2VDQH 3CFJB 3F7YA 3T0WA 3UJJH 3LQZA 2XY2A 1JI2A 3SCMA 4F57L 2BNRE 5KSVA 1DQQB 2D7NA 4N1HB 1DLFL 5CWSB 5AYUL 5LAXB 1F97A 2PTUA 1I9JH 1PZ5A 5F6IC 3SKOB 1NSNL 3DRTB 5I19H 4S1QL 4YHOH 3P4MB 4JKLA 3WYRA 1NMBH 3QUZC 5GGRB 3P9LB 1CFBA 4CDGC 2RIKA 3DHJA 3L3JA 4MQ7B 3C08L 3GIZL 3FO2B 3T0EC 3CXHK 1M6OB 5EO9B 4LKCA 2YPKA 3WO4B 4P9HC 4PJGA 5DJ8A 2YD1A 4L8DB 5C0CB 4PUBL 3BX7C 5E70A 5ACMA 2ZKHH 3GUTB 3JWOC 3PGDB 5D7LE 2R2HB 3UPCA 4K3HA 3LZFL 3TZVC 2DIBA 2VR5A 4OFPA 2KZ1B 4KRNA 2IANA 5DQ9B 3MUJA 3VCLA 4U0QB 2AV1B 5DHVA 3TIEA 1ODAA 3NAAL 5C0BB 4Z7WE 3X12B 3WFDL 1E6OL 4ALAL 5EOQL 4N90E 2OM5A 3SDXB 3RRQA 2OTWB 3VXQB 3TBSB 5ALCH 2NTFA 2J88H 2EXWD 1ZVHA 5C07D 3PGFH 4X6CB 5J7CC 2PW1B 3ALXA 4P0DA 4NQCA 4NO2B 4XP5H 4Y19D 2P24B 3B2UD 3SGEH 4JZOB 3N85L 4RMSA 4YQXH 1N4XL 3IJYA 1BQLL 2HJFA 2VDKL 3OTTA 1OGTB 1NGZB 5DK0B 5DZOA 2O5YL 5GGSB 4YHIA 2APWA 4R7DA 4G8IB 3UTQB 3T2PA 1F3JB 4M5ZL 1SVZA 5IROC 4I48B 4Q97A 1JFQL 1ROWA 3I85A 1DUYA 3NVQA 1CK0L 1S7XB 5D2NA 1I9JL 4NZUH 2YA1A 4EUPA 4A2LA 2ZZUT 4P3DB 2XFXB 5FAAA 4MA1C 4UAOB 5GS1B 5E6IA 4LDLB 4P2OB 2XYCA 3KLHD 4D9LH 2GITA 4GQPH 4OZIA 4YR6B 4P23D 2Y06H 2ERJC 4ZPTA 3WD5L 1A0QL 2F53B 3RVUC 1AIFB 1VEMA 4HQQH 2H41A 1WGOA 5T3ZH 1WZ1H 3S88H 1NEZB 1CICD 2FLBT 3OF6A 1HHHA 4RRPG 1W0VA 4L4TA 1FNGA 1RQ5A 1PX4A 1Q94B 3GSWA 3MBXH 2UWEF 2BNQD 1P5UA 5IB1A 1XR9A 1WWCA 3BXNA 4PS4H 3MNWA 5AZ2H 2F5BL 2AQ3A 5JIPA 3NFNA 1SJEB 4OM0H 4OFIA 3S4SG 3KJ6L 1H8SA 4PJ9B 1NAML 4ZFFB 2XKUA 1GHFH 4PGCB 4NBZB 2HJLB 5C7XL 4X4MA 3WMSA 3QQ4A 3BKYH 2VDNH 1T6WA 5IHBA 2VABA 1KB9K 2EH8L 4H20L 2VXSL 4O9HL 1IGCH 3PWNA 5FYLE 1JNHB 3MZGB 1ACZA 1MQ8A 1WBXA 5FK9A 3EZ8A 3HI1A 4ZS6D 3K8KA 2X1WL 4G7VL 1EV2E 3UJIH 5KVEL 2Q6WB 3SPVA 3GGWA 1MELA 5D2LE 5C0JB 1JGEB 5CD3A 5CD5D 1N2RA 3DSFL 4IDJL 3DV4B 2PO6C 1W72A 3HPJB 2P8MB 1RUAL 1X5IA 5C0EB 2OBGA 5DMKB 1CE6B 3RZWA 5MP6H 3WIFA 1FC2D 3IFOA 3JXAA 4MGXA 4F7EB 1KJ2B 2ZCKH 4HHAB 1BZ7A 4PJXB 3I02A 5E95B 3NFPB 3TA3D 3H2WA 5AAWA 2W9DL 4P2RD 1YEEL 2W0LA 4GMSL 3P0YL 4M6ML 3TBVB 4GRLB 4OGXL 4C4KT 2D7QA 1A6PA 1D5BB 5I15L 3KLAB 3GSRB 1ETZA 3MRLB 4OSUH 1MY5A 3OGOE 2C4FT 4MVBD 3KS0J 3O2VH 5FGSA 2FO4A 3QDGA 4ZO8A 3QDHA 4PR5B 3MOBL 4P4RB 1X5HA 3TVMA 4PRBA 4QRPD 3HUJE 2NXYB 2R8SH 1RMFH 3LN5A 4Z7UF 3RU8H 2DQJL 4KHTH 2XWBB 5IVZA 5IM7B 5FYLD 3BGMB 4XPBH 1Q9OB 2FB4L 1FVCB 1UEYA 3PDGA 4MA3B 4U1HA 5KVGL 1PQZA 1QFHA 4LLDB 4KUZH 4WFGD 3N50A 5IG7B 3QHFL 4EDWH 3RIAK 4ACPA 2Z8SA 4PY7A 3X3GL 3KLSA 1RHHB 3IKCA 1F4WL 4MJ5A 3VWKD 4PJ5D 4HIEA 1H15A 3SEPA 1MIMH 5D96B 4X7SH 2Z91B 5E2WL 2OL3B 4YHYB 1WISA 3ZDXF 3V6OC 4ZUTA 3WUWG 3HAEH 3S35L 1H3GA 4YPJA 4HFUL 2B1AH 1MUJA 2ZOLA 3NIDE 3RI5K 2QTEA 4PRAA 1D9KA 3QG6B 5CUSL 4L29A 2PXYD 3ARUA 5EBLB 2MPAL 3FT2B 1BJ1H 4PGBA 4M4PA 4MD4B 4I18C 4UNTA 5KG9B 4FFYH 5H2BA 4JFHD 3GMRA 4Z77A 4H1LG 4JN2B 1QFOA 1GC1H 5D7SH 3TCLA 2BY0A 1B0WA 5EIIA 3U1SL 4M62L 2ZCLL 3DVFA 3CDYA 3HMWL 2VZSA 3FRUA 3IJHA 5TFSL 5FA3A 3BZFB 5F6HI 4NFCA 5KZCD 3T04D 3GHEL 3H9ZA 2VIRA 3ARFA 2DIJA 1S5IL 1CDYA 1LP9A 2ITDB 1MRFL 2VITB 1YEJL 3ULVF 3MXVL 1X7QA 3P0VH 3OV6A 3EYSL 4W68A 3FZUD 4DUVA 5D70H 4K71B 2BC4A 2YD2A 4CDHA 1HKLH 2DF3A 1EHLH 1HXMB 3RAJH 4PRIA 5HD8C 4HIHA 3BEWA 5BV7C 1JGVH 2NY0B 2K7PA 4V2CB 1T3FB 3BUTA 3OSKA 5H2BB 4P5TB 4NQCD 3QIBA 4RWHA 4U6VH 1T03H 1KGCE 4CJ0A 5AZEL 4K8RC 4ZG1A 5L88L 3FQXA 5TFSH 3GJFH 3M07A 4ELMF 3OAUL 4XXCC 1NAMA 5FYJH 4NRZA 4X5XA 4G6KL 4P5TA 4L3EA 1FCCA 5GGVH 2IBGA 1LQSR 2XNAB 1EAPA 1KPUA 5DA0B 4KUCF 3T65A 2NY6B 2J8UB 3INUH 3SJVA 3C5ZD 2VZUA 3VRIB 4QHUB 4JFZL 4JHWL 4HFUH 1YEGH 2I9TB 4S1SL 2DWEB 3B5GA 3V7AE 2DI8A 2A83B 4HKBA 4IRJD 5FYJU 1JYNA 3CH1B 2Y5TB 3GBNL 2BY3A 4LSUH 1L7IL 4U1LB 4ELME 1Q9OA 4KV5E 1RK0A 4YLQT 3MLSL 4NQXA 2D7TL 4XPHH 1W0WA 4ZNEA 5TDOB 1YY9C 4HMCA 4X5WA 1PGRB 1J0YA 3VDAA 3HMWH 1T89C 5D1XC 4XH2B 1TVDA 1AO7A 3MODH 2EDLA 2R1YB 2X89A 2FECL 3Q3GA 1MI5A 1QQDB 2Y36H 2VERN 3G5XB 5DHVH 2GY7B 1ZT1A 4QTIL 4KY1L 1R5IB 1MCKA 1SJXA 2QSQA 3HS0B 4EVNA 3KLAA 4BQ9A 4LBEB 3ULVC 1HN1A 1T1YB 2EIZA 1CGYA 2FEEI 1DQLL 4OI7A 4ZFOB 5DJDA 3VFGL 2G60L 4NJAH 5IB3A 4PJIF 1NQBA 2VDLH 4YHML 5IUSA 1FCGA 1LILA 2CDGA 2VYRE 3FO0L 1T5WA 4FFWC 4RIRA 5FO9B 1LO3H 4Y2DA 2I5YL 2QSTA 3EYUL 4S10A 4F15B 3G04A 3L3OB 3ARBB 4NO0A 3V8CA 2D03L 3T2OA 1JYWA 4KK6D 4RDQG 1VEOA 3ARDA 5T1MA 1MFDL 4UDUA 1R3KB 1OGAB 4XP6L 3QJHB 2YD6A 4QY8A 4DKEL 3VXOB 1DQDH 4HGWA 1LO4H 2IADA 3X14A 1CD1A 2IFGA 4GW4A 2NYYC 3TJHC 3ZHKA 1CXEA 1TXKA 4JCMA 4KHXL 3QFJD 3VXUA 3RWCB 1JWMB 1HH6B 5DQJB 5MEQA 1NFIA 4Z7VF 1JZ5A 1NDGA 3C8HA 4XGZA 4YX2L 4D0DA 3MLXH 4JO3L 4PYHA 3ET9F 4IRSB 2QR0A 2N1KA 3I75B 3ES6A 3MOQA 1MHHB 2BNRA 1ZHLA 3IDGA 3QIWC 3QO1B 4PJ5A 4YIQA 1HILA 5CEZH 3ULVH 2BOBB 4NHUB 5GS2D 3IXAA 4MSWB 4M7LL 3IU3A 1A7NH 4MNQD 4PY8J 2MQ0A 1ZSDB 2J8UF 4HWZA 5JHDE 2VSDA 5DMJB 1KN4L 4O51B 2LE9A 1IGJB 2LV4A 5EC2B 3BZEB 3DUSA 1UM6H 5JZ7C 2B4CL 4YHKH 5ACZB 1T4KB 3EDJA 1RUPL 3LSOB 3D3VD 5DSCA 1IAKB 4JN1L 2RB8A 4LU5L 1UKTA 5D1ZC 4WFGE 4U0RB 4MB5A 1VGEL 2WW8A 3BDYL 3WHE1 1X5XA 1EEUA 1ZT4A 1CGUA 3LEXB 4XBPB 4WWKC 5C0NC 4XCYB 1DBKL 3CX5J 2W9EH 3V0VB 1X4ZA 5E9DE 4URTB 5C0CE 5HBBA 1SJVA 2DM3A 3FAWA 5IBUB 1T21B 4Y5XC 5HPMB 4JGMA 4DAGL 1IEAA 4HKXB 2WQRA 2J4WL 5CJBA 4EXKA 3GSVA 5CZVL 3MRGA 2F5AH 3S4SA 4ELMB 3QEQE 2R2BA 3T1WA 5CD5C 5DO2D 3BDBA 1TQCC 2AW2A 2UYLA 3DOSA 1RZKH 1OTSD 1K85A 4QHKI 3EYVA 2UYLB 4GAFB 2HWZL 7FABH 1A8JH 2H1PH 5A3IC 2AJYH 12E8H 3U46A 4KK9D 1W8OA 2ZSWA 3U2SA 1IEBB 5EWIH 4MAUL 5J57B 5KTEH 2W9LA 4HGMA 2VL4A 5T33L 3QUZD 1C1EL 4HPOH 3O6FB 5E8DL 3HRZA 4FQIH 1MI5E 2CUIA 3IB4A 4LASH 1TENA 2BCKB 4YBHA 4DWHA 1NL0L 3S4SB 1UM5H 2A38A 1A47A 4U1MA 5DK2B 5F6IB 4TNWK 5IMLB 2NY4D 5KVFL 1HHIB 2NXYD 4Z7UA 5A2KH 2EDRA 3IXTB 5HPMA 4LEOB 5CIPA 2YUZA 4KQ4H 1U3HA 3MJ8B 4PJ9A 2UWEE 3OMZA 3UZVB 4HXBL 2GW5A 1H3WM 4YUEL 3KS0H 4CMMA 3S36X 5J6HB 3TBYB 4X9HA 1HWHB 5CJQH 2ZOKA 3T2NH 2KUTA 4H88H 2FLRT 5CILL 4OZFH 2XN9D 1IQDB 1UZ6E 3MRNB 4M62H 3MYZA 2VLLA 4ODUB 2EZ0C 3CFCH 1V7NL 4IOSD 3IDGB 4U1NA 2Q7YB 1FNGB 4NO5A 4JFYB 5ELIA 3B6SB 1RJYA 3EYOB 4HC1L 4G6AC 3JUZA 4LRNH 1BX2A 5IVXE 1N59A 4RX4D 4HUUB 1RZIA 1II4E 4F9PC 1S7UB 5DQJA 1U8KA 3QAZB 1OP3K 1A3LL 3QG7H 1NDMA 5HTSA 1CGSL 4K71C 1QPPA 5I18L 4K9EC 5HYJA 2YBRB 3QJHA 1HILB 1I8MB 5MEPA 3KYKH 3CZFA 4N8VG 1QFUL 2NLJA 3EJYD 2XACC 4QEGA 1Z5LB 3P9WB 2IADB 3X14B 3OJDA 3T2NL 2ADGB 3OKNA 1T7WA 1O5DT 5GGSA 3QO0A 2IQ9H 4Q9RH 5CZXC 3W9DB 4QHNA 3MBED 4FN0A 3TO2A 2HMID 3RWGB 4WV1A 1TITA 4FP8H 5CWSA 1CLOH 1QSVA 3CCHB 2H6PB 7CGTA 4EZMA 3CMGA 3FFCB 4XCYA 4JRYA 4IEFB 1Y0LB 1J1PH 3G6JA 3EOYG 5CGYD 4YGVB 3DYMA 1NL0H 4PRNA 43CAA 2H2SC 4NCC1 1P2CB 2GEEA 4YFDB 3QRGL 2GK0B 1QA9B 3OR7B 3BOVA 4LVNC 1IJ9A 4OTXL 4POYA 3CFEA 4XTRD 1WBZA 4UQ3A 4XPGL 5KSBF 2MHAB 4H8WH 3HTLX 5EOQH 3CH1A 5B39G 5JOFB 1M71B 1XGTA 2OSLB 4UT9L 1MIEL 1AR1D 3TT1L 1E4KA 4GG8B 5HY9A 2Z35B 5L7XH 3NABH 1VPOH 1UA6L 2VQUA 4ODHL 4PJXF 4QY8B 1VFBA 2HVJA 4B7LA 5HGAB 5I76A 1CDGA 2H9GB 3P77A 1CICB 1GIGH 4Y4KB 4ZSOE 1NMAH 3HZKA 4Y4HB 1ZANH 3N85H 4M5YL 3HN3A 4N0FA 4JM2F 4BZ1H 5I1JL 3AGVA 5MEQB 2HLAB 3QEGH 1LGVA 3BQUA 3S5LB 1F90H 4MNQA 4XCEA 1U42A 3T3PF 2VZTA 2O5XL 4LASL 1B2WL 2LU7A 5HHNB 4NCDA 4KMTH 1F3RB 1FYTA 2C9AA 4MQSB 3UZEA 4QHUA 4X7SL 2QADC 1PKOA 3WLWD 2PCPB 1RULL 4PY8I 1GOHA 3VXRE 1BOYA 1U95B 1KELH 4ZS6C 1LEIB 1A9BA 1D9KD 4PJXE 4MJIE 3WS6A 2APBA 5BRZA 2DKUA 2ADFH 4AT6A 3HE6B 1XZ0B 4DZBB 4D3CL 4Z7NF 3WNOA 3FRPG 1E27B 1OT2A 5DJ0B 3UTSA 4RNRA 2ZUVA 1KPVA 3ARGD 4XAKD 4YHKL 3FFCD 3HAEG 1R0AL 2PF6A 3FOMA 1QR1B 2XTJB 3DURB 3O2DL 2HYMA 4MMZC 3U1SH 3P4OB 1GXEA 4OZIF 3E1F1 5E24E 5F9OL 2VLJE 4GKNA 1CDUA 5CAYB 3G08B 1EHAA 5ERWA 1MCDA 3QDJB 1U93B 3B8YA 5H94A 1MHCA 2G75B 2FECI 3HG1E 4OSUL 2NNAA 5EZLA 2EDEA 5F1KC 1G0DA 1NGPH 1G9MH 2PYEA 3NN8A 4MHHG 4H8WL 5BZWA 3LS5L 1YPZB 4CAGA 2DJ4A 4Y8AA 2DLFL 2A83A 4HKBB 4DFHA 1T1WB 3FOMB 2B4CH 4PGZA 1QSFA 4WUUA 1ITBB 1I7TB 3S37X 5FUCE 3WE6B 5GQBA 4JHAH 1PAMA 5IT2H 3R06A 4M8VA 1CD0A 4E0RA 2IAMD 3RDTB 4JY6B 1TPXC 4PFEA 2YXFA 4F7PB 5FHAH 1H15B 3BEWB 4QOKE 4HIHB 2E9BA 5ECJE 1VFBB 5JHDA 2PO6D 4X0KA 4PJ9C 3TNNA 1D9KB 1IKNC 1I85A 5BS0B 4GAGH 3HC3L 2P46B 3FMGH 4AL8L 5KVEH 4JE4B 3G6DL 2ATPB 2XY1A 1T5XA 1C12B 2ZUQC 4K7PH 3WKNA 5TE6L 1P4LA 3ARDC 2YK1H 1H3PH 4ODSH 4Z7OF 2HT3C 1EUUA 2VMFA 1T04B 5HGAA 5H37G 3D3VB 3MV8E 2DM4A 1XH3B 3VXUE 4ENED 4UIKL 4Y4KC 3FB7B 4GG8A 2WANA 2DLHA 3ZT5A 2R1WA 3PHQA 4YHLL 3TO4B 2W9DH 1A21A 3O3EA 1F6LL 4M6OL 1V7NH 3IDYB 3DMMD 3RFZC 4F3FA 4FQXB 5D7LD 3OAZH 3RKDD 1WZLA 2MHAA 2HVKA 1QSEB 1KCSH 1L4IA 1JPTL 3VWKB 1LP9B 3C8DA 4K3GA 3ZO0A 3RX5A 3SN6N 3OAUH 5DD5H 4WVRA 3SE8H 5AZ2L 1BZQK 3HZMB 4NWTL 4PJDF 4DKFL 4PR5A 3FRUB 3IJHB 1Y0LA 3CXDL 4HIXL 3WSQH 2Y9RT 5KVFH 1I8LA 4K2UL 4ZO7A 5K9JH 5K9QI 2AJSL 5FDWB 5MHSE 1LEIA 5DURD 3BSZH 3WHE0 1NBYB 2LAGB 1RZ8A 3LY6A 4LHUG 1IGFH 4PRPD 3LAFA 4UTAH 4A6YH 3AY4A 1CFNA 4OAWA 3OKNB 1K6QL 3NCFB 1Q0XL 4EI5D 2VC2L 1R0AH 3KDMA 1KJMA 1MJJA 3RVXC 5C0BE 1YNKL 4PB9L 2HLFD 3MZTA 1ORQA 3NPSB 5HGDA 1JGLL 1PQZB 2YWYA 1FYHB 1AKJA 4PLKC 2EDWA 4EIGB 4KTEH 4AY0A 1ZKAA 1H3UA 2XG4A 4R26H 1EEZB 4ETYA 1AR2A 4JFFD 4Y5VC 5DJ6B 5JW4N 2AEPH 4ODTH 2HT4C 5HYSG 2QLVB 3E6HB 4NN7C 3EHBC 2OZ4A 2H45A 3N1MC 3SJVE 5B38A 3TZVB 4LLDA 4AG4L 5J6HA 1BX2B 2FX9L 3IS0X 4DW2L 1MNUH 4LVEA 1TZGH 3SQOL 4X6BB 1R5WA 1XIWB 4X83A 3FT4A 4NFBA 4AH2A 4XNYH 4ZXBB 3OGCA 2ED8A 3V6BR 2DJSA 4JFDD 4P2QA 5DMIL 3WBDA 3QQ9C 4P4RA 4G9DB 2HH0L 4N5ED 2NZ9D 4EI6B 4LHUA 3FONB 5FYKH 5IMMA 5CS7A 2DDQH 3T4AA 2XA8H 1NCBH 4LEXL 2ILLA 1YMME 1XF2B 5KOMC 3F7PC 2FZ3B 1SMOA 4GAJL 3L3GA 3IDIB 4FFVC 3JV4A 4MX7A 3T3ME 3U2SB 2AXHA 2EEDA 2WLZA 5J9PA 3GMPB 4NOBA 3TBTB 3EDDA 1NANH 3V79C 1RD6A 1TJHL 3VXSB 3C5ZB 2G2RB 3FQWB 3VFWB 4Z7VA 3QUZA 5CEZL 3TF7C 1WFNA 5INDB 4PGEA 1V05A 2VDPL 5CJ8A 5IFHL 4AMKH 3TYGL 3ZMRA 3BAEH 3BD5A 2DN7A 4X6DA 2V2WB 5C1MB 4P5TD 5C2UB 4LPXA 4FFYL 4DGYL 5AWNL 2DYPD 1MJUL 3EJZD 1CLZH 3HMXA 1FZKA 1SY6L 3BP6A 4FXKA 2QBWA 4XRCA 4LCWA 3GSOA 1OD9A 3I9GL 2NY6C 3I2CL 2FJGA 4CN1A 2J7LA 2WP3O 4KQ3L 3GSNB 3PWVA 3DX8B 2N4IA 3O4LB 1OGTA 2WNGA 2X2YA 1L0YA 4FQQA 4ZDHA 1B4JL 3PL6B 5KBNC 3H0TB 1RULH 3LPGA 43C9B 5JXAH 3DUSB 2Q86B 3O6LH 5C09E 4DJMA 4NO2A 3TCXA 4G3YL 5BVPL 3NIGF 5SX5K 5K9KB 5JW4R 2D9QB 5LGJA 5C6PB 4H5SA 5HGGS 2CK0L 3C8KA 2BOCA 5JQ6L 4AEHH 3OX8B 4OCNC 5MP6L 3SDXA 3QIWD 2VSCA 1XAUA 1Q0XH 2BSED 3CUPB 5EULV 2YN5A 3BW9B 5DVLA 4ODHH 3DGGA 4OFYD 5CILH 1JZ4A 2WIMA 1NDGB 1FGVH 4XGZB 4FQPA 5D8JH 3WCYA 4KROB 4QRRE 2YKLH 4H0HB 4PB0L 1A6UL 1WTLA 4AJ0A 3MROA 1Y6NR 5JW4M 4Y2DC 4YNYB 4FFZH 4KXZH 2BOBA 2RJMA 3OJ2C 1LE5A 1EEZA 1OB1A 3GUTA 5JPNA 5GS1A 1VDGA 1J1XH 3CJJA 2R4RL 2DL2A 3ARDB 3LQAH 3QNYA 3ZTJG 1G6RA 2DQCH 1IBGH 3QH3B 5DD1H 1MCRA 2VDQL 3C60A 3RGHA 4OZIE 5E8NA 3KAAA 4V2BA 4ZODA 5I1HL 4LCUA 5IW3A 2ED9A 2CLRB 4TVPD 1YEGL 4I2XE 3V6FA 4QTHB 3P4MA 1FBIL 5B39A 2PTTA 5JPMA 4DGVH 4Y4HD 5E2UH 1FL5A 1U36A 1UM4L 2ZCKL 4Y5YB 4K8RL 1ZT1B 4F7CB 1OARH 1QSZA 2CR6A 5GRUH 4OZFB 2XZAL 3CFCL 1E4WL 4POZD 1JF1B 3DIFB 3VDBA 3P9LA 1PYWA 1O7VA 4FQLL 3SE3A 5BV7L 5A3ID 4K94C 4TYUA 3OWEA 1KULA 4GBXD 3F5WB 1I7UB 3WDIA 3BGFC 3ZYJA 5C9JA 3IJYB 5GJSL 3WXWH 1KT2A 2GJJA 5IB4B 5K9OA 2IF7A 1IARB 5DDHA 5J8OA 2P8LA 3U4BL 3LRSB 3HMXH 5I18H 3NCCB 5B4MD 4FQ2L 3Q3GB 5JDSA 1NGWA 2OTPA 1I8IA 3ZYZA 1J8KA 1OTUC 2WWKO 4HH9A 4LK4A 1HE7A 5IGXH 3P11L 2V9QA 4ODVH 2FCBA 1TVHB 1PEZA 3QR2A 3T0XA 2VXTH 3O6KH 1G7LB 1JNNL 3KXFA 1NGQH 3TWCH 2BSSB 1EAPB 1KPUB 2J5LB 2BVOA 4UIKH 3H9HB 2FJFA 1LDPL 2IPUG 3SDDB 2NZIA 4LSSH 3WNMA 5HSFA 1GCFA 1V7MH 3D0LA 4W4OC 2WUCL 2I9TA 3OKMB 2HG5A 4GRWH 4WO4B 1OTTD 4D9RE 4C54A 3PGDA 5D5MB 5JR1L 4YGAB 4XHJD 4D8PA 1W0YT 3LEVH 4MZ2A 3G04B 3H6JA 1R6VA 1G6VK 4JO3H 4UIMB 5C0DA 5D1QD 2W0KA 1DL7L 3EOTL 4OKVB 6CGTA 4OLWH 4FABL 3E8UL 5DJDB 3GMQB 5EBMA 4XWOC 2NY1B 4ZOEA 5HGBB 3DI2B 4LL9A 5CUSH 4ONOA 3SDXF 1PZ5B 4U0RC 4QRQB 1LDSA 2P48B 1C5DA 2DQGL 3DVGA 1UM6L 2YXMA 4U2ZA 3SHSA 2BVYA 2VAJA 2W07A 4JPIB 2DKSA 3AREB 3CX5K 4KRPD 3D0VA 4LU5H 3AM8C 5CSBA 2CKBL 3RVTD 4EDWL 3QQ3B 1P69B 1BQUA 1UXSB 3GMNA 2UVFA 4WHDA 2D0FA 4KK5D 2WBJB 3B9KD 1FFNB 2BRQA 1C5CH 4MQXC 3PXHA 3QFDA 4HS3A 1UVQA 2NY4C 1UCTA 5FA3B 4Q0XL 1NLBH 4F58L 4NOFA 3RJDA 2XIDA 1M7IA 4O2FA 1F90L 3AXLA 3ZKND 4RAHA 1R24B 1L7TL 5KOVC 3GMRB 3EO0B 1XIWC 3MCG1 2NTSP 5DFVC 3O3BA 1DBJH 1ORSB 1XGPB 4Z5RB 2DWEA 3SQOH 1MQKH 4TOYH 2YEZB 4HUKB 3KR3H 4AZ8A 3S96B 1QOKA 4NWUL 4OCMC 1Y6MR 5F3BB 5CMAB 3DMMB 2ADFL 3MUGA 1ZLVH 3MFFB 4PIRF 1FVEA 4LVOC 2V5TA 4L5FH 4WO4D 1G6RL 4PJCA 4WI6A 3HAEB 3QDMA 1UGNA 1JPFA 3EW3B 4MCZB 4MNHA 3SKMA 1RAMA 2J6EH 1MWAH 1LDPH 5ESAB 1YEEH 4QRSB 3E3QE 3RWEA 4HT1H 1G7HB 2DQFA 3GFUA 3STLA 3MRBB 3LEVL 2A9MH 3QWQB 1HI6B 4KMTL 3RY6A 3ECBB 5FHBH 3MGTB 2OR9L 5C0FB 4LLWB 4MA8L 5D7IE 1WCBB 4YXHL 1U8OB 1CL7I 4XB8A 1Q72H 1WT5A 4OUUB 5KSBA 4QT5A 4R96A 2VDPH 1B6UA 4M1GL 4JDTL 5L2KA 4CADA 3WLWC 3PWJA 1T7XA 2C3VA 2VL5A 4I13B 1U3ZA 2GT9A 4PBVC 4S1QH 1ETZB 3GBNH 3MRLA 4LSUL 2VITA 4OF5A 3ZHLA 4WDIA 3VWKC 1S5HA 4LPVA 1I8KB 3KPTA 4UNVA 4KJQD 3DO7B 1CWVA 2W38A 1CR9L 1DFBL 2H2SD 2YRZA 3U0WH 3PWUB 4R2GD 3UX9B 3BZFA 1NFDA 1OAQH 1LO0L 3PWLA 4YGVA 4L1DA 4GKZA 4BH7B 3TBWA 3VA2C 1NAKL 5C07A 1J1OL 1JHTA 3MV8A 1CT8B 2F74A 2C1OA 2EYSB 2I9LA 3Q2CA 3QUML 3K1KC 3U4EB 2WLYA 5IBLD 3FFDB 1MAMH 3BVNA 4P9MH 1BQHB 2YZ1A 4ERSL 4X6FB 2KZWA 4BM7A 3VFSB 4AENA 5JOEA 5DUPH 4K7PL 3QIBC 4TPRL 4XBEL 1KB9J 5E0QA 1QFUH 3VW3H 4GS7C 3OZ9H 1YJDC 2AJUL 2IANE 2O5ZH 5HGHA 3WFZA 3QUXC 3X3FL 1NEZG 1LK3H 1OCWL 4OKDA 4X4ME 5E6IC 4XPHL 1ZLWK 1HYSD 5D8JL 3DSNA 1I4FA 4L8SB 5C0BD 1HCVA 1TIUA 5IFJB 3T8XA 2YD3A 2EYTA 3EJZC 5BV7B 2CO7B 4M6OH 5EO0B 1IM3A 2BVQB 3L3KA 1KTRL 3GMMB 5DRXB 1OAQL 4FTVA 3KPQB 5IHUH 3Q5YA 4JKKA 4WFEE 1FG2B 1KCVH 4PRDA 4RSVA 5C07B 3VGEA 3O3AB 3E2HB 1J1XL 3QUKB 5JORA 1RZJC 4OLZH 5KW9L 1FN4B 4ZUUA 4APQD 4N8PA 1FHGA 3W2DL 1JFQH 3ZZ1A 2ZCHL 2EICA 5FF6B 2KH2B 5AUMB 5KSAA 2AJSH 3NPZB 3QIUC 4G42B 5E8EB 1EJ6A 1BECA 4DFIA 5T1LA 4JDTH 2BJMH 1CK0H 1BLNB 1IM9D 3BH9B 5LG1A 1EMTL 3D25A 4G9FB 1UYWH 4MXWH 3WN5A 1G0YR 4V1DA 2ZP0T 5F89A 1UCBH 4TUJB 1LK2B 1HHJA 5IB1B 4IOIB 2OX5A 4YK4C 1L6XA 1F58H 4JB9L 4XCFH 2NY3B 4QO1A 1HHHB 2XT1B 2VDOH 3BMVA 4U6XB 1EX0A 5C6WH 3EO1B 4Y2DD 3ULVE 1HQRB 2ADIA 4OB5H 5DJZA 3K4AA 5CEZE 3QXUA 2H32A 3BXNB 1IBGL 3GSXA 4E41B 2DIAA 1BZ9A 3S6CA 1MCIA 5FO7A 1IAOB 3ZYOA 4Z7OE 4PJDE 3B9VA 3GNML 1N8ZA 4EUPB 3AM8A 4N68A 5SWZA 2ZUWA 2AJUH 2WBJC 2EXWC 1DDHB 2H1PL 2WINB 2HH0H 2AGJH 3LS4H 5D72L 5DMIH 3L3HB 1CBVH 5C09A 4Y4HC 4BSWB 1MFCL 5FO8A 1PZUB 4L3AA 1S9WA 1ZANL 5I1GL 3G6AB 3QIWA 4AEEA 1CVSC 5J1SC 3NBNA 1YNTA 5IK3A 5JR1H 2R9HD 4MD5B 2BK8A 3QEHA 3DARA 3B5HA 4OZGE 4QOKB 3L3DB 1IM9B 4NN6B 3M17A 3TBSA 3D85B 4NP4H 4PJAB 4F57H 1JN6A 2XXCB 5C0IB 1IAKA 1AHWB 2X4OB 3IGAA 5IB5B 1QLRB 5B4MC 5DFWH 3U82B 4NC1C 4ZUWB 5E4IA 1LWRA 2VH5H 4Y5XB 3T2QA 5LWYH 4OD2A 4HWZB 32C2A 3TN0D 3F8UB 5I66B 4O5LL 1MCOH 3MNWB 4XPFL 2I5YH 1A6VL 2NTFB 2ZPKL 1BIIA 1QSED 2AJ3B 2DLIA 3LB6C 2X6MA 2HKHL 3V0WL 1DVFC 4L4TB 3ZKQD 4HLZH 4R7NB 4I18A 2P42B 4RMWA 4LKCB 3IDMB 4IS6B 4ONHB 4ORGA 1KTKE 4WFED 2VISA 4L8CB 1AXSA 5CFHA 5D5MA 1OAXH 2DKMA 1K3IA 3UJIL 2JK5A 1A1MB 1J05B 3ZSTA 4N8CL 4Y1AE 3IU4H 2GITB 3MV8D 1OGAA 4AM0A 4MJ6A 4Z7VE 1ZLSH 4M7KH 1OF2B 3L9RB 4DN3L 3QHTC 1QRKA 4ONHA 4EI5C 2QQLL 1ONQB 4U6TA 3BI9X 3VGHA 3KYKL 3K81A 1AY1L 2X5PA 1VADA 1PLGH 4TUKL 1I1YB 1T0NA 5EOTA 5IQ7H 3R4DA 3LQZB 3C60D 1DQTA 3NMEA 5EDXA 4PJCF 3PABA 1J8HD 1YQVH 4JO4H 4UTAL 3EYUH 5FDYA 3LQMA 5I1DB 3P9MA 4GH7B 2YRPA 1YMMA 4NHCH 2GI7A 5DVMA 5E8OB 1AP2B 5GHWL 1WK0A 4LNRA 4WW2C 1TPXB 4W6YB 1I9IL 4K55A 1LP9F 1HSBA 4MJID 4QXTA 1QLRA 4OBSA 4WFFE 2VXVL 1J87A 1DQJB 3HE7C 5FYLL 2VN7A 3G6JF 1Q9LB 2AKRA 3THMH 5E8OA 4QTIH 5DD5L 3FMGL 2UWEA 4AL8H 5HHOA 4G5ZH 5B3JF 1SYVA 1GGUA 1MCWM 3M1BA 5JO5B 1TTFA 3LPFA 1QBML 5DR5H 2VLKE 3EGSB 1VEPA 1KIUA 5T1KB 1S78C 5DFVD 4ERSH 2N56A 2A6KA 4LSQL 2A6IB 1AQKL 1EZVY 1IC5L 4BFIB 3FN0H 1EFXA 5FOBA 1CU4H 5A2JH 3B9KB 1K4CB 1YPZE 3WL9A 2ADJB 2RR3A 2IQAB 1J8HA 1YNKH 1YPZF 3PABB 3PP3H 3REWB 4W70A 4WO4C 4D0CA 1M7DA 4JKPL 4F37F 3U48A 1VGKA 4D9QE 2VISB 3T1FA 3GRWL 1J0JA 1BF2A 4L4VE 2Q87A 1ONQA 3O9WB 2G9HA 1Z0NA 3KXFE 1S7TB 2D31A 1IAOA 5L0QC 4PJ7A 1RPQA 3LQAL 5FYLH 4YBLC 4LVNB 5EZOH 5ALBH 1RJZB 1A1MA 1BOGB 3OKEA 1PEWA 4P2RE 4H0GA 4P9ML 3QIBB 2DI7A 1CGTA 4GG6B 1I1AB 1AO7D 2WIIA 1GPOL 4GO6B 4XBEH 4Y16A 5KSVB 4QNPF 3H9SE 4HEME 4Z95L 4NKQB 3RWJA 4WV1C 3T4YB 4ETQB 4MJIB 2UV3A 1U8NA 1TVBA 5I1AA 1YQVL 4JO4L 2YD7A 2AP2A 1OL0A 3X13B 2CRIA 4MXQC 4OM1H 1RJCA 3FB8B 4O02H 5IK3B 4R4BB 3FT3B 1R5VA 2AXJA 4XX1E 5T33H 1S9WB 3OL2A 4RAVB 4DUWA 5T1KD 2VIRB 1MOEA 1OAXL 2Y7QB 3SO5A 5FYJL 4HH8A 3V0AC 3L3HA 5IVXB 1FGNH 5J4MA 4NYLB 4CVUA 3HA0A 1P7QA 3MV9E 4K9EH 5DUPL 3ARTA 3QIWB 2Z93A 4OV6F 3QPQC 1NJ9A 3FOLB 2WBKA 5JQ6H 2DQJH 3B4NA 1HIMH 1X5LA 4LLQA 4MLSA 4NKDB 1BFVH 3KHOA 4OZGA 2K3TA 3O4OC 5D93B 5CP3H 2F19H 1OTUD 5DJZB 3JTSB 4GSDL 3L5XL 5ACLA 4JJHA 3OJMB 4KDTC 3VD5A 1EGJH 3RWFA 1KN2L 2WSKA 3V5DA 2PETA 3DRQB 4ZAKB 3VXTB 4OCLC 5EO1A 2ID5A 1DUZA 4KRMB 3CD4A 3RWDB 3W82A 4LLMB 1NH6A 1KLGA 3L7FB 2VXQL 3GO1L 2AEWA 4I4WA 4OD1H 1YDPA 1SBSL 2BHYA 1IAIH 3AMKA 4D0BA 3LKOA 1TLKA 3TVMC 3CVHB 2GFBA 1G9EA 3E6FA 3MRPA 1E4JA 1U8HA 3QNXB 5I8CA 4JZNB 1A7PH 2ZUTA 4IRSC 1A3RL 3UEZA 1QPXA 1CCZA 2W65B 4YHNA 1DVFB 4AEHL 3W9EA 4XPBL 1IKFL 2JJWA 4CW1B 1MCPH 1HXYA 2F58H 4LVHC 4V1DB 4R90H 5C08A 3QEQB 1EZVX 1K8DB 3H9SD 4K8RD 2MWCA 3QEQA 3FTGB 4XP6H 3MODL 3HUJF 4Q0XH 4KHXH 3O2WL 1KPRA 5DJ6A 1ND0A 1U8OA 4U6YB 3OAZK 2YD4A 5I9QC 3GI8L 1CGSH 3CGTA 3OR6B 2R23B 3K8LA 5EPMB 2L0DA 1M05A 5DI8B 2NXZB 1KLFA 3KR3L 3DV6B 4LF3B 5D7JA 4WFFD 3BSZL 5B8CA 3QI9A 3W5MA 1JP5A 3IFOB 4NNPH 3VXPB 3WIFB 4ZYKA 2JB6B 5IFJA 3T3MF 2ZG1A 3RTQD 4UT6L 5B8CB 1KFAL 1YMHA 5DD6B 3BESR 3ZE1F 3ALWA 4WI4A 2P8PB 4OLEA 1KC5H 1U3HC 5TQ0L 3ETBF 5JNYB 5DC9B 4YXKH 4RQQA 5JHDD 1A6UH 2NCMA 3G5VB 3AC0A 3RQ3A 4HUWB 4Q58C 2X9WA 3MRCA 3ABZA 5I1LA 3P73A 4XX1G 4KDWA 3BPNB 3MBXL 5DO2C 3MLRH 2VLRE 1KPRB 3UBXB 3KYAA 3IDYC 5D1QB 1UB6B 4NM8H 1BM3L 3QUMH 5KN5B 3P4NB 2I60H 5DHXB 3VGGA 2GFBB 1CE1L 4LDEB 3K4DA 1NC2B 4FXGB 4Q6IB 2P5EE 3ZTNH 4MYWB 2E7BA 5L2KB 4UT7H 3KYNB 4OQ1A 4FFWD 4ETQA 1AY1H 3ZE2E 5E1AA 1VFAB 3DX9A 4D9LL 3D3VA 3KG5A 2OYPA 2AV7B 4BFBD 4JFDB 1DUZB 1D5IL 5IHLB 3WO4C 2XQBH 4LPWA 1BWWA 5EFIA 1U8HB 3AS0A 7FABL 1KG0A 3H9SA 3PJSB 3VFUB 2XZCH 3TN0C 1FAIL 3PWPE 1OY3B 4HK0A 5C09D 1KC5L 5TQ0H 4WIQA 4CADB 4U6VL 1KB5H 4XP1H 3ULUF 2C26A 4N90D 4J4PC 5HDQL 2XZQL 2B8OT 4GKOA 3QNZB 4H0IA 4P57B 1J86A 2EYRA 2GAZB 4PJHA 1KNOA 5CP7B 1EO7A 1YC7A 3KPRA 6FABH 2MCPL 1MAML 2C3WA 1AXTL 4XPAL 3TNMB 1B9ZA 2D3VA 3IYLW 1XGUB 4NSKA 5BVPH 4S1SH 4F33A 2HG5B 1S9VB 1CU4L 1K2DA 4MNGB 4ODSL 1S8DB 5GS0C 4L4TD 4JFDE 3O0RL 5ESVB 2XFXA 3SDAB 5ID1B 5FGCB 1NJ9B 1YPZA 2NY4B 2B20A 4YXKL 1P7QB 3S37L 1VENA 1MRCL 1B4RA 5J89A 3GDBA 1XT5A 4HH9B 1WEJL 1XGRA 1TJIH 1OAKL 1VA9A 4YHIB 3V6ZA 3WL9B 3ARGA 2AABH 2CKNA 5D2NC 2ZKHL 1DQJA 3OJVC 4M1DL 5HHQB 2P8LB 4ZS7H 4KZEH 5KAQG 4DK6A 3ZKXB 4NQVB 4HF5L 4MA1B 1L7TH 4GG6A 1FFPA 4JDZB 2Q8AH 9CGTA 4OF7A 4UV7H 3RA7L 4XNXL 4MWFB 4X6CA 3VGBA 3GMQA 3EFDL 5IIEB 1U58A 1NC4B 4YHYC 5I19L 3CSPA 4OIAA 5I73B 1KV3A 5DWUH 5HI5C 5BJTB 3S35X 1CTOA 3PGFL 2NR6C 3TEUA 1FSKB 5TF1L 3H42L 5ALCL 4K3EH 1RIVH 3MLWL 1I1AA 5HVWA 4KROD 4Y19A 3KPNB 2FSEB 4PRPA 2C4XA 1YEIH 3PDOA 4AM0B 3GRWA 2P4AB 3QHFH 4UZGA 3V6FB 4H1LA 1U41A 4LKXB 2EEBA 3HZVB 4WTZA 1F4WH 5HHNA 5C0AB 3TA3A 1NEUA 1F42A 5C0DB 5BOZG 3C6LB 2O5YH 3MBEA 2VDML 2EC8A 4NDMB 3QIBD 2O5XH 3QZWG 4PLJC 2X9YA 3GSUB 5B38G 4GQ9H 1I1AD 4XAKE 5FHBL 5ADOL 3RZCC 1QRNA 1JTOA 4R4NC 1DBJL 4FMFA 1JK8A 4KKCD 2DM2A 4D0CB 5T1DH 3PHSA 3BIAX 4KJYA 4PJAF 2OJZH 4OIBA 1MFNA 5LWYL 1N64L 1WVZA 1FP5A 1NCWH 3LCYA 4JG1H 4RISL 2FX7L 4TSCL 3NA9H 4QCIB 5EU7E 1NBVH 3SOBH 1FNAA 3RP1A 4F7TA 4A2MA 4FFVD 4OCSH 4Z76B 2NW3B 5FYKL 2A2QT 2AEIT 3U7YL 1XEDA 4P2YA 3KPRE 1JIBA 2FL5A 3U30C 3VGFA 1RFDL 4MWFA 3BHBA 1PYWB 4KMLB 4M5YH 5JDSB 1DSFH 2DBLH 2R4SL 1GL4B 1N26A 3ULUH 2OL3H 3QEGL 4JRYB 1EGJA 3IDUA 4CVXA 3CCHA 2IMMA 3VGAB 3H0TA 4Y5YA 5C9JB 4J3SA 1AHWA 2X4OA 4J6RH 5F7DA 3JWDL 3W9DA 4AG4H 3NCJH 4JZJB 4BKLA 1CF8H 2YOCA 3DSFH 4PJ8B 1KENL 4WCYL 1P9MC 2QADB 3BDXA 5CSZA 1UKSA 3QFJA 2AXGA 1NGQL 4YO0B 3WXVH 4JREC 3TIDA 5L2JB 3HUJB 1QSFD 3D39D 2IEPA 3QULB 3CFKA 2D7TH 1I9IH 5B39B 5HYJB 1IC7L 5J12B 3HZVA 1NCBL 4WJ5A 1KIRA 2JTDA 2IPTH 3QWOA 4Y0GA 4P23A 5TF0A 2VZVA 4I77H 4F9LC 3R1GL 1RZIB 4HUUA 4GW5A 5HYJE 1FE8H 5DR5L 3EBAA 1U8LB 2IG2H 2Y23A 5JIHA 4IDJH 3C2AH 4PJHF 4YNYA 3PQYD 4HXBH 1I3VA 3HR5B 1RZKL 4DVRL 2O61B 1Q9KA 3TN0B 2RFXA 5F7LB 4JRWA 4IMKC 3H9SB 4EI6A 4IRSD 43C9A 4HUXB 1MHEB 5EU4B 3S34L 1YYLH 2DWDB 1FAIH 3RGVB 3NTCH 4ZAKC 2JJTC 1MCNA 5F9OH 2EIEA 3VXRD 3V6ZB 5KS9F 1VB9A 4K07A 5D2LB 2CO6B 4ZPVB 1UWXH 1C1EH 3MJ9A 4HD9A 3N1PC 4ZUUB 5CCKH 1Q0YH 3TO4C 2BCKA 2NY7H 4LLAA 5CJOH 4NJ9L 4FQ1H 1IVLA 1JNLH 2IBZY 4KI5E 3R0NA 3I84A 4FHBD 4NM8L 5CEXB 4NUGL 4Z7UE 5HYSA 3CLFH 2ED7A 2OXHA 2QADD 2VUYA 3JV0A 5JXAL 2ENYA 1CQYA 5D1QA 1MCLA 4L4VB 3DX8A 4DEPB 4PBXA 4BSWA 5F9WB 4HULB 2OI9B 3P73B 1S9VA 4RGNC 3TPUA 2WBWB 5DJ2A 3RTQB 2OTUB 3PQYA 4R6UA 4TQEL 3IT8D 5T3XE 4GG6F 4IM8A 4NWUH 5DD0H 5L8JB 4KKLD 3BIKB 3CU7A 2VOTA 3A6BH 4BJLA 2XZZA 2FB4H 3BE1H 4XCCL 4Z6AT 1T0PB 1YY8A 1P7KA 2X4TB 4KUZL 3KJ4B 3D87B 5IB2A 3BVNB 3SE9L 5BO1L 1G7IB 1K4DB 4M3KB 3EZJB 3BDYH 4Z0BL 2D0GA 2F74B 3VGDA 1EVTC 5EU3B 5IEKB 2R23A 5EPMA 4JM2B 3C9NA 1DJSA 3QWRD 3NIDF 1ZT4B 1JPST 3GBML 4OGAD 4LHUD 1ZXQA 4OGYH 5F7FA 4NNXA 3GSNL 3ZDZE 4Y1AD 5DS8A 1GOFA 4ZTOL 3OGCB 3IJSA 2F53E 3F7VA 3ARVA 4OTXH 2Z9TA 1N3NB 4R0LC 3VD3A 5F1SA 4PP2B 4TVPH 5D6CA 5EC2A 1IGJA 1QLEH 1WIPA 3G5ZB 1OP3H 4L5FL 2IPKB 3QYCA 4YZFE 2QHRH 2AI0L 4UNUA 3MC0A 5DEFA 4P59H 2FGWH 4QHKJ 4GLRI 3E6HA 1CL7L 3GJEA 1P1ZB 5J1TC 3WJLC 1OAZL 4HWEL 5KSAB 4XHJC 1ZVYA 2BSRA 4QHMA 1JJUA 1HZHL 4OCYH 1NMAL 1LE9B 4PJFE 4AEFA 2E9JA 1T7YA 3D39E 4WFHE 2A6DB 1ZWIB 1FG2A 2MTPA 3C2SA 3CVHA 3HLAB 2UZXB 4OLXH 3BRDA 5CEYB 4GAJH 2DQFB 2V2TB 1T7ZA 5E03A 1S7WB 5IESL 4Q6YA 3GIVA 2XPGA 4OGYL 1YEDA 3QQ9D 4ZYKB 3PL6C 3BT2L 1IAIL 3D9AL 3WEXA 4QNPE 5DMYA 5ESAA 3U4EA 1T1XA 1D7FA 4I3RL 3E3QC 5LXGL 4DN3H 1IAII 5TE4H 2AQ2A 5D7JB 5FGCE 1Z2KA 4FABH 3ESVF 1UACH 5IGXL 1KN4H 3OG6B 4N0UA 5D1XB 3SDXE 5AWNH 5C7XH 1A4KB 5C2BL 2FH8A 1CD9B 1ORSA 4YWGH 4Z7WB 5TQ2H 1KCUH 1I8KA 1OM3L 3BKJH 4M93B 3HAEA 4BZ1L 5I1JH 1I3UA 2CIIA 5GSVA 3V2AR 4F3FB 1NLBL 2C3VB 3TBWB 4IRJB 4RGNB 4KKAD 1EO8H 1AO7B 3MLUH 3SKNA 2G75A 2Z8RA 2HFTA 1MF2L 3CFBB 3GMNB 1UXSA 3SDAD 1NC4D 4K23L 5ITBL 5DEGB 4CU7A 5I8CB 3I6KB 1AGCB 1QSFE 3WDJA 4GKNB 1JZ3A 2MJWA 1C16B 1S7SB 1AFVH 1UZ6F 3RAJL 1MCSA 1M7IB 4C56B 4QWWC 1KEGH 4J7RA 2QHLA 1Q9WA 3RL2A 1A1OB 1FFRA 1FFOB 3O45B 1KLGB 3BKYL 3N1QC 4GUPB 4MD0A 2ICEA 4L9LC 2BX5A 1VACB 1KB5L 1ZHNA 2VLRB 3BISA 1ZGLB 3DGCR 3G9VA 4FFZL 5DRNB 4OFDA 2DBJA 2VE6A 4FTVE 5EOCJ 1YEHH 5FKAB 5ALBL 1ZHBA 5D7JD 4O58L 2MQCA 1FYTB 4WUUB 1EBPA 3ZHDA 4HDIA 3KLHC 1IFHL 2X4UA 1S7TA 2D31B 4Y88A 5MI0B 4U1KA 3CXDH 1DANT 4KQ4L 4X6CE 4M7JH 4YEFA 1H8OA 2GJ6E 3ZTNL 1D6EA 3P30H 2OR8A 4E0RB 4D8PB 3O3DB 5ILTL 3JTTB 1CLYL 2H9GA 2BDNH 4L3CA 5IEHB 3ARYA 1TVHA 3AMLA 1V3LA 1D5IH 5A16B 1CGXA 5TH2B 4HXAL 5HY9B 4JO2H 5E5MA 5DQDH 3MJGX 4HZLB 1AQDA 4NUJB 5CJ5A 4AQOA 1A6TB 4QXGL 3HE6D 3NIFF 3MOAL 5ABDE 5HYFA 3I6KA 5HDQH 4QYOA 4CRPA 1KB5B 3HI6H 1F4XH 4QRQA 4DUXA 4HAGA 3QIUA 1ZMYA 3C5SB 3FQUB 2R4RH 2DB8A 1QD0A 3S3SA 3CFBA 4G8GA 4OLUL 2FWOA 1YEHL 4UQ2A 4C83A 5IESH 3HC3H 3LZFH 3UJTL 4WWKA 3D85D 2Z0BA 4C56D 3V8OA 3MLUL 2AKRB 3G6JB 3LVEA 1JZ7A 5F7MC 5INCA 5EIVA 1RJLA 2W60B 1KLUB 3KPPB 5GS3A 1J0KA 2FX8L 1RZ7H 4JRXD 4I9WE 3I50L 3KJ4C 3ARDD 5JPMB 3F5WA 4R4FL 4LLVB 1LD9A 4LSVL 1D6VH 2MPAH 4FOMA 1KXTB 4UDTA 1BOGA 4RNRB 2HJKB 5TDPA 3OKMA 3O6FC 4ZO6A 3PHOA 3WJJA 1ERNA 3JWNC 3U30B 3UTZA 1EIBA 1YC8A 1PY4A 4BQ8A 3VI3F 4HT1L 3MR9B 5DHYA 2BVOB 2CMRL 4DEPC 4I0PC 4YK4B 1ZS8B 4HIEB 1U6AH 4FQXC 3DUUA 3UP1A 1P9MA 2L7JA 1G7MA 4QXWA 2CLRA 4M03A 4EBQL 3EDEA 5ICXA 1ZHKA 5IVXF 4G5ZL 1A64A 3B9AA 5HVFB 4YEEA 1ZA6A 2HFGL 3RTQC 5CZVH 3MGOA 4PG2C 3IDMA 2DMKA 2OXGA 1TJGH 4ZD3H 4ZQKA 1KT2B 4JFYA 1XCTB 4XNYL 1GGTA 3CFEB 3WFCH 5JPNB 5KVDH 1TCRA 3L5WB 4XPFH 5LGJB 4Z7QF 4LIQH 3MV7E 1FV1A 3GKZA 5I66A 3MV9B 1EH9A 2ESVE 4YFLF 2FO4B 3QDGB 2JB5H 2R0ZL 3KPOB 1DE4A 1PJ9A 1AC6A 1FNLA 4NM4L 5BMFH 3KWWA 3PV7A 3WUWA 3IGAB 5C0RH 1U3HB 2RGSA 3EDKA 3Q6GH 1AE6H 3O4LA 3VE0B 4OLYH 2XWJB 2FJGB 4OZHE 3OQ3B 3HFML 3GSNH 5LGHH 3UJJL 4F2MA 3FHAA 1YNLH 5E8NB 3HNSL 2ORBH 4S1RH 5IMKA 4JM4H 3VG0L 1S9YB 2VQTA 4UMGA 2QQNL 2H8PA 1A3RH 4ZD3L 4KK5C 5DJCA 3CSBA 3BAEL 4ZUSB 4YFEA 5BZDA 4KGJA 2V2XA 1Z9MA 3U46B 3GB7A 1S3KH 1RUKH 2WUBH 4J4PD 4KKLC 1UCBL 1WBYB 1XGQA 4XC1H 4LSSL 4AK1A 1CL7H 2W1NA 3FCTB 1NGYB 1WC7A 3QCTL 1U8KB 1FL6A 5HYEA 3G5YB 2V5RA 3QH3A 4IHOA 1ED3A 4TTDC 4CNIA 2NY1D 3CZFB 3GMPA 1ZT7B 1WITA 5SWSA 5C08E 1AE6L 2HFFA 3L3GB 2PYEE 4J3TA 2P5WE 4X6DB 3WHXB 4RWYH 3DJ9A 1NGXB 1GZQB 3BEVB 4LAJH 1IQDA 1NDMB 1L9NA 5K59E 3SQBA 2UY7A 4PGEB 3SO3C 1F6FB 4C4KO 2W91A 32C2B 2G2RA 3FQWA 3TC9A 1E4KC 4OZHA 3VFNB 2I60L 3QRGH 2CLZB 4ORZC 1MQKL 3DTXB 4JHWH 4TOYL 2Q86A 4IIQC 5D6DA 3CAFA 2GYSA 5FUOH 2VDLL 3IRPX 3QSKB 4PPTA 2HJLA 5H35B 2G60H 4GW1A 1QLFB 3IXTA 4PJEA 3RU8L 2YD9A 2VLLB 4IOIA 1RU9H 4QRUB 4CU6A 2AJZA 4BELD 1CFTA 4P3CH 2PXYA 5GRUL 3IRZA 5IMMB 4J1UA 4Q9RL 3NZ8B 1C5CL 2J2ZA 1BLNA 1YNTB 3GSQA 3QUXA 4NCC2 5EBWA 1PY9A 3TT3H 5FHAL 1UWEL 5L6YL 4HPYL 2DL9A 4OZ4A 5I15H 3GSWB 4NBYB 2V2WA 4PJ5B 5EZOL 2IGFL 5D5ME 4EQ2A 4XVTL 4K3DH 1T1ZA 4XRCB 4N8VB 3MJ7B 1DDHA 5HD8D 5HGDB 3VFWA 5EG6C 1IEHA 2E27L 4M00A 1IM3B 2BVQA 3X11A 5I1HH 4HGWB 2K1MA 3ZE2F 3VXMA 1PLGL 1JI1A 4TUKH 5SWSB 4W6XB 4K7FB 5JLZA 3QULA 5D1ZA 4MAYA 5CGMA 3QB7C 4X4XB 3ZKMC 3TFKD 4Y4FC 4ESKA 2XZAH 4Z7VB 2ZG2A 1BFOA 4JFPA 4XBPA 1CFTB 4X7TA 1V7ML 1CDCA 2V7NA 4R3SB 2VDKH 3TJEL 5KS9B 3BN9C 2HMIC 3K4ZA 3T0BA 1T1YA 2WZPD 5DJCB 1S78D 4PJEB 5MENA 3VRJA 5FM5M 2JIXD 1FZJA 3V0VA 3CVIH 5I16A 3NFSL 1ZLUK 3FB6A 5JOPD 3VFNA 1JHTB 4JM4L 3VG0H 3VH8A 2QQKL 4U1IB 2V9RA 3IU3B 5SWZE 1N6UA 4X5WB 3P0GB 4RBPK 4YIQB 5DSCB 1AHWC 3H42H 4NQXB 4KK8D 4LHQB 3BO8B 3VFTB 1RUPH 2M1KA 3QUKA 4M48L 4KK6C 1U0QA 3WN5C 2HTLD 3MGOB 1FL6B 1KCLA 4OF6A 4FXLA 3ZE0E 2BSTB 1I3GL 1F13A 4R96B 1X44A 4M02A 3UAJC 4OAWB 4U3HA 2XKNA 4WUUD 3TESA 4LVHB 3QCVH 1QZ1A 1T04A 4OLVH 2MKWA 3U36A 3EUUA 4RFOL 4JFEB 4KVNH 5GZND 2H8PB 2VUOA 5FDWA 5EO9A 3MRBA 4FG6D 4U6HA 3O3UN 2FX9H 2PYED 2BNQB 5GGUB 2F15A 5IFHH 3B5TA 3L5IA 2ICCA 1TFHA 5BS0A 1IL1B 3OKLA 2EDBA 1QLEL 1DEEA 1BJ8A 1KEMH 3FO9A 4LLVA 4TVPL 3QPXH 2EDYA 4QRRD 4YXLH 5GGTA 4X7EC 2COQA 2I9LB 1MLBB 4HUVB 2AEQH 2QKIB 2F9BT 1QHOA 4S2SA 1UXWA 1DE4B 3MA9L 1QHPA 4XNZC 4IMLB 1EK3A 5F3BA 2X4NB 4TNVF 4KI5F 2E6JA 2FEDC 5KAQF 1CLOL 1T1WA 2AK4E 2EDOA 4Q2ZA 3W5NA 2HA1A 2PTVA 1HWGB 1HDMA 5FECB 1AGDB 3MLVH 4XVUD 1GGBL 3HPLB 1QSEA 2C7UA 4L4VD 4JFXB 2Y5TA 4XMKL 3U9PH 3H7BA 1N6VA 1S7VA 5HXMA 2LTQC 4G3YH 5BQ7A 2G5RA 1A1NB 1TJGL 2E7MA 1E27A 3VFRB 2P45B 4X0KB 2AI0H 1TZIA 3QIUB 3AREA 3P3YA 1F5WA 3OXSA 1RSFA 5HHXL 2Z31A 3C6SB 3ULSB 4JY6A 2WK2A 4KZDL 3ARFC 2IBZX 4U1LA 5CP3A 2VAAA 1K5NB 4O2CB 2JB5L 1JHLL 2P1YA 4N0UE 1PX3A 4R9HA 4QLRA 5C07E 2XOTA 5CJOL 1CFSB 2VZOA 4RFOH 2VE6B 5JIIA 3T65B 2HLAA 4AT6B 1BM3H 4Z18A 4D2NA 2VWEE 4KC3B 2R56L 4KVNL 3VD7A 5C6TH 2Z91A 1LO5B 6FABL 1KLUA 5JXEC 4HIXH 3WSQL 4HF5H 3ZLQC 4MD0B 5IVNA 2X4UB 1QFWL 2R69H 4HFWB 5E08H 1INDL 1U8PA 4RGOH 1WAAE 4ZSOA 5F9JB 3T77A 2P7TB 15C8H 1YEKH 3HB3D 3BUYA 1N6QL 5BQ7B 4NN6C 4OT1L 4X4ZA 5F3HA 5FKAA 1UG9A 4JCLA 1K5NA 4O2CA 4DVBB 2CJUH 5CEZD 5IOPB 4JQVC 2VLME 1T3FA 3VFTA 5FM4A 4HXAH 3O8XD 3FO1B 1UZ8B 3MLTA 4Y16D 4O02L 1EGJL 5JTWA 2BNQE 3CLEL 3V52L 1QR1A 5EZLB 1VKXA 2X40A 1OPGL 4Z78A 5T3ZL 4ZUVB 3QFDB 2L4OA 1GAFH 3DVNA 4HLJA 1BMGA 1CGWA 4GOSA 4L3CB 4U1GB 1NAKH 3R8BB 3QDJA 4KJWC 4M6AA 3WUZA 5DDHB 4RWYL 2DS4A 3CFDB 3TCLB 1EUTA 4LNVA 5L8KB 3MXVH 4X9GA 5DEGA 4M1CD 1I7UA 1QBLH 3HMXL 1U91B 1XR8A 5F3HB 4OIIH 4QRRA 5CIPH 1NMCB 3OJDB 4PRNB 43CAB 1D5MB 4OCXL 5F9JA 1SVCP 15C8L 5SWQB 5E7BA 4U1JB 1T66C 4KTDL 4OQTL 3BWUC 1JGVL 4JPKL 4YC2B 1XZ0A 3SBWA 4HMEA 3X3FH 1CIUA 4HUVA 1MLBA 5CBAA 1FL5B 3HZKB 1RU9L 3I02B 3FT2A 2XQYG 3RDTC 1T03L 1FFQA 3U36B 5CKAA 5DQDL 3WEXB 3VA6A 4JKPH 2YUWA 4BK4A 4IJ3B 4O9HH 2EO9A 3OKLB 2HLFC 2CR3A 1P4IH 5JUEH 2EH8H 1OPGH 1ZVSA 5KTEL 5KANG 1WIUA 4F8TA 3B8SA 4EN3C 4PJEE 2IFFH 4K3DL 3GO1H 2VXQH 1YEJH 3MJ7A 4H26B 2WP3T 3EYOA 1QEWA 5F9WC 4OFYA 1UJ3C 3U4BH 1ZK9A 1NLDH 5D9SB 1B4JH 1QSEE 5M7QA 1JV5A 2MSPA 3GIVB 3K1DA 4LVOB 4ONFH 4S0TD 3CPLA 5TE7L 2Z35A 5B21A 3VFMB 4XTRC 2B2XH 3OZ9L 3QRFM 1NGWB 1SEBA 2ZOKB 4P5MA 4Q6IC 5SWSE 2PXYB 3UO1H 3WXVL 4Z8FH 5TJWK 3IDXH 5IVZB 1DQMH 2Q7YA 4U1NB 1QFWI 3BZ4A 4L8BB 1QA9A 1JPGB 2GK0A 5EBGA 4AYFA 2G5BB 4KJPC 2NY0D 2VQ1A 1VFMA 3F58L 4KUCD 5DS8B 3PDDA 4UILL 4LCCA 5D71H 3VRLE 2VLMD 5GIRA 1F11A 3N1GC 5BS0E 2GTWB 1EJOL 1FORH 5J1AB 5EU3A 1ADQL 3GK8H 1FRGL 2OL3L 3MX0A 3E0GA 3LRGA 1G7JA 1XMWA 3I6LD 1PW3A 4F8QA 2ITCA 3HE6C 5AAMA 4P99A 4PG9A 2HFFB 3VXMB 5ENWB 3H3BC 5IQ9B 5GRJH 4ELKB 2JJTA 3EAKA 3IDNB 4NJAL 5DC0A 5I1IL 1FJ1B 1T20A 5KVDL 1CZ8H 2AK4A 3WFCL 3JTSA 3LKQA 1FZKB 1SQ2N 4JDVB 3NFPA 3FB5A 4ODXB 4LIQL 5JIKA 4JFEA 2OLDA 5TQ2L 1OB1B 1J0HA 3LKNB 4ZNEE 3TFKC 3ZKMD 3DXAE 4YDJA 1TTGA 2DICA 1MLCB 4M8QA 1DQDL 4QGYA 1U6AL 3BIKA 5EU6E 2DQIH 1NFDE 4KH2A 4R7DB 3QDJE 3BW9A 1UH3A 1GZPA 4X8JA 1MIML 5E94B 4YH6A 5A2LH 3IJSB 2PR4H 2NR6D 1NCCL 4H25B 4FMKA 3BGFB 3GNMH 2XTJE 3DROA 5DGQA 3PWNB 2JLLA 5GZOD 3T4AB 1S9KC 1LEGA 4J1UB 5IEKA 3HRZB 1F2XK 2ARJQ 2O61A 1K8IA 3MV9A 4NQUA 4APQB 1B3JA 4U7KA 1BIHA 1MCPL 5IF0B 4NQTA 4YDIL 4WTZG 2A0LD 3O41B 3V0WH 5IMLA 4NO3A 1ZT7A 1BVZA 1E0OB 3RVVD 1CI5A 4PJ5E 4GW5B 4JRXE 4DOHE 2X1QA 1EEYA 3K7UA 4OZHB 2D4FA 1A9EA 4P4KA 2V17L 1BF8A 2BRRH 3NZHH 1HHKA 2BNUB 2I27N 5DLMH 2F5BH 3UJTH 4PRHE 2H32H 4PG9B 3ARPA 4JFQB 5L8LB 3QDME 2ESVB 2IC2A 2EC9U 3MR9A 5INDA 3MSPA 5FUOL 5DZNA 4GAYB 2DQUH 2HT3D 3QWOB 5F9AC 5A43C 4F2MB 1WBYA 3GMOA 3VWJA 1ZVSB 2H26A 2FNBA 5GGRA 3S34H 3WD5H 4OZIB 5JA9A 2JCCF 3GSVB 5GXBB 4MAUH 3DRTA 2FZ3A 2P5ED 1PSKL 2OMNA 4YHZL 4S11A 4FQLH 1HEZB 5CBAB 2EDKA 3HUJA 4HUXA 5L88H 3ORJA 1UC6A 2C3XA 4LCYA 5DT1H 1DTUA 1OWRM 4R97C 4GRLC 3SCMB 1Q9KB 3TN0A 5GJSH 1T80A 3U0PB 4XXCA 2JELH 4GAGL 5T5NG 2NY1C 4QRRB 4GS7B 3PG2A 1TMCB 4J3XA 4RGOL 4S1DD 2CH8A 5T5FL 1U8LA 2VXUH 3HS0A 4FQJH 4YBLB 1CF8L 1LVEA 2Q7NA 1JBJA 5DYOA 4CBPA 4OI9A 4XP9L 4JGUA 3O3EB 4NQDE 3DPBA 2FIRT 1C08B 1FO0B 1D6VL 3P9MB 5TH2A 4P46B 4XH2A 1A7OL 1NGXA 4PJBA 2FHCA 1XH3A 1TTUA 1JHLH 4YHLH 3FO1A 2PNDA 3ARFD 5CJXC 4PB0H 3DXAA 1Y6KR 3TM6A 2E9IA 1JUFB 2EDNA 4IHOB 4E9LA 4DVBA 2ATPA 2HRLA 4KQ3H 5F7NC 3T0AA 3TIEB 5E4EC 4DKDC 1XGQB 1YN7B 1MJJB 3EJYC 1KJMB 3SE4C 1J05A 1KCKA 2PO6A 3QDGE 4NQDD 4M5ZH 3DX7B 4F7PA 4EVNB 3CK0L 4IBLT 1ZGLP 1ZA3A 3GKWH 5HI3C 3BP4A 4KU1A 1DQQA 2P5WA 3WIIH 1AGEB 1D5ZA 4PRIB 2B1HL 3V4VL 2AGJL 3LS4L 1JNJA 1R3JB 1PFCA 1H0DB 3NIFE 3HZMA 3O45A 4JVWA 4WW2B 3RKPA 4ZFOA 1MAKA 1MWAL 1RIHH 1RUML 4NPYA 3TV3L 5K9QG 3ZE0F 1PG7W 4XP5L 3KPNA 1UZ8A 3VWKA 3ILQD 1OW0C 3Q6GL 3X3GH 2CUMA 1FYTE 1FIGL 5GS0L 1MI5B 3VFRA 3NZHL 2R1WB 3PHQB 1EO8L 3QBTB 3QZWA 3M17B 4YPGB 1OLLA 4O58H 4NP4L 3DMMC 3NAAH 5GGSY 3MGAA 4XI5D 3O3DA 3ARQA 4Q9QL 2WM0A 3KPRD 5IOPA 1C12A 1HKFA 1IGYA 4L8SC 4NDMA 4X99A 1AGDA 5HJ3B 1HDMB 3O9WD 4KHTL 4WWID 3MYJA 1CFSA 5EORL 4M9PA 3IDXL 5ICXB 2P7TA 4LKXA 2WINA 4XXDB 1FDLH 2ZPKH 3SJVB 3SDCB 5ISZA 2DQHL 4YAQB 3ARRA 5I8EA 3MV7A 2YMXH 2DD8H 4WW1A 4J3WA 3MOAH 4MD4A 1EJOH 5E9DB 4RGNE 1UKQA 2RCSL 1WWWX 4AEIH 5JHLH 1JE6A 1P7QD 1LD9B 2BC4B 5H8DA 2Y07L 5FGRA 1BD2B 4LPYA 1Q72L 3W0WE 4XNXH 3CK0H 1LO2H 1RV6X 3INUL 3MXWH 4UV4H 4UV7L 1KNOB 5CP7A 4P49A 3EFDH 5BZWB 4DW2H 1QP1A 4I1NB 4HBQA 4MA7L 4B0MM 5DD0L 3TT1H 3RIAF 5HHME 4I0PA 4HJ0D 4HEPG 2SEBA 1NMBL 4YPGA 4XCCH 4G8GB 4UQ2B 2DAVA 1E4WH 2GJZA 2I07A 1I75A 5CGTA 4LGRB 1TJIL 3H8NA 4GXUN 2E6PA 1I7RA 5ESVA 2Q8BH 3BD3A 4Z7WA 3QXWA 4ODTL 1HYRC 1DEEB 1KPVB 4HUMB 4XPTL 1A4KA 2IH1A 5MERA 1H0DA 4MXVE 3AU1B 3BP7B 1NC2A 4MS8C 4XMLL 5C8JA 3C9NB 3CVIL 4XMPH 3EYQD 3VWJC 3U0TB 3EOAA 3JTTA 1OGAE 5I16B 4S2SB 2D0HA 2FGZA 1NAMH 2PKDA 5C0AD 2W0FA 5KG9A 1YMHB 3ZKXC 2OZ4H 2BDNL 4C56E 4NQSA 4RMTA 3T8XB 1WZMA 1AR1C 3RY5A 3QG6A 2FGWL 1KIPB 4TUOA 1P7KB 2X4TA 4CJ1A 1MUJB 3V5HB 4H88L 5ISZD 1INEL 2DYPB 1KBGH 1BJ1J 1MHPL 3MO1B 3FQRA 1WV7T 4PJIE 4UOW1 3O4OB 4KKAC 3HG1A 1FG9C 4HK0B 4G6FD 1EBAA 4N0FB 3LKSA 25C8H 4C55A 5D1ZB 4X4YA 3JBG7 4P5TC 2EKSB 1X5ZA 1BQLH 4L4JA 4F7EA 5F71A 2X05A 4HGKC 3OHXB 5A2IH 1MFAL 3QG7L 2R0KL 1G9NL 5C6TL 2FH6A 1JMXA 5GRVK 4P46A 4A6YA 2PN5A 1UM5L 3CDGA 3AUVA 3B9EA 1INQB 1X5KA 2R15A 5EU6D 1A22B 4XMLH 3O6LL 1YEFL 1OP5K 3SPVB 4PP2A 4QHLA 5IW6A 1AGCA 4JKMA 1G9NC 3RNKA 3CX2A 2RHEA 3QAZC 4J8RA 4MDJA 2DQUL 1EXUB 3QIUD 4JFFA 1J88A 2DWDA 4NNXB 3WS3A 5GGTL 3TVMB 1QKZL 3HCVA 1BHGA 5LQBH 5TGBB 4LMQI 3VFPA 2EIDA 4Z0XA 2E7LA 4HS8H 2J8UE 3PWJB 2D4DA 1MVUB 4QRUA 4NT6A 4FZEL 1PSKH 1U3HD 4XVJH 4XVSL 4NKMB 5MENE 1K4DA 1G7IA 5I71C 1O0VA 4EI5A 2X4RA 4Z7UB 1NFKA 5E6ZA 3QI9B 4OZFG 5MEOA 5H35A 3D39B 4BA8A 1IGMH 2ZJSH 1R3LA 3CLFL 2VRAA 3F65A 4BH8A 1CFVL 3BP5B 1JVKA 3DTXA 2OR9H 2JCCE 5E2TH 2PW2A 3IF1B 1JMZA 4S1RL 3RL1B 5GGRY 4LPTA 3BFOA 4X8XA 4W6WB 3FQNA 3QISA 4M7ZC 5GGQH 5H37H 1KJ2A 4HHAA 4OD3L 1OOAA 4G6FB 3WIHA 3CIQA 5IHZB 3TH2T 3HC4L 1F3DJ 4KXZI 2LFGA 4BZ2L 4YXLL 3T0EE 5ICZA 3IAQA 4YDKL 4OJFH 5D7IF 5HHXH 2H2PC 2JJSA 3UBXG 3CXHJ 2F58L 4R0LA 3CDFA 3TV3H 4YZFF 1A3QA 4UB0H 1F3JA 4HBCH 4XP4H 3RTQA 1KJVA 2YEZA 1ZAGA 2APVA 2HAZA 4TULL 2W65A 4YHNB 2VXVH 5DK0A 3WLBB 4PGCA 4ZS7L 5FK9B 1VFOA 1WBXB 4DK3A 4GW1B 1T21A 3EKCA 3MRNA 3ZKNC 4NQEB 3BKCH 3P40A 2FJHB 4MA8H 1V3JA 3HNSH 4UI2A 4LLUB 3E6FB 5F93C 2CXGA 4X7FC 1MAJA 3U9UA 2B5IB 3LEXA 3A67L 1U8JB 1UVQB 2Q3AA 4PJDA 1XR9B 1DLFH 1JWSB 3MRQB 4FS0A 1U8NB 3F7VB 4NQCE 5ADPH 5IQ7L 3LS5H 2OTWA 3QQ3A 1DBML 2OR7A 3LKRB 1N64H 1QLFA 4JLRB 1EHNA 4Y16B 5I8OH 5EO1B 2HT2D 4BZ2H 4J3UA 3K0WA 4CNIB 2AJYL 3QCTH 5F1OB 4KFZC 3QI9D 4KJWD 1AIFA 3ZDYF 1VERA 1DEDA 2VDNL 1KIRB 3ISWA 2Y6SC 2XA8L 3B2VH 3MUY1 3IXAB 3BEVA 2NY5C 5J56B 2X7LA 3V7MA 1I9RL 3FFCE 2DI9A 1Q94A 3L1OL 5IB2B 3MRMB 4G80B 3ES6B 2XI9A 4YJZL 1E4XL 1AI1L 4NGHH 1YJDL 5ANMB 4JANB 2FHBA 4D0DB 2DRUA 3LKQB 5L2JA 1KTLA 1RIUH 2CIKB 2A9NH 3PV6B 5IMKB 1NGYA 1WC7B 3FCTA 4PV8A 3MRJA 3L7EB 3FQTA 4JAMB 3JZ7A 4ELKA 1ZHKB 3F7QA 5FCUH 5D4QA 2FIKB 1FIEA 4OZHF 2XWJA 3UPRA 4ZUSA 5AG8A 4QF1A 4RAVA 4PRPB 3U7WH 3SKOA 4NNYB 5EU5B 4ODWA 3C5JA 1AD0B 5T3XL 1DLHB 3EGSA 2BXYA 1M7DB 2DDQL 4GFTB 2VLKA 4JM2C 5CSZB 4DQOH 5I1EH 5F70A 1WWAX 5KJRL 1T2XA 2XTJC 1TVBB 3Q1SH 5I1AB 1TNNA 3B9KA 5HDBF 3VE0A 4OB5L 4X80L 1C8PA 1GGCL 5C0AE 4N5UA 3TP4A 3SGKA 5KSAD 1P53A 3BH8B 4HS6A 3CFJA 5FUZL 4WHTB 4OIIL 2B7DT 1YEKL 5K9JL 3BPLB 5AEAA 1MREL 2FWOB 4C83B 5CLWA 1F6AA 5HI4C 3O8XA 1YQ2A 2CDFA 3VDCA 5K33A 1WCQA 1RK0B 2GSIB 2YC1B 3QXVA 4DZ8B 3O9WC 4H26A 4DGIL 4NNYA 4LCWD 1OQXA 4GKSB 1HINH 4JHAL 5DUMH 2VN4A 2PTTB 3MFGB 3OXRB 4RZCB 4M3JA 1SJHB 1TQBC 3HR6A 1FLTX 4F9LA 4EKXA 4NRYB 3MACL 4L9LA 4WENB 4XC3L 3F12A 3MLRL 4JY4A 1K4CA 5EZIL 4Z7WF 1SMAA 3MCKA 5C0CA 1KTLB 3KPRB 5FKPA 3QNYB 4UAOC 1WJ3A 5DD1L 1A5FL 1J10A 2NXYC 5T1KA 5ITBH 4LOUD 3L3JB 3QFJB 4OCWL 4HDIB 2YK1L 5IB3B 4FQJL 4NZUL 4PREB 5SWZD 1RY7B 3K74B 4PJ8A 3CSGA 4POZC 3C2AL 5FA4A 3WFEL 3F6IA 1N7MH 2AJVH 4WHTA 2CKBA 4M1GH 3SKJH 3I3EA 5DRNA 1C7TA 2NY3C 1U8IB 4JPVL 1FGVL 3G9AB 1FO0H 1H3TA 1OARL 4GXVH 4GUPA 3O2DH 4FNLH 3AS1A 2AJ3A 3CFIC 3ARGB 3MRQA 4G6AD 1ES0B 3Q5OA 4JFHE 5A16A 1PG7X 1W72L 2NY7L 1Q1JL 3U9UB 2VLKD 4Y5XA 4WHCA 1ZLVK 2OQJA 4NQVA 4WW2F 1XF4A 5I1CH 3PE9A 4ZMAT 1MF2H 1UB6A 3PL6D 4MDIB 3UCRA 5ID1A 3ROOB 3W0WA 4QF1B 3LRHA 4K2UH 4HZLA 1OVZA 4RBPH 3MJ9H 4PTTB 2E7HA 4IRJC 4J3VA 2R0WL 1B6DA 5HYJD 5FFLA 1AXSB 3QPQD 4MZ3A 1RUKL 1T7VA 2WUBL 1CQKA 4DTGL 4Z77B 5IBLC 2OS7A 1D3CA 5CZXD 2ZCLH 5DRZB 3RJQB 4U1KB 2P5EB 3ARBC 4G80A 4LRIC 4O4YH 3VXPA 2I25N 4NKOA 3U83A 3AS2A 4MNGA 3QDMD 4CGTA 2GSGB 3Q1SL 1FFOA 4HMDA 4I8DA 4E41A 4NN5B 3U7YH 5HDLA 1R3IL 4MQTB 2ADIB 2DD8L 5JOPE 1JPSH 3LV3A 2C3GA 2FHFA 2YPLA 3VXSA 3TO4D 1SBSH 2Z31B 3C6SA 2EYRB 1UWGH 1EVUA 1EO5A 4P2OD 5EUKB 3SBWC 2ICWA 2X1XR 5J3HC 1IE5A 3O6FD 3G6DH 3V95A 1QFPA 3STZA 3TVMD 5SV3A 1XF2A 1ZEAH 4PG2A 2Z4QA 5DWUL 1M7XA 4LGSB 4C59B 3JV6A 4LSVH 1DBBL 4JGJA 2B5IC 1U92B 4MA3A 1HNFA 1FVCA 2ZNXA 5DTFB 1X7QB 1VFUA 2X70B 4K94L 1K3ZA 2GUOA 4G9DA 5EFIB 3ZDZF 1LEKB 5D72H 4G42A 5E8EA 4ONGL 5BXFA 4HWBH 2V5MA 3HC0A 4L3EE 1LNUA 2NW2B 1P1ZA 3PGCA 1BD2E 4F9PA 4KK9C 3QNXA 4HCRA 2HKFH 3UROR 5IW6B 4QHLB 3WN5B 1X5AA 4HWBA 3CDCA 2VDMH 3BPLC 5D7LB 3TZVA 2W0PA 3G5ZA 5FM5O 4GBXB 4I0CC 4WNQB 3KPQA 4R0LB 2LTQB 3DYOA 3FAXA 1QBLL 1FSKC 4E42B 3PWPB 1KYOK 1HH9A 1P84K 4PRAB 3DXAD 2AS5M 3VRLF 3RKDC 3RWFB 1JHKH 3SDYH 4U4BA 4RQQB 2R0LH 2X4QA 3HLAA 3TYFB 5BOPA 3QCUH 4U6XA 3ARGC 3H3KA 3V5HA 2J8HA 1R3LB 2PUQT 4RMUA 1BZ7B 3QFJE 4NKDA 4PJXA 1DP0A 4ONGH 3VXRA 3Q6FA 2X4RB 3SDDD 4O4YL 3SGKC 5J0BA 1RHHA 3IKCB 1W72B 4KVCH 1ZTXH 4JPWH 3RBGA 3EOAB 2XZQH 3VFPB 5JW4Q 4WI3A 5C0GA 4LSTL 1P4BH 1MJ8H 3DETD 3H7LA 2OTUA 1XF3A 5HI3D 4JRXA 2GTZA 4F7MA 4J12A 5C71A 1FNEB 3DX6B 5DJAA 3C87A 4TRPL 2R2CA 4JFFB 4B7IA 3DX6A 5DJAB 2V6HA 2NMSA 4F80A 3U4AA 3B3IB 3RNKB 4N1EA 5CHNA 1UJ3B 3O0RH 5D6DC 1WFUA 3GBLA 3AVEA 3VXSD 3NGBC 1A2YA 2VXTL 3MRIA 1TQBB 3PWLB 4KDTA 4ZXBD 2N7BA 5D2NE 3UBXA 4G6JL 5T3XH 3F58H 4BQBA 1PVHA 5HHVL 1S7RB 5FYKU 1MI5D 4YC2C 3MRCB 4XP1L 1YY8B 4PD4K 2O26U 2ARJB 4FZEH 2WIIB 1YMMD 4P5KA 3MLZL 1AKJD 1C5BL 4KDVA 4PJ7F 3LV3B 1OHQA 2FRGP 4D0BB 1FGNL 5D5MF 1MCEA 3MREA 4RMQA 5E8PA 1QG3A 1AGFA 3JSSA 2EDFA 5M94B 5DJYA 4NKOB 4RX4A 2ICWB 4X6DF 3W2DH 2I24N 2ZNWA 2Z8WC 3BYTA 4OBRA 3QWRA 3CSYB 1W0VB 4U1GC 2P8MA 1A7PL 4OFKA 2OZ4L 1DBAH 4PRPE 2PYFB 4NFDA 1KEGL 1BWMA 1REIA 4LMQE 2BHZA 2WWMD 3SO3B 3QCUL 1N0XH 1UENA 3SJVD 3EYQC 3LN9A 5JW3L 2R0LL 3BP7A 2ARWA 1Z9OA 1I7TA 3D69B 3ROLB 3IFNH 4Z5RA 4Y7MA 4QRSA 1DANU 3JV5A 4TNVK 1FO0L 4DQOL 4H1LH 3CLEH 3V52H 4WDIB 1MVFA 3FT3A 2V7HB 1JTTA 5I8KH 3PIQA 4U3XA 4NKIH 2DJUA 2BXZA 5IFAH 5T5NF 5D7LA 2AXGB 2XTJD 3P2TA 3M1BB 4HG4K 5JO5A 3D48R 3IU4L 5IVXA 3LMJL 1XF5B 4CW1A 5DLML 2WBJA 3HC0B 1NKOA 4MJ2A 1MFBL 2UZIH 1CN4A 1IILE 5FUZH 2FBJL 2GCYB 2XN9B 1R5VB 3KYMA 3DVGB 4G8FB 4LIQE 1Q38A 2CLZA 2EDTA 1UACL 4P23B 4NQCB 4UOJA 4LDOB 2CKBB 4EQ3A 5HGBA 2CXKA 2V5YA 4IRZH 4P23C 1VHPA 4UBDD 5DUML 3T4YA 3RWDA 5EWIL 3CC5B 4UIMA 4UU9A 4NQEE 5D1ZD 1ZA3B 3DRQA 2K9UA 1NUDA 4R2GB 1H9VA 3W81A 4G7YL 4OLXL 2YMXL 2YPLB 2B4CC 5IMOB 5ETUB 1OSZA 3MFFA 4PJFF 1KIQA 2PCPA 3RVWC 2CPCA 1BVKA 1U3JA 2JK5B 5GSRA 4KJYB 2BNRD 4PTTA 3LH2H 5E08L 1X5GA 4JZJA 1DL7H 3EOTH 4JQIL 3O9WA 3FOLA 3MV7D 1CS6A 1JUFA 1A6AA 3TYGH 1IAIM 2YPKB 5D7KD 1S9YA 2GSIA 5BS0D 3V4PL 2OQJB 3J7HA 3KPSD 1LHZA 2CK0H 4DGYH 1JYVA 1AGBA 3F12B 1OTSC 1YECH 3MLPA 4GG6E 3BRGC 3C08H 3GIZH 3CMOH 4BKLB 1KF9B 5J13C 3BH8A 4HS6B 1MY7A 5HYIA 5C70A 1BBDH 2FJFB 4CMHC 3RWIB 3AREC 4UQ3B 5EOCL 1G7LA 3KXFB 4M7ZB 5E99L 3SE3C 5EU6B 4RA0C 3J8F7 3MRDA 1IM9A 2DLTA 4PREA 4PJ9D 1DCLA 4L4TE 2NW3A 3A67H 4WRLA 3ULVL 3L6FA