2PYFB

Crystal structures of high affinity human t-cell receptors bound to pmhc revealnative diagonal binding geometry unbound tcr clone 5-1
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
241
structure length
241
Chain Sequence
GVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGTTDQGEVPNGYNVSRSTIEDFPLRLLSAAPSQTSVYFCASSYLGNTGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-Cell Receptor, Alpha Chain
publication title Crystal structures of high affinity human T-cell receptors bound to peptide major histocompatibility complex reveal native diagonal binding geometry
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 54
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2007-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2pyfB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2pyfB02
3WN5B 3H3BC 1L6XA 3V4PL 1MCRA 1R3KA 1U0QA 1PKQA 5SWQB 4KKAD 4WWKA 3MV9E 2X7LA 4X99B 5J12B 3EYUH 4YBQC 3QXAB 3MUGB 2UUDH 5DVOA 4F80A 4X6DE 2NY5H 2OP4L 4ETQB 3HNVH 4KUCD 5DUPL 5A16A 5LXGL 1NMCB 4NKMB 3BP6B 4PJ5A 5F6HI 5DI8A 3MZTA 1CXHA 1EFXA 4IRZH 4HCRA 2BZDA 1JUFB 1YEGL 5C0AD 4B7IA 5HGBA 3S97C 3P0YH 4PRDA 2PW1B 3QUZD 3CFKA 3ELAT 4EVNA 1CWVA 3B2VH 3MCLH 1FSKC 4Z76B 4AEFA 1KB5A 2X4TB 5I8OH 3RA7L 2IADB 4Y4FB 3FQNB 4HIIB 4JHWH 1RJYA 2WSKA 2NNAB 5IHUL 4A2LA 4ZFFB 2ERJB 1KTDB 5I1CL 1AGCB 1MWAB 2FHBA 3X3FL 5JIKA 4NHUB 2IG2H 4U3XA 1CQYA 1KTLB 1UCBH 4MD0A 1N5AB 4UNVA 3S3JA 2VLKE 5MENB 5IKCB 5JXAL 4BFGA 3RAJL 4JFEB 4I4WB 3QUKB 4AK1A 4LPYA 1NCCL 4GRLB 2YD5A 1JJUA 2Q8BL 1QLEL 3AY4C 3O8XD 4ZUWB 1IAIL 1QZ1A 3G04B 3VXNB 3TEUA 3BIAX 4RMSA 1INQA 3TNMB 4FQCH 4EN3D 1OAYH 1MCWM 3FO1B 3CSPA 5DVNA 2EEAA 2IAMA 4J1UA 3TYGL 4G6MH 2X89D 3C08H 4P0DA 1QD0A 4DN4L 1WIUA 3BPNC 3SJVB 3UTQA 4DN3L 4UDUA 1VEMA 1J1OH 3MRCA 4S0TD 4PJCE 1IGIL 3K7UA 3LRHA 2DBLL 2D0HA 1U6AH 1XIWB 5FKAB 5E8OB 1MI5D 4Z9KB 1ADQH 1TFHA 4OFPA 1Q0YL 3QDAA 2Z8RA 2Y25A 4X7TA 4AIZA 2CKBL 2FATH 5C7XH 4BQ8A 5E1AA 1FFNB 4I0PC 1CICC 3REVA 2CIKB 2HFFA 4DZBA 5FB8B 5L7XL 4HG4K 2EYSB 4YEEA 3DUSB 2BVOA 1FLRH 1KG0A 1YEEL 3EJZC 2WP3T 4N5UA 1KELL 5J9PB 1FVDB 4YHIB 5IHBA 3MRNA 3QHTC 4WRLA 3VFPB 2Y5TA 2EE2A 3TO2B 3LS5H 2FBJH 1T83C 1D3CA 3U7YH 4YO0A 2P24A 1EEYA 4C57C 1D6EB 5I1GL 3MV8A 1S3KH 5ERWA 1I7RB 3PXJA 4KI5E 2FJFA 2KDGA 4KV5F 2EZ0C 4MD4A 1RIHH 3HNSH 4QRSB 5D96C 4LRNL 4PJ7B 5LBSH 3VXOB 4G8IA 5CBEB 4Y2DC 2C1OB 4Y4HB 3KGRA 2J88H 3TN0C 4NBZB 1VKXA 1JWMB 4JHAH 5B4MD 4P9HL 3DMMA 5CUSL 2HYMA 5DMGD 3I75B 4I48A 4K7FB 1UVQA 4OZFA 1I8LC 1MJJB 4Z5RA 3BYYA 2HLFD 1KPVB 3NCFB 5H94A 4ISVB 2GFBB 5SWSB 3DYMA 3PWNA 1ZA6A 3FQUA 4Q6IC 5JW4N 4HJJH 3P40A 2N7AA 3V95A 3ZT6A 5KS9F 5E8EB 2HT4C 3R0MA 4ZUSB 4C4KO 1AGFA 3FOLB 4L4JA 3D25B 4QRRB 1SEBA 4S1SH 4XTRC 5DD6B 5ICYA 1F4YH 4IIQA 5IJKC 4MJ6A 3VXUB 4ZOEA 3ULVF 2VWEC 5IVOA 5ID0B 2G5RA 5FYKL 3I9GH 4PGDB 4HEPG 2XT1B 1DVFB 3OHXA 4G8FB 2YK1H 2VZOA 1KN2H 3LKQA 2NTFB 3V7MA 3T1WA 2JLLA 2YOCA 4HC1L 5GGRB 4Y19B 3IFPA 5JNYA 1RZJC 1TZIB 3SDXE 1N3NA 1ZVSA 4D9QD 2WQ8A 2APVA 2DQHH 1K6QL 2FWOB 5HHVL 1EXUB 5IEKB 1BHGA 2J8UA 4NO0A 1EO8H 1KTRL 4MVBD 5K9KA 4PGEB 4MS8C 4APQB 4BSVA 3QZWG 3MOAL 2V17L 4LSPH 4Z0BL 3TJHC 1GC1H 3D2UB 3RX7A 5GS0D 1C7TA 1W0VB 4Z8FL 2DYPD 1RJZA 1N64H 4HSQA 5F9DC 3OXRB 4HAFA 5T1LA 1BGXH 4HH9A 3HR6A 4JRYE 2VAJA 2A6JB 5HHNA 3QQ3A 2P4AB 3UJTH 4ZAKD 4KKAC 5D5MF 1AE6L 2BCKB 1FNGB 3D0LA 4P9ML 3PQYA 1W72L 4GO6B 1BFVH 4DUVA 4I0PB 3DVNB 2VLLB 2D03L 5J56B 5F3BB 3MBED 5TF0A 3O45B 3S4SG 3V5KB 3LKOB 3NAAH 3B9VA 1A47A 1CE6B 5FYKU 4ZPVA 5TGBA 3BSZH 4KPHL 4JRXA 1J9CT 5D72L 3WUWG 3VWJC 2R0WH 4N0UA 5HHOD 3D5OF 5H35A 5IV2A 4HBCL 4OZGA 3QUZC 4OT1H 1T21A 4MD5A 4U6TA 4PRPE 2WUCL 1A5FH 3VG0L 2ZUVA 5ICZB 5FHAL 3G5YB 2EE6A 3FB5A 1J88A 3C5JB 3K4AA 3GSNH 3VG9C 5T1DL 2CDGA 2YUXA 1NCDH 3HPJA 4ONHB 3QFJE 1LEKB 3VFSA 4Q58C 1J87A 2QHRH 4U1SB 4RNRB 1ZHLB 1IAII 1NBZA 4PJIE 5EA0L 2EEBA 4B53A 4YXLL 5C0EB 1GPOH 1YQ2A 4LLWB 2VABA 4XPBH 1I3GH 5C0BB 4GKSA 1BIIB 4R26H 2ARJA 3BDXA 4OM1H 1E4KC 5GHWH 3QXWA 2IH1A 5JHDB 1YYLL 3NZ8B 3O8XC 4IRJA 1T5XA 4Y5YB 2XFXA 5HYQB 5EFIA 1YJDL 1JGLL 4LBEA 2BRQA 1XGPA 4EN3C 3AS0A 4QXTB 4NQUA 3ZE1E 3E1F1 2XRAL 4PJAE 5JOFB 4M43H 1S9VA 5GGUB 5CEZE 4PJXE 3HI1B 2AK4B 2RHEA 3BAEH 4GMTL 1Q9OB 5DUML 3CSYB 1JF6A 1VFBA 3B83A 1ZA3A 1PJ9A 2DLIA 8FABB 5FUOH 3ZTNH 2E6PA 3OBAA 2ZNWA 3W2DH 3WLBA 2VZTA 3RL1B 1AXSA 3HRZB 1JN6B 4GKOA 4N5ED 1ND0B 2F5BL 1YN7B 2PUQT 4Y5XB 4TSAL 1WTGT 5I1EL 3MOQA 2Q8AH 5AZEL 4OLVL 4KTEL 5K93A 1BQLL 3WFEH 2A38A 4HHAA 5J3HD 1DP0A 3DECA 4LCYA 5I1IH 4PG2C 3BH9B 4NNYA 5CLTA 1TVDA 3IRZA 1WEJL 1UA6H 2GTWB 1A3LH 3LEYH 3QRGH 3A0OA 2DM4A 4X6CE 2HP4A 3AROA 3MGTA 4LCIL 2E8YA 1UWEH 2FGZA 2FYYA 3T1FA 5C0JB 1MQKL 1BX2B 2AABL 1U8JA 5C9JA 1FZOB 4JQXA 3INUL 3PL6B 1IVLA 2A73B 1OW0A 5CBAA 2R1XB 4PV9B 2CDEA 1FFOA 2LV4A 2HT2D 2YKLL 5GSVB 5L0QC 4AY0A 5B4MC 5JXEA 3PWPE 4HS3B 5TQ2L 5CJQH 2NX5A 1U3JA 3PWVA 3LHPH 5C0CA 4MAUL 2R39A 5C0AB 1MCBA 1X6NA 5DMGC 1VEPA 1OSPH 4EDXB 3N50A 2XPGB 3O41A 5D1QA 3TP4A 3DLQR 2HLFC 2AAVA 4LLUA 5KSAD 4HEME 4JDVB 3GIVB 4KTDH 5IK3B 3FMGL 4UIMB 1MFCL 5FYJU 3FFDB 4OFYA 1CBVH 1ROWA 5IG7B 4P2RD 3MFFB 4V1DB 1DBBL 4UNTA 3TBYA 4G3YL 3RWJB 4H1LA 2BVQA 1MCIA 1P4BL 5TDNB 1PEWA 4YPGA 4JFDE 4Z18A 3WEXB 2C1PB 1K4DA 1P5VA 3BH8A 3RGVD 1H5BB 4JKLA 2APXA 3QZWB 1G1CA 2J7LA 3LSOB 4POZD 2CLVA 4LASH 5FGBA 4MXWH 5F7DA 5AAWA 3T77A 1MLCA 5DRZA 3BIKA 3O8XB 4YHOL 4MSWB 3U30C 3ESUF 3QIUB 3CLEL 5J4MA 3U7WL 1SY6A 1QRND 4MVBC 1ZT1B 4I5BA 4U7MA 3JTSA 1MIEH 2NQCA 3O6KL 4YIQB 2QADB 2YPLB 2EDFA 5GRJL 2R0KH 3IDIB 5GS0C 2VTFA 1S9KC 4XXCC 5A2IH 4J8RA 4O58H 5CJXC 1F2QA 4GG8B 3ZDYF 5D8JH 5DDHA 3CUPB 2Z9TA 4RGND 2Q87A 1MI5B 3ULVL 2HJFB 1A14H 3VFVB 5BQ7B 4ZAKC 4AMKL 4X9IA 2WUBH 5EIIB 2XY1A 1FFRA 4G6JH 4ZOCA 3RWIB 1FE8L 2VOTA 1WVZA 4MAYD 4PRHD 43CAB 1DE4A 1LO4L 3S3PA 3SKOB 4PTUA 1RUQL 3U9PH 5TFSH 3JVGC 5EBGA 5FO9B 5I75B 2NY5C 3EZJB 4JDZA 1FP5A 1VGEL 1F6AB 3IGAB 2BNUA 2AEQH 4I2XB 1BAFH 4X6FB 3MRFB 1QO3A 2BVUA 5HDBE 2I60L 5HHME 2EIZB 2W59A 1H3GA 3DRQB 3N1FC 1RZJL 1Y0LB 4G9DB 4I8DA 5IQ7L 3HE6D 5AZ2L 5IB5A 5D6CA 4ORZC 3GBNL 3MLZL 2XTLA 4M00A 4LSQH 3SGDH 3V0WH 3VXSE 4WI3A 5DD1H 4NKOA 5B8CC 1S7RB 2R1WB 3NN8A 2C4FU 3WO4C 2CMRH 3PGCA 4S1RH 4QHKI 4Z95H 3FO0L 1D5XA 1C5CL 1A6ZA 1J10A 3IDYC 3RTQD 3QCTL 3LQMA 3B9KA 5EORH 2I9LB 1T1XA 5L0QB 1X5IA 4PJFB 2YD7A 3VGDA 5D2LE 1XF3B 3S36L 3VXMB 1T2XA 2IQ9L 2AJUL 1YN6B 4L4TB 3IXAB 3WMSA 2EDTA 4FG6D 1NFDA 3DYPA 1MAML 3ET9F 5DJ0B 4YZFF 2P8MB 1MJUL 2R0LH 1JPGB 4U0RC 1N0LA 1T6WA 5GGTH 2A83A 5J6GB 1I7TB 3THML 3QEUB 1CFTB 1NUNB 1S9YA 1ZHNA 4I3RL 4LCWB 4F7EA 3VE0A 1XT5A 3HZYB 1YQVH 4EUPG 1NBQA 3FRPA 4DAGH 2FX8H 4OZGF 2A6DA 3GMLA 3CU1A 5FDYA 4X7SL 1CD0A 4JQIL 1C12A 1I9EA 3DHJA 4JZNA 4N1EA 3U9UA 1N8ZA 2VUOA 3AFLA 1U93A 1ZEAH 1FVCB 4JO3H 3BT2H 4TVSa 3SDDD 1FN4B 4FQPA 3DXAD 4L3ED 1IC4L 2D4FA 3QEHA 4Q9RL 4N5EC 4X99A 3QXAA 3MUGA 4YDJB 1P84K 4Y89A 1E4WH 1KJ3L 2WMPA 4WNQB 3BW9B 5MERB 35C8L 3QXTA 1AGDA 5F6IC 4ETQA 5BZDB 4Y2OA 1CGSL 2FECL 2GJ6B 3DRTB 4NKMA 3BP6A 1CU4L 4DVRL 1AGBB 4D3CL 4M7LH 1K9TA 3TFKD 3KPMB 1ZLVK 1BFTA 4Y4KD 4MZ3A 4YHKL 1KJMB 1BBDL 4IJ3C 3UYPA 2P5ED 5KSBE 1YEHL 7FABH 4ZAKB 1KB5L 3HR5B 3EGSA 4A6YH 1MCPH 3A6BH 4OCLC 1ZSDA 2YD9A 3FQNA 3PWUB 4KJWD 5EU6E 1A9BA 3MBEB 2ZSVB 3MO1A 1RULH 3MC0A 4ZPTB 4W4NA 2HT2C 1MIMH 4MQSB 4EJ1C 4MNQA 1YPZA 1KTDA 3HI6L 1MWAA 4UILL 1KTLA 3QIBC 1N5AA 4UQ2B 5MENA 1F2XK 4L3CB 3O4OB 3P11H 4LU5H 5BXFB 2O93L 4RMUA 4JFEA 4NCC2 5KSAC 4LLAA 3MBXL 2DLEA 3QUKA 4MA8L 3LDBC 2R0ZH 4Y1AE 3MRMB 5EG6C 5FUCC 2OX5A 5CAYB 4ZUWA 5BZWA 4AEHH 1Q38A 2CDFB 2VLRA 4HWBA 5B8CB 2FZ3B 2YSSB 3SDAB 1DLHB 3WO4B 2GCYA 3VXNA 2EDLA 4UMGA 3TNMA 1F4WL 2BSRB 2FGWL 3FO1A 3TT1L 1FNSL 2XN9A 5SWZD 2WINA 2B5IC 4IHOB 3MYJB 1DFBL 3VD5A 4HXAH 1X5ZA 3RGVC 3SJVA 1PSKL 5HY9B 4GKNB 1BLNB 4XHQA 2COQA 4NRXB 5JXEC 4OD2B 1XIWA 4POZC 5FKAA 3VGEA 1U3YA 4KH2A 2AP2A 5F44A 5E8OA 2OQJA 4U0RB 1A1MA 2AJYH 1FFNA 2SEBB 2CIKA 1EO7A 3I6GB 5FB8A 2ICES 2EYSA 2X09A 1KLFA 1QLFA 2OLDA 3MODH 1OAQH 2AI0H 1JNJA 2GI7A 3REWB 1NCBL 1UG9A 1UEYA 3CDFA 2A9MH 4RRPA 3G5VB 1FVDA 4YHIA 3L3IB 1GC1C 3C09C 5E5MA 4NN6B 1GGBL 4RGNC 5CGMA 5T3XE 1XGYH 1UQSA 3A6CL 3TO2A 3L3HB 4JPKL 1FDLH 3RY5A 4RDQF 1D6EA 1DQQB 2K7PA 3EDFA 3N1QC 4MAYC 2WWMD 4XVTH 3QHZH 5HGAB 1I7RA 1MCOL 1MFDL 2HJLB 4DQOL 3DI2B 2EO1A 4QRSA 3ARTA 1JPSH 4PJ7A 4P2QE 3FB6B 3GMOA 1UWGH 5F6IB 2NPLX 2HKFL 5B38B 4Y4HA 3FHAA 2FR4A 1EH9A 3I02B 4PJ8D 2JB5H 3TCLA 1JWMA 3EYSL 3VU2A 1G9MH 1QKZL 3HE6C 4PRIA 3KLDA 3MOBH 4N0YL 1CXFA 4J7RA 3ZKND 2AV1A 3I75A 1A4JB 3KVQA 4IJ3B 4K7FA 4UINH 3S88L 4GG6F 1T6VN 2D4DA 1R24B 5BO1H 1MJJA 1U3HD 4LDOB 1KPVA 1RQ5A 1ITCA 4UOJA 4ISVA 4NCC1 1ZTXL 4LEXH 5FCSH 2GFBA 5SWSA 1NAKH 2CO7B 3T4YB 3RTQC 3ES6B 2EDBA 3LRSB 4IM8A 5DD3L 5KVDL 5K9JL 1PKOA 2F53D 3GUTA 5E95B 1J1PL 3FOLA 4QRRA 5IB2B 4KZDL 3MJGX 3B4NA 3VXUA 4XC3H 4FG6C 2OM5A 2NMSA 4QRTA 2Q7YB 4PGDA 4O9HL 1DVFA 4G8FA 5FM8A 2VXUH 4EUPB 3EOYG 1SJVA 5KSAB 2C26A 1OGAA 4XNUL 5GGRA 1EZVX 4GAJL 4Y19A 4Q9QH 4QY8B 1RUAL 4S10A 5TE6L 1UXSB 5HYJD 3KYMB 3MJ7A 3QEQE 1QNZL 1NDGB 5K9QG 4PGEA 4APQA 5J89A 3ARZA 4YBHA 2VLKD 4LSUH 4NKIH 1CFVH 1FYTD 3S35H 5BV7B 4HMDA 3D2UA 3GHBL 4PRAB 1W0VA 5CWSB 1DBKH 2JJTC 3SDDC 2XG5A 3KHQA 3BGFC 1ERNA 2FECI 4P5MB 2A6JA 1A6WH 2VXTL 2A0LD 2AGJL 3O6LL 5DRNB 2X4PB 2HVJA 2BCKA 1UM4H 1FNGA 2ZUYA 3DVNA 1OPGH 1IM9D 4KJPD 3CGTA 3NABH 3SE3A 1G6RH 5F3BA 3HCVB 3O11B 3WIIH 1LO3H 1NPUA 3V4VH 3V5KA 2W9EL 1MCDA 4FFYH 5GRXG 1IGMH 4PV8B 3TFKC 4W70A 4Y4KC 5HHQB 1NFDF 2CK2A 4DTGH 4MWFA 1H3XA 4OI7A 5E2UL 4WV1C 1BP3B 3BKMH 1P69B 2GJZA 1U92A 1YMMD 4N0FB 5ICZA 3G5YA 1K5NB 3GKWH 2GKIA 3C5JA 3OV6A 5TH2B 3NIGF 5KAQF 1TJGH 4KJWC 1U2HA 2CUMA 3HG1D 3UC0H 4HS8L 2LAGB 3I84A 3TH4T 5FCUH 1LEKA 4KHXH 3IETA 3C08L 4MB4A 3I85A 4FQ1L 1ZHLA 2IANE 3VI3E 1RIUL 5E9DB 2B0SL 5C0EA 1U8LB 2IJ0C 1KN4H 1NAMB 5C0BA 3C60D 5GGSY 1ADQL 4U3HA 5E2JA 1I1CA 4MQXC 4KAQH 3H2WA 3D87B 3VXRE 5C7XL 2MTPA 4TUJB 1NUFA 3ARDD 5JHDA 4KI5D 1PBYA 3NZ8A 4HGKC 5IJVB 3CFJB 4Y5YA 5HYQA 4KK8D 5TDPB 5J1TC 1JWUA 2OS7A 3QEGH 3WJLA 25C8L 1HHKB 3GSNB 1NDMB 2Q3ZA 2CK0H 5FEBA 1FLRL 3RTQB 4F9LC 3HUJB 5I8KH 2VN7A 3QIWD 1KCRL 1FL5B 1WIPA 4QEGA 2A6KA 2X42A 5TDOB 5JOFA 1ZGLB 1AC0A 1QFWM 5GGUA 3LMJL 1DN2A 4YBLC 1CGWA 3U7YL 2RFXA 4UT7L 3ARXA 5CP3A 4PFEA 1EHLH 5I8CB 4M3KB 1BZ7B 1T5WA 4LL9A 5L88L 1EJOL 3I50H 2VUYA 4OTXH 4WFHE 1ZV5A 2PXYA 1XF2B 4M93C 1OGTB 4X9HA 4ZMAT 3HRZA 2ESVB 4FXLA 1MCCA 1ND0A 1YN7A 4QXUH 2WZPD 3UTPE 4XP5L 4PJGB 4Y5XA 2P47B 2DWEB 4ZUVA 3O9WB 1KFAH 2A6IA 3CSBA 4LCCB 4Q0XH 5JMOC 4JHAL 1RPQA 2EDYA 4MNGE 2BNQB 3JUZA 3QCUL 4IOFD 1FRGL 1KXTB 1X44A 2ZOLA 3BH9A 1QEWB 4XGZA 3RUGE 3SDDB 1RURL 4K94H 4M62H 2IGFL 2W0FA 4PPTA 3DXAB 5KN5A 2C4XA 3OKEB 3OKNB 2WWMC 2UWEE 4MMZC 3U0PB 4IOIB 1MHEA 4QOKA 3RP1A 3UYRL 3IAPA 4KY1H 4ONFL 5CEYB 1MCLA 5C0JA 1KYOJ 6CGTA 1BX2A 1T1YB 4KHTH 1GGTA 3PL6A 3O3UN 2EYTA 3MR9A 4PV9A 4GBXD 5GSVA 4YJZL 1P6AB 2L7UA 1G7QB 4FTVA 3NZHH 3H0TB 4HS3A 4NFCA 3ZKNC 3ALXA 1PVHA 4WU5B 2XPGA 3D39B 5DWUL 2P5EB 3TESA 4BZYA 3D0VB 1U3HC 2GITB 4M6OH 5T3ZL 3TVMC 5E8DH 5IK3A 1MRFL 1I1FB 1GZQB 1W0WB 4XX1E 2VNCA 4UIMA 1YYMH 2EECA 1NQBA 1H15B 5MEOB 3FFDA 4TQEH 4JGJA 5IG7A 2EYRA 3MACL 5DEGB 5EIVA 4V1DA 3DNKA 1LP9A 43C9B 3RWJA 3QI9D 1KIPB 3BO8B 4CU6A 4U49A 4QXGL 5TDNA 1CTOA 4E42B 5K9OB 4RFNC 3WEXA 2C1PA 2ZUUA 3QNYA 4LF3A 3LOWA 2X1XR 2AJXL 4FZ8H 2BOBB 4Z7OE 1H5BA 4OZIB 2ZKHL 2FX9H 3B9AA 3QZWA 4FQJH 1CF8L 1NMAL 4QYOB 4N8VG 3WFBL 3IB4A 2BK8A 4MSWA 4NKDB 3O2WH 1SY6L 3QFJD 3QIUA 4JKKA 4PJ7F 3IFLH 3U46A 2ZUWA 3LZFH 4PJ9B 3ZKMD 3TO4D 3MRHA 1YMHB 1ZT1A 4ZNEE 2E3VA 1NANI 1I85C 4PR5A 4UU9B 2F8XC 5SWZB 1RU9H 2YPLA 1S7UB 1HEZA 4O5LL 3GB7B 4J2XA 3IDIA 1A3RL 1K3IA 3LIZL 3TPKA 1F11B 1J11A 2GT9B 3ETBF 4ZUTB 1CVRA 3G08B 4O2FB 5C8JB 3CUPA 3S4SA 4PB9L 2PYFA 4G9FE 5J13B 1GHFH 1VHPA 2A0LC 3VFVA 5BQ7A 2BSED 4BQCA 3WUWA 3C8KA 2HT3D 3AXLB 3QFDA 4M93B 4KJPC 3O6FB 3FOMA 5E0QA 43CAA 3N9GL 4WI8A 1J8KA 4P4KD 1R5VB 2X4NB 5FO9A 3KYOA 4J4PA 1JPTL 1F6AA 4HWZA 4X6FA 5D7LB 1HK6A 4UIKL 3OGCB 3KR3L 4M7JL 5AWNL 4R26L 2EIZA 4IS6B 5DS8B 3DRQA 4G9DA 5GHWL 1J0HA 1AP2B 4G7VL 5FO8B 4CAGA 2DWDA 3VMPA 3GHEH 3KHOA 3HC4L 5J1SC 1A7NL 3E2HB 2R4SH 3RY6A 4X0KA 4ONOA 4R97B 1S7RA 5CFHA 1E4XH 3G6AB 3OWEA 1MAKA 3WV0A 2VDKL 4HUKB 1E0OB 5HTSA 4HIHB 1WQVT 2YHGA 1HILB 1RUPL 2JIXB 3D9AL 5EO9B 5AUMA 1Y6NR 3DYOA 3WKMH 4OCYH 2I9LA 3G6JB 4M61B 4PJ8B 4D94A 3U0WL 3BAEL 3VXMA 5IM7A 2B7DT 5I74B 4H25B 3C60C 3DPBA 1MHCB 4L4TA 2YS4A 4BYHA 2O61B 4IDJL 1OT2A 4RGOL 2FB4L 2GY5A 3ZTJH 4M5YL 3C2SA 1H3PL 4WFFD 5DF0A 3BPLC 3ARDC 3MV9B 4KI5C 2WIMA 5IESL 4LFHD 2P8MA 5EO0B 3W2DL 1JPGA 3BKYH 4KK8C 4R90H 5CJ5A 3UPRB 4X6DB 2ED8A 5J6GA 3BZ4A 1I7TA 3NCMA 5DT1L 1I3VA 3FFCA 5DQDL 2QQKL 2QQNH 3RVVC 3BN3B 2XWJB 1CFTA 1FL6B 4LCWA 3QIWC 5H2BB 3EO1B 4FABL 3HZYA 3PWPD 1QRKA 5D1ZA 3E6FB 1UC6A 1GGYA 1LO2L 3O3EA 4WTWA 4WJ5B 3WD5H 2GHWB 5GIRB 1R0AH 4HKJB 5I66B 1D7FA 1P7KB 4C56E 1INEH 4NO2B 1YNKH 1S5IH 1FVCA 1H3TA 4OSUH 1BQSA 3VCLB 5HYSG 4DKEL 2DQEH 3H3KA 2VL5B 4KUZH 1ZLWH 2JCCA 1YUHB 5HJ3B 4YDJA 1WICA 4WNQA 1SM3L 5BZDA 2VLKB 4P5KB 2KPNA 5J6HB 1NLDH 2GJ6A 3D3VA 1GIGH 1EHXA 1AGBA 1IGYA 4IOFC 4F2MA 2MQCA 1I7UB 3KPMA 4GSDH 4GQPH 2YD2A 1QSFD 4QRQB 4F7TB 1KYOK 1NFIB 3C5SB 5INCB 2YPKB 4UT6H 1MEXH 5C0RH 4YWGH 1T4KB 1EVTC 5CIPH 2EIEA 4D9RD 5F96H 3ZT7A 4MLIA 1IM9B 3PWUA 1L4IA 2AXJA 2PR4H 3CDCA 2ZSVA 1JNLH 1QVOB 2BY3A 4GBXC 1PG7L 2XTJE 2BNRE 4PJCB 2H45A 1BMGA 1P4LB 4YUEL 1MCFA 3BWAB 4YFDB 3EDKA 3L7FA 1WUNT 3A6OA 1WFTA 4CMMB 5JR1L 4UQ2A 2ARJQ 3S96B 4O51B 2VXQH 3GJFK 4UZGA 5INDB 1G9MC 3CCHA 4FFVD 2E9IA 1OCWL 1OP3H 5LQBL 3UEZA 4U1HB 5ISZE 3RWCB 2WBWB 4U1JB 1WV7T 3MRMA 1IAIM 2AJSL 5IBUB 3DO3A 3EZ8A 1BZ9B 4HWBL 3FO2B 4XC1H 5D2NA 2UVFA 3T2NH 4A6YB 4J23A 1MIEL 2FZ3A 3SDAA 2PW2A 2H2SD 5I1KH 1B0WA 3FONA 3QDJE 1PDKA 2OJEB 3UROR 3QI9C 1S7XB 3RL2B 2DQDH 3ULUF 4O58L 5HHMD 1AH1A 4UTBL 5EU7C 3MYJA 3TLRA 3ROLA 4HV8B 1BJMA 2P43B 1BJ8A 3GJFH 1FAKT 3C60B 4GKNA 4Z7UE 1FZKB 1CR9H 1KIUA 4P99A 4PREA 4I0KA 4OD2A 4K2UH 1VERA 2O5XH 2H32B 4F3FB 1QBAA 4S1QH 2N1KA 3TYFB 3KPNB 4QNPF 3T4AB 2DN7A 3MXVL 5CKAA 2R23B 3ZKMC 4KUCF 2H3NB 2SEBA 5DK0A 4ZTPH 3I6GA 5CCKH 3TBTA 4GS7B 2DQJL 4I9WD 4YE4H 5IUSA 3MNVA 3GSQB 1V5JA 2GJJA 4X8XA 3REWA 4BQBA 1MFAH 2NXYD 4G80B 4PGZA 5T5NF 1NCWL 3TH3T 4IMKA 2IPTH 4R2GB 5JOPE 3L3IA 2BFVL 4Z0XA 2FIKB 3V6ZA 3GDBA 4XMKH 2XA3A 3L3HA 4LSQL 4WO4C 2E8ZA 3V0WL 2NTSP 3D1MC 2HT3C 1A6AB 4UQ3B 5EWIL 2DQIL 3RX8A 1N0XH 3GNMH 5F88B 1DUYB 4Z95L 1UJ3C 4MXVF 4FN0A 1U42A 4P4KC 2P42B 3FB6A 1IC7L 4P57B 5ID1A 5DEFB 4NM8L 5CILH 4FQ2L 1R3HB 3I02A 2E6QA 2AK1H 3T2OA 3BEVA 5HI5C 1DR9A 4HKZA 3SDXB 5HVHB 4WU7B 3NACL 3CLFL 4JN1L 4P2OD 1OHQA 1R24A 1Q1JH 1A8JH 1CL7L 3ZYOA 5HDOA 1Q72L 2A1WH 1KEMH 4JM2D 4BFIB 4KGLA 2DJUA 2A74A 3KWWB 4JQVA 5IVZA 5L2KA 1P7HL 1PQZB 3IJYA 2E5EA 2YD6A 2AEIT 4OAWA 3ARUA 3GMQB 4P23B 4QCIA 4XCCH 3I6KB 2CJUL 3PGDB 5F72S 3DV4B 2XWTB 1XF5B 2HAZA 2PCPB 4LNRB 2R56H 1M05B 4JRYB 3ROOB 3KG5A 3DVIA 3WDIA 1HINL 3MLVH 2AERT 4EIZC 2ORBL 2Q7YA 2ATKB 3QXUA 4EUPA 1C5BL 4GFTB 5CHNB 3OJDB 3WE6B 2GSIB 2OTWB 1MLBA 5M7QA 4KK5D 1EEZB 4OLZH 2NZIA 1JL8A 4PBVC 2XQBH 1UXSA 5I71B 1E4WL 1R6VA 4NQDA 3KYMA 2XWBA 2ZSWB 4RISL 4KK9D 4NQCE 4NWUH 4NZJA 3QI9B 5IMLB 1NDGA 4ZD3L 2EDNA 4J12A 5D1XB 4PRPB 1SQ2N 4PRAA 1JHKL 1A6UH 4PRNB 5CWSA 4DW2H 1ZS8B 5GZOD 4HULB 1IGTA 4Y1AD 1AXTL 5FOJA 4PD4J 2VDRH 4HUVA 4P5MA 1QTYT 5DQJB 5FKPB 5LGJB 2Q3AA 3QFJB 1IGCH 3H9SE 1NMBL 4U1NA 1RULL 4LVNB 3TA3D 3TO4B 1D9KA 4ODUA 3B3IB 5ADPL 3H42L 4BK4A 3X14B 4PJFF 1JVKA 2X9XA 3K2UH 4FP8H 4PJIB 4GMSL 1S5HB 5MP6L 4G43B 4HK3N 4OZ4B 4BZ1H 2M8XA 5HHQA 1B88A 3MRBB 3RKDD 2QLVB 1IEHA 5DJAA 1UB6A 2FJHB 1AO7E 4KQ3H 5FHBH 3KPRD 5IIEB 2Y7QB 5CINH 5FV1L 2Z92A 1BWWA 4CADB 1RHFA 4K94C 5TH2A 4UV7H 1XFPA 4OD1L 4U1KB 2NY4D 2DQTH 2B1AH 2YPVH 3DX7B 3T0EE 4PJAB 4TRPH 3T0WA 1RZFH 1GCFA 1XCTB 4PJXB 4OIBA 1IAOB 3QUXD 3Q5TA 1G6RB 5FYKE 3QUMA 5C09E 5I30L 1EHAA 5E9DA 4OCNC 3F65A 4MXQD 1T20B 1KCSH 1NAMA 4FFVC 2DIBA 5FM5O 5D7IE 2Y07H 4YAQB 4K8RL 4KK6D 2QHLA 2R9HD 4HKXB 1QBMH 4YH6A 2HG5A 4WTZA 4WEBH 5TDPA 1MJ7L 4ODWB 2H2SC 4LHUD 3HC3L 5F8QC 1OAQL 1ACYL 4RAHA 2UZXB 3HUJA 4NQEE 3LH2L 4XWGL 5LCVH 1FL5A 2QSVA 2V2WB 1FBIL 4PGBA 4J6RL 3MJ8B 2ATPB 5TDOA 3CU7A 3QPXL 4GRWE 5HHXL 2AJ3A 5H8DA 1OF2A 4JO4L 4E9LA 4PJEA 4X6CB 1BZ7A 1TQCC 4HLZH 1QSEA 3KPTA 4XVTL 1Y6KR 1QFWH 4C58B 5IW6B 4K7PL 5F9JB 1TMCB 2VB5A 1CDHA 2ESVA 5IMMA 2D7TL 4JFFE 3PWPB 4HPYL 3I6LE 2DWEA 1MY5A 1RIVH 1UH4A 1CXKA 3D69B 3OJVC 3O9WA 3OF6D 4M48H 4AIXA 1A0QH 5I16A 1HXYA 2ED9A 2MQ0A 2MQ3A 2WQRA 4BH7B 1PYWA 1DQLL 3UTTE 2BNQA 5MEQB 4XPGH 3WS3B 3NH7H 5TJWK 2YUWA 2E9WA 4ONGH 2G5BB 2J3SA 1PY9A 4LEXL 4WFGD 3OKEA 5LAXA 3OKNA 1SYVB 3U0PA 1GOFA 3HAEG 3KPPA 1A4KA 4EXKA 1A2YB 1RZ7H 1FQ9C 2XZQH 4KFZC 4JO1L 3UDWA 4YHZH 3QQ9D 1CLYH 1SMOA 3BQUD 1I1YA 5D71L 1HHGA 4XVJL 5DMIH 1CL7I 1T1YA 3C5ZD 3BRFA 1CE1H 4JFDB 1E6OL 1MHHB 3KNBB 1A64A 4AEEA 3BDYH 4NUJB 3P9LA 3MLPA 1FNAA 1MUJB 3MGAA 1S7QA 1BM3L 4ELKA 3H0TA 3FCTB 4U1LB 2P8PA 1GYAA 3X13A 4P2OC 4WU5A 3D39A 4U1MA 1F90L 2GITA 1KNOB 4WHDA 4QHMA 4GAYB 4P5TD 1BJ1H 1Q94A 2CD0A 3FKUS 1ES0B 4JM2C 3SGJC 5CZXD 5C0ND 4LOUD 1I1FA 1GZQA 1W0WA 5TQ0H 2VXSH 1H15A 1X5JA 4Z7VE 4DGVH 4M6ML 5KTEL 1XH3A 4P3CL 3PUCA 3LKNB 4M1GH 3KPQB 4LSUL 1UZ8A 2QEJA 4NZUH 43C9A 1WBXB 1KIPA 3BO8A 4P49A 3Q6FB 4DGIL 4HUUB 1HXMB 1OB1A 1IFHH 2V9TA 3MLWL 2AKRA 4RGMC 1ZE3C 3ULSB 2J2ZA 5K9OA 3QAZB 1KCUH 1VPOL 3FTGB 3LQAL 2YD1A 1BVKA 4YXHH 1U8PA 5T1KD 4B41A 1A6WL 1X5KA 1ZANH 1S8DA 2DLFH 3BP7B 2XNAA 4KK5C 4IOSD 4QYOA 3TWCH 4F33B 1JYXA 5ALCL 4S1DD 5D6DA 3T65A 1F8TL 2ZP0T 3BWUC 4NKDA 4OM0H 5F7UA 3U36B 3IF1B 1Q0XL 2D7PA 2QSCL 3KDMB 4KK9C 4PJDE 4PJ9A 5E03A 1YMHA 2IAND 4F58L 4PD4K 5HGDB 2K9UA 4FFYL 4K9EH 5HHMB 1RK0A 3GB7A 4HWNA 1IZKA 1FAIL 2X4OA 5GZOC 1F11A 3KLHC 2LVEA 5DJYB 5IBTH 1PY4A 3VXRD 4ELMF 3MRGB 2X1WL 4O2FA 1EA9C 3MPCA 4GT7A 5C8JA 4K3EH 3VXSB 3EFFB 3SO3C 1TJGL 5E2VL 4J3TA 5T33L 4ALAL 3OKLA 4JB9H 1B9ZA 2OBGA 3TA3C 3RVXD 1JGEB 5IP4A 3AXLA 4HWUA 4P2CG 4PIRF 4J3XA 3O6FA 4U33A 4JFXB 5IVXA 5TE7L 5D2LB 4JHBA 2ADJB 4QRUB 2KUTA 5HDQL 1WC7B 4NO3A 3V8CA 5BVPL 2X4NA 2NXYB 1IGJB 3VH8G 1EEUA 4I77L 1KN4L 3RKDC 3PV7A 5D7LA 3OGCA 4YDKL 5FA3A 3QO1B 3IU3B 4IS6A 4WFED 2WWKO 3BI9X 1LWRA 3K3QA 2MPAL 1AP2A 5BMFH 4W81A 1IAKB 5FO8A 1SJXA 4NM4H 3QDGE 4OF0A 2NY4C 3F58L 3UTPD 2J6EH 1IRAY 15C8H 1FYHB 1OTTD 2ZCHH 4HIXH 2PNDA 2VDML 1OVZA 5I8KL 2VE6B 5LGHL 2R8SH 4LIQL 1MREH 3G6AA 2ZPKH 3BEWB 2C3WA 2IFFL 2YN3A 3WIFA 3QUXC 1D9KC 5C9KA 4M8QB 4LARH 1FL3A 2JIXA 5EO9A 2HWZL 1L0XA 1BD2E 4KXZI 4MXQC 3C6SA 4M61A 5DC9B 4EDWH 3MJ9A 1Y6MR 3CIQA 3V52H 3EYFB 3HZVA 4H25A 5IQ9A 1N2RA 2ZJSH 3GRWA 2B39A 4KK6C 2R9HC 2Z8WC 4LSSL 4F9PC 3MV9A 3KJ4C 1AHWB 4GW5B 3UPRA 1DUZA 5EUKA 2MCPH 2XWJA 5GRUH 1FL6A 4QRPA 3CH1A 4LLVB 3EO1A 1JZ4A 1HOCB 3NTCH 5C07D 3ABZA 3FN9A 4WUKH 4OV5A 1G7PB 4EI6B 5BS0D 5KSBB 4WJ5A 1ZLUK 2PTUA 5T5FL 3UTSE 3IDXL 5FFLA 5GIRA 3QISA 1KUMA 5JO5B 5A3ID 5I66A 1S9WA 3GSUB 4NO2A 5EU6B 2YN5A 1V7NH 3VCLA 4LAQL 3H9HA 2VWEE 5K59E 1A7QL 2JKXA 4LSTH 2J1KA 3M17B 5HJ3A 1BQHG 1SEQH 3W0WD 3VFGH 3IDMB 1OLLA 4NQTA 4BK5A 3FQRB 2E7MA 2VZUA 2BVTA 3V4PH 4XBPB 2R2CA 3NZHL 2YMXL 4P5KA 3KXFD 5J6HA 2NY2D 1ZLUH 9CGTA 4UUJA 4LLYA 4PRBB 4PJHE 4OCSL 2AQ2A 3G6DL 1ODAA 5DZLA 4Y1AB 2DMCA 2APBA 2OP4H 4O2EB 4P59L 3FQTB 1I1AB 1T1WB 4F7TA 2B8OT 2YBRB 3C5SA 5INCA 3CVIL 4GUPB 2VQ1B 3SO3B 2YPKA 5E8DL 3TJEL 2NY0C 1U95B 1YYML 3BIBX 3P30L 5C0DA 1YEGH 2BP3A 4JR9H 4MDIB 4XBGB 3QQ9C 3AC0A 4EKXA 3BQUC 3HUJF 4DEPB 2DQGL 3LRGA 3STBA 3C5ZC 2XKNB 4MJ5B 1QVOA 1TNMA 3TIEB 5IFJA 3B5HA 3RA7H 4PJCA 1P4LA 4RIRB 3BWAA 5IHUH 3L3OB 1W0YT 4PJBA 4TSBL 4TYUA 1YY8B 2QKIB 1A7PL 1FG2A 2FX9L 1LK2A 5I73B 4FQJL 1D5MA 4QHKJ 5INDA 1KC5L 2E9BA 4L8SC 5I1CH 1K8IA 3SGKA 4U1HA 3RWCA 4U1JA 5E5RB 5C0NC 1ED3B 4LOUC 5FM5M 4CBPA 1U91B 4PJGF 1BZ9A 3RAJH 2MNUA 5C0AE 2V2TB 3N1GC 1NCCH 4RA3A 2D2OA 4YHYC 3AGVA 1NC2B 4N8VA 1QLEH 2JB6B 1IAIH 2AJVL 3IDNA 5FA4B 1F3JA 4HV8A 3WJJC 1DQDL 1QG3A 3VRJB 3SCMD 1XCQB 3BD3A 3HMWL 1GHFL 1IQWL 4WI6A 5EU4B 3TYGH 3WNLA 1OP5H 2BSTB 2H32A 3T3PE 1T1ZB 4F3FA 4S1DC 4DN4H 3KJ4B 3T0DA 1IGIH 3T4AA 2DBLH 4P2QB 3GFUA 4PJ5E 4R7DB 3HKFA 5F7HA 1Q0YH 1DBMH 2CKBH 3GSQA 1A6TB 4FQXA 1Z2KA 1M6OA 1VGKA 2BMKA 1JZ8A 4KWUA 4DWHA 4RWHA 4G80A 1BF8A 4XNQA 4LVEA 2OZ4A 4ZQKA 4R0LB 1O0VA 3GJFB 1YEEH 4HBQA 3QJFA 3GHEL 1KELH 5ACZB 1YNLL 4UQ3A 4KMTL 2NY1D 4FNLL 2FJGA 1IL1B 1W2KT 3OX8A 3L6FB 2WBJD 1E4XL 2GY7B 5F88A 1ZGLP 1GH7A 5D6DC 1EV2E 1NGXA 3RNQB 1OP9A 4LQFL 5CZKA 3GMMA 4WDIA 1MH5A 4OCYL 5I1GH 4P57A 4M9OA 3LPGA 1R3HA 3ZLQC 3QULB 4C56D 1CGYA 4OZIF 2V5MA 1U8KA 2Z4QB 3AS2A 4LRNH 4FS0A 2VITA 4LKXA 1D5BB 3SDXA 3VFUB 4WU7A 1E27A 1JRHL 3FB7B 1OQXA 4R90L 1N59B 2I27N 4IRSD 3OKMA 3OR6B 1VACB 1OTTC 3I3EA 4BFIA 2NCMA 2BY2A 3QEQB 4P9HH 5CUSH 4PG9B 4B7LA 3BQUB 3C2AL 1INDL 1PQZA 1ZT4A 4X8JA 3C5ZB 3F12B 3FJTA 2MCG1 1AQKH 4NC2B 3LB6D 4P23A 1ZLSL 3PGDA 5IMKB 3DV4A 2XWTA 3MUY1 5E8NB 2J5LC 1M05A 4JRYA 3ROOA 3MGOA 5GXBB 4OSUL 2ATKA 4MCYB 4P5TB 3VXQB 5CHNA 3OJDA 2DQEL 2GSIA 4JZJB 1CIUA 5JIPA 4X9BA 4W6YB 5FYKH 2AXHA 3JUYA 5DFTA 4OUUB 5B3JF 4JFYB 2Z35B 1B2WL 4OF6A 5ABDE 4HC1H 4WHTB 3ARBD 1HN1A 1B4JL 2NXZB 4U0QB 4YHYB 1K6QH 5BV7L 5HHVH 3LPFA 1Z0MA 4P2YA 2BDNL 5D1XA 3WFCL 4K3DL 4PRPA 5A3IC 1RZKH 3VXPA 3BPCB 4PRNA 2OXGA 1ZS8A 3WNKA 3MOAH 2V17H 1G9EA 4G6KH 4WY7L 2GTZB 1YEFH 4KRNA 2HLAA 5EO1B 5D70H 2N7BA 5FKPA 4G6AC 1LDPH 4LGRB 1XR8A 3QDJD 2WM0A 3TO4A 2YD4A 2IANB 4ODVL 3ILPB 4OGZA 3B3IA 1DBAL 3ARFD 3G6JF 3X14A 1AE6H 1T0PB 2NY2C 4D9QE 1W72H 1T0MB 2D03H 4TOYL 1Q9KB 2VXQL 5D7KD 3VXRB 1OAKL 1SHMA 5EU5A 4X6DF 5IIEA 2I5YL 4KPHH 3ISWA 5D72H 4CADA 5I1LB 4XC1L 4HBCH 2AV7B 5I1KL 4U1KA 1E6JL 2WUCH 3DX8B 3VG0H 3DX7A 4NSKA 5FHAH 3OKOB 1GRWA 1XF4B 3EDEA 5SX4I 1IARB 3QUML 4PJXA 1IAOA 3ZMRA 4DUXA 1LEGB 5T1DH 1G6RA 3GSXB 3QWOB 3KPSA 1CCZA 1SJHB 1NAML 1EGJH 1R3JB 3CDYA 4E41A 1G7IB 3DX6B 5CD5D 1FJ1B 2C9AA 2J8UE 4YAQA 4LHJB 5EA0H 4YXLH 1MCKA 1JE6A 5JIIA 5F9AC 2BY1A 5HHOE 4WHCA 3UBXB 4I18A 2FD6L 4ODWA 5J06A 5GISL 3O3DB 2DJ4A 1HHHB 3Q5YA 1JGVH 1YYLH 1ZK9A 1UXWB 4MNGB 2VLJA 4WW2C 1JGDB 1YJDH 1KCLA 1JGLH 2P8LA 2V2WA 1EUUA 3MJ8A 2ATPA 3RUGB 1IEAA 1F13A 2WP3O 3R8BB 3SCMC 4D0DB 3PGFL 4YHML 4K71C 5F7EL 3DO7B 2UWEB 5CGYD 4X6CA 2HH0L 2XRAH 5FM4A 2UY7A 2YRPA 4GMTH 5DUMH 3VGAC 4GW4B 3PHOB 4RSVA 5F9JA 3WS6A 2ZUTA 5DMYA 2IBBA 1UJTA 4PJCF 4QHLA 1FGNL 1YY9D 2E9JA 4N0UE 4OCWH 1EAPB 3ECBA 1ZVHA 3D69A 4K9EC 3U4BL 1LDSA 1UACL 3PWLB 3L3KB 1UZ6E 4NC0B 4BH7A 4TSAH 3RKPA 1NGZB 5FYJH 5AG8A 5I1EH 3N1PC 4JJHA 4OLXH 5MEQA 1Q1JL 2PYEA 3Q5OA 4KTEH 2CLZB 1BQLH 2G5BA 4NQSA 2NY1C 1IT9L 2WBJC 3U4EB 2AXGA 1F58L 2R2HA 1R5IB 5H37H 3P2TA 1WEJH 1JRHI 3MA7A 5EOCL 2IMNA 5HVFB 1ZWIA 3VFMB 4JFDA 3KNBA 2VDLL 2B4CH 4NUJA 4LCIH 4X6BA 1AGEA 2CXGA 5LKNA 2W9DL 1MQKH 2ILLA 2AABH 3C6LA 1N4XL 3FCTA 4U1LA 2DQFA 5C71A 1FIEA 4KI5F 3INUH 4RX4D 4PGCA 3F7YB 1YZZA 2FSEB 2MSPA 4CMHC 5A43C 2YKLH 4AENB 3C9NB 3HE7B 3H9SD 4BJLA 4GAYA 2X10A 5TQ2H 1ES0A 3MNZB 4MAUH 4HIJA 4LLQB 4RDQG 3U82B 2X4UB 3ZKXC 4OF8A 3FB8A 1CGVA 3MV7A 4JE4B 3UJJL 4I1NB 2ITCB 4Y5VC 1FCCA 4ELME 2DTML 1WBXA 3QHFL 2R2BB 1MFCH 4XHJD 4RWYL 3Q6FA 4HUUA 1HXMA 4KVNL 3ULSA 5C6PB 4G9FB 1DBBH 3EBAA 3WFHA 1RD6A 5J11B 4G3YH 5MI0C 1HH9B 1EO5A 1P4BH 2MKWA 4Y16C 1AKJD 4NC1E 4ODSH 1T2QL 4JKPL 1MCNA 4F33A 1KJVA 4U1IA 2GK0A 4ZO7A 3IF1A 3ARBC 5C1MB 1NUDA 3KDMA 5FYKD 5DHVB 3QWRA 4ENED 4HK3J 5C09D 5HGDA 4YHOH 2D9CA 1XGTA 5TF1L 3U7WH 3RZWA 5FUCE 4J3WA 2C5DC 3BKCL 4KDVA 1ZHKA 2D7MA 4P2RE 3SCMB 5DJYA 5GPRA 4TSCH 3O6KH 5C0IA 3MRGA 3ARGA 4K71B 4NJ9H 4R4FL 1J8HD 1WFNA 4XP4L 5GRJH 3O2DA 3WYRA 4YC2C 3VXSA 3W5NA 1P4IL 2J12B 2OSLB 2PO6B 3EFFA 2J8HA 3I2CL 5F70A 2DQTL 2B1AL 1KPRB 3VGAB 2DJSA 2Y6SD 5D7JD 4ZFOB 3ULVH 3ARFC 4AMKH 5EU3B 5EZIL 3GMRB 4JFXA 5C0CE 5D2LA 1K2DB 1CT8B 2ADJA 2ZUSA 3B2UD 4QRUA 4UTAL 1WC7A 1FE8H 1F3DJ 1A02N 1IGJA 3S3SA 2DMKA 3SDCA 4GQ9L 1QRNE 2EH8L 1LO4H 4X9GA 1XAUA 1JP5A 4S2SB 3VD7A 1OTSC 3IU3A 4QTHB 3UX9B 4CN6A 2Q76B 3V5HB 1QBBA 1T22A 2W1NA 1MJ8L 1VGEH 5DQ9A 4Y88A 2C3VA 3C8DA 1IAKA 1EMTL 1T7XA 2I60H 4NKQB 4DJMA 4L1HA 4QLRA 4ZYKB 3WHE1 2XG4A 4JFFD 5IQ7H 5AZ2H 4RGNE 3PABB 3JZ7A 3SN6N 3VGGA 3BEWA 3H7BA 2W0LA 3GBNH 3MLZH 1H3UA 3IVKB 4M8QA 8CGTA 4C56B 3AM8C 5DURD 4UI2A 1FIGL 4MA1C 1BEYL 1FO0B 1UM5L 4GW1B 4PRHE 3SKJL 5CD5C 3EYFA 5IFAL 3FO0H 3GRWL 1C5CH 5TPWL 3QCTH 2ZUQB 1CFQB 1ONQB 1C7SA 3OKYA 4H88L 3STLB 2CIIB 3IS0X 4TUOB 3S36H 1JF1B 4IRSB 3E6HB 2IQ9H 4P46A 1AHWA 4GW5A 4ZS7L 5LVEA 5F7FA 4PJIF 3STZB 3AB0C 5KAQG 3GM0A 3W9EB 5DXWA 4N9GA 3RHWF 4JPWL 3EOBB 5E2WL 4KVCL 1MJUH 4NZDA 2EXYD 2V5RA 1HNGA 4M6AA 4XPFH 3PG2A 4LLVA 3MQIA 2XZAL 2LFGA 4JPIB 3THMH 4C83B 3AREB 3TZVB 1G7PA 5M94B 3L5IA 4I3RH 2EDHA 5KSBA 5CGYC 4ONGL 2X40A 3VFNA 3GSUA 1P7QD 5FDWA 3T3ME 3DUUB 3ZE1F 4X7SH 5EU6A 4PJAF 3V7AE 4JQIH 5C08D 2XTJB 4PJXF 2BNRB 2VAAA 4OUOA 3ARBB 3M17A 4F37F 2Z93A 4NT6A 3VFOA 4QGYA 3ZDXE 3IDMA 3FQRA 5JW4Q 1IC4H 2R15A 4XBPA 4XCEB 4EQ2A 4Q9RH 3PE9A 3HAEA 1QYGL 1LE5B 5ACLA 2DM2A 5ISZB 3HMXA 1KJ3H 1BFSA 1WCQA 6FABL 2Y36L 35C8H 4O2EA 1I1AA 1CGSH 5JOEA 4NRZA 2YBRA 2X4SA 1CU4H 3V4UL 4GUPA 5FYJD 2VQ1A 1M7DB 5JA8B 3PV6A 4HCRH 4D3CH 1U95A 4OF5A 3QDJB 4XBGA 4YHKH 4MDIA 4DGVL 1MHPL 5FIEA 3NGBB 1YEHH 3ARFB 4LSRL 4NZUL 1T3FB 1KB5H 4WI7A 4L3EE 3TIEA 4Z7UB 4ZOAA 4KKBC 1KCUL 3KYNB 1HQ4A 4RIRA 4X6CF 3UJIL 1B0RB 1RVFL 5I2IB 3LEVL 4NNXB 5AG9A 3U2SA 4WENB 4HPOL 4ZUUB 3HLAA 5DD0L 5BOZG 3KLAB 1IBGL 3BX7C 4F7PA 4UILH 1HYSD 3PDOB 1ED3A 5ICXB 1NJ9A 1TJHL 2DBJA 5K9QI 5I1JL 3EYQD 4P9HC 2V2TA 3MBXH 3JXAA 4K9EL 4MA8H 3X3GL 5C2BH 4JANB 1JTTA 4XHJC 1NC2A 4NJAL 5IR1A 1CICD 4I0CC 2JB6A 3JBG7 3V6FB 3BPOB 1F4WH 3CMGA 1G0XA 4YK4B 2FGWH 1VCAA 2RJMA 3TT1H 1FNSH 3VGBA 3DROB 5EU4A 5KS9A 3QDGD 3LPWA 1DFBH 4HDIB 3VD4A 5EBMB 2OI9C 5ANMA 1PSKH 1CLOL 4NZRH 1KPUA 4P2QA 1I8MB 4ENEC 3OB0K 4R7DA 1CK0L 4BZ2L 3FQXA 3BP4B 4OCXL 3OPZL 1DDHA 1GZPB 1DJSA 3VJ6B 3KPLB 2OZ4L 1IC1A 2RIKA 4BFEA 3VWKD 4JFQB 1FZJB 1RZKC 1NCBH 5IB3B 4UAOB 2FNBA 3ZE2E 1I8KB 3VH8A 5ACZA 3BZDA 15C8L 1DEDA 1I3RB 2Y6SC 5D7JC 1GGBH 2QTEA 2VDPL 2P5WD 1IL1A 3OB0H 2R8SL 3L6FA 3A6CH 1YPZE 1NGYA 4MNQE 4XVSL 4F7MB 1BOYA 4GKZA 4UOW1 3B2UC 3RNQA 4OKDA 1KJ2B 3W9DB 2R69L 3ULVD 1QPXA 3TPUA 1QFUL 3LS4L 4KDWA 3UTSD 4F57H 3V6OA 5D5MA 1JWSB 3S5LB 1MFDH 1LO5B 3WXWL 2VRAA 3CDGB 4DQOH 1NBYB 2Z4QA 2Z31D 1FNEB 2KL6A 4YGVA 3QNXB 1D5BA 4WI9A 4JPVH 2HKFH 2VLRE 4XTRD 4LDLB 3VD3A 4G42B 1F3DH 5HGHB 1KBGL 2BVEA 3MCG1 2JE8A 4CJ0A 3EYSH 3BN9D 1RUKL 1QKZH 4NQCB 3QEQA 2XN9E 4HX1A 4LKCB 4OZFH 3JSSA 4PG9A 5HDBF 3S88H 2CGRL 3NFSH 3F12A 4U6XA 4WUKL 1KF9B 3RZCB 3IFOB 4X7CC 5IMKA 1Z9OA 3H6JA 1FVEB 5E8NA 2R2EA 3QRFM 4JAMB 5DD3H 1E28A 4MS8D 4Y0GA 3SDCC 5K9JH 4Z78B 2XZCL 1A9EA 3MUJA 3H9SB 4MCYA 1J1PH 3TV3H 5JTWA 5ETUB 1VFAA 4OQTA 2NW3B 1MRCL 2HTKD 2RCSL 4HKBB 4N9OB 4LSTL 4W4OA 5D2LF 4OUUA 3M1BB 4O9HH 1NC4D 4PBXA 4LGPB 2EXYC 4OGYL 5JMRA 4XNUH 4GAJH 2D31B 1RUAH 1ZMYA 3RIAF 4W68A 5TE6H 3WFDH 3S6CA 1AO7B 5BVJB 1YJDC 5CMAB 5EBLA 2IWGA 2Y23A 5DUBB 3KLSA 5E70A 1BQHA 3AUVA 1QNZH 4L9DA 1TPXB 3RFZC 2P7TB 4BH8A 1MRDL 2F53E 2BHUA 2GTZA 3T0BA 4JR9L 3VWJD 5EO1A 3GHBH 1OSZB 5ITFA 3T0EB 1CDYA 1ZOXA 3CZFB 1NKRA 3ALWA 2ZWLT 1J05B 3ILPA 5C09B 1NANH 2VXTH 2L4OA 3GSWB 2AGJH 3O6LH 5E7FA 4PRIE 3O81A 4UV4L 2Y06H 4DCQA 1GGCL 2YRZA 4XWOD 3P3YA 5I1AB 1T0MA 5D7IB 4JJ5B 5HYJE 3V0VB 4OF3A 4WWKD 1M7IB 1WBZA 1G7HB 2W9EH 1NEZB 4KRPD 1FZMB 1FYTE 1NGPL 4PJ5D 3GK8L 3O4LE 1CIDA 5I18L 3NA4A 4IEFB 5E2UH 1EFXD 4NQEB 2AV7A 5CSBA 3DX8A 3DWTA 3OKOA 1XF4A 4HXBL 5CEZL 4GRWB 5KSBF 2C3HA 3OR7A 4MA7L 2D7QA 3SHSA 5EOTB 3GSXA 4HS8H 3FQWA 2B4CC 4XB7A 1CDCA 1W72B 1OGAE 3SKMB 3BUTA 3TNNB 1R3JA 4LVOB 4QF1B 1G7IA 5EBWB 3DX6A 4HFUL 3LN4B 4FQ1H 1HYSC 5HPOA 1WWAX 1FGVL 1RIUH 5GS1C 5D7SL 1T7ZA 2B0SH 3DGGB 4KDTA 2VL4A 4JFFB 3UBXA 2ZNXA 3EYQC 2Y5EA 3ME0A 1LD9B 3MLSH 3X11B 5FECB 1DBML 3FO9B 3ARVA 3O3DA 1YMME 1HHHA 2H9GA 4PS4L 2VQUA 1UXWA 1Q8MA 3FT3B 4MNGA 2JJSA 1HKLL 2Z8VC 3UTTB 1CG9B 1JGDA 3CPLA 1BBJB 4G6FB 4AM0B 1PLGL 1L6ZA 2UV3A 25C8H 1A6VL 3HG1E 4X80L 5DJ8B 3RUGA 4D0DA 1Z3GL 4AL8L 1B0GB 4K7PX 1KCRH 3DO7A 3PF2A 4E5XB 3MA9H 3HTLX 4M7ZC 4ZNCD 1JHTB 2IAMD 3IKCA 2VISA 3JV4B 3LMJH 4FMFA 3QO0B 5F9WC 1T04B 5CD3B 3HFML 4UT7H 3PHOA 4R9HA 4ZFZB 4L3AA 5GGSB 1F42A 3WNPA 5L88H 4POYA 2J4WL 1EJOH 2AJZA 3L3JB 1OQOA 1FHGA 3VGFA 3HN3A 5I1DA 3VWKC 3PWLA 4XP5H 4GXVL 3GO1L 3F5WB 1P7QB 4Z7QE 3T0AA 3NBNA 4XBEL 3ZZ1A 1IQDB 2CLZA 1C16B 1HKFA 1NL0H 4RMRA 4Z7VB 3C87A 1DQJB 2BSSA 3QCUH 1P1ZB 1FRGH 3K81A 3MMEB 1AQKL 1RURH 1U41A 3P77A 4B0MM 2F5AL 2EICA 2IGFH 3NIDE 4XCNB 3TM6A 1FSKB 3S37X 3ULVC 3B6SB 1FV1B 4HS6B 3UYRH 1X5FA 2BY0A 3MV8D 4KU1A 4ONFH 5T5NG 2Z31C 5HDLA 3O3BB 3ARWA 5DVLA 3DBXB 4YXKH 2CPCA 2FSEA 3F7YA 5B39B 5DMKB 3UO1L 4AENA 3KS0H 1UGNA 2VR4A 1B6UA 1SYSB 1PGRB 3HE7A 2E27L 4QWWD 4MX7A 4V2CB 2P48B 3BN9C 3E3QC 4PJDB 2IPUG 3MNZA 2WBKA 4R3SB 4LLQA 2Y4SA 2X4UA 3FT4A 5DWUH 1CFSB 1BFOB 3JWDH 3HPLA 3DMMD 1CS6A 5D93C 5T3ZH 3VI4E 1MRFH 2YZ8A 2Z91B 5JDSB 5A2JH 4GJTB 1RZKL 4WVRA 4BKLB 3EJYD 1KSRA 3G9AB 3MACH 2HRPL 2DI8A 4G9FA 1FG9C 4H1LH 4G6KL 4GLRH 3SE9L 4RMQA 1YEFL 1JK8A 1HH9A 1U8HB 4QXGH 5D70L 5DJCB 3BPNB 1LDPL 3QA3A 2HTKC 4NBXB 4A2MA 5IB4A 4J3SA 1GOHA 1NUGA 1WCBB 2AJXH 4YEFA 5EC1B 5EPMB 3O2VL 3FT2A 2ZKHH 4IMLB 4JEGB 1CLZH 2D7OA 1CF8H 3SO5A 1NMAH 3N1MC 5DHVA 2FBOJ 1CICB 3SQOL 3WFBH 3TBSA 1SY6H 5ITBL 4X7EC 4Q9BA 1O7SA 4PY8I 1I7ZB 5JPMB 1RY7B 1F4HA 4NO0D 3O2DL 4X4YB 1CGTA 1MNUL 4PP2A 4ZXBA 3QDGB 2DL2A 4O5LH 2VQTA 1A3RH 3QDMA 2PO6A 1VFUA 1UB5A 3LIZH 1M71A 2V9RA 5DHXB 3RNKB 4XB8A 5IWLA 2C7UB 5EU7E 4CKVX 3QUYA 2LTQC 1KPRA 3QQ4B 4HW6A 2FHCA 4ORGB 4X6EB 4PB9H 5F97E 3GJEB 1WT5C 4FTVE 1FNFA 5T1LD 4XAKE 1BD2B 5EU3A 5C92A 4R96B 4XWOC 4WWKC 4K23L 1EGJL 2A9NL 5D96B 4D0BA 3EO0B 3PQYD 4F8QA 4YNYA 1G7MB 3N9GH 2XY2A 3OXSB 3U48A 4Y2DB 4S2SA 1LEIA 2XXCB 2F19L 4KRPC 3TN0B 2HFEB 3OG4B 4XP9L 1JPTH 1TZHB 1WFOA 4UIKH 3ARQA 3KR3H 1II4E 4M7JH 4JRXD 1HSBB 1U9KA 4XNXL 1LP9E 5AWNH 4JFPB 4ZYKA 1H0DA 1JGVL 2KBGA 1HDMB 4WUUA 5L8JB 4G7VH 2XZZA 3L5JA 3HC4H 1A7NH 3UTSB 1WK0A 3IVKA 5F9OH 3CK0L 1OD9A 4Q6IB 3BVNA 1FO0A 2Z31B 2VDKH 4JFHE 5F1IA 3PJSB 5F3HA 1RUPH 3D9AH 1CFQA 1MSPA 3SKNA 1QR1B 1ONQA 3STLA 4H5SB 3SOBH 3U0WH 4IRSA 3E6HA 3VI3F 5EUOB 4IDJH 4RGOH 2FB4H 5BOPA 3WO3B 1HI6B 2DB8A 2R4RL 1TVHA 4M5YH 1H3PH 4OCWL 3MNWA 5EC2B 3ZYZA 2EC8A 5IESH 4PJHB 3T2QA 5HVGB 4JPIA 4IRJD 5DT1H 5DQDH 2ZOKA 3AREA 2QQKH 2FHFA 1NH6A 3BZEB 5FYJL 3TZVA 4OLXL 1A1NB 3LCYA 4K07A 4OFIA 2VSDA 4FABH 4G8GA 2LU4A 4XP6H 2IAMC 1Z0NA 1AD9B 1LO2H 2X2YA 4G8EB 2IQAB 3TF7C 1P84J 1L7TH 2ICWB 5BRZA 1X5XA 1NC4B 2OXHA 1QA9A 2I07B 2BNRA 4WFFE 1TDQA 3MUZ1 2B4CL 1MVUA 2YEZB 1HHJB 3ZT5A 4DKEH 1KCKA 4N68A 4XCEA 3RDTA 2QBWA 4YDIL 2JJSC 3HMXL 5E4EC 5E99L 2BXYA 4XXDB 3UTZB 3OZ9L 5ISZA 1YECL 5EN2B 1M1SA 1JYNA 1SM3H 1GGUA 3DX9A 1A1OB 2V6HA 3P4NB 1X5GA 4OKVA 4UNUA 3VWJB 3QIBD 4KI1A 1M7DA 5FYLH 3QUZB 1IKFL 4RZCB 3Q1SL 2HFGL 4EEEA 4XCYA 2LTQB 3Q6GL 5T1MB 1K4CB 3RVUD 1AQDB 2QL1A 5FF6A 5C70A 3L7EA 5DEZA 5F8RC 1T3FA 1HIML 3RUGF 3VG9B 5F7LB 5IROA 1K8DA 2ZCKL 3VFRB 1RHHB 1X5YA 3BD4A 1IILE 2OK0L 3KYNA 2UWEF 3DURA 4PB0L 5HYEA 1B0RA 3JTTA 5E6IA 4NNXA 4ODSL 1PG7H 3T8XA 4QWWC 5FK9A 3FFCE 1MWAH 4ZUUA 4YUEH 1RUML 2A77L 3ZO0A 2VH5L 4DKAA 1QOKA 3M8OH 4PJ5B 5LGKA 3PP4L 5JR1H 1G7LA 3DSFL 3E8UL 2DDQL 1EFXB 1Z6JT 3EYOB 5JXED 3D48R 2NX5D 5C0CD 1QSFE 4NNPL 3DMMC 4HJGA 1Q9WB 5HGBB 1OCWH 5LQBH 2EDJA 3LKPA 1P9MA 4GG6A 1M7XA 5D1QD 3BHBB 2AJSH 3IAQA 2X1QA 5T3XL 4HWBH 1KB5B 3EJYC 4JG1H 4EN3B 5T3ZD 1WBYB 3CFEB 4D9RE 1R3IL 2JK5A 3V6FA 4TSCL 4HF5H 2AS5M 3P0GB 4L9LA 4NJ9L 5HI3D 4OFYD 2OTPA 3U7AA 1SBSL 1JV5A 3MLXH 4R4BA 4NZTL 1C8PA 2JCCE 5KSUB 3D85A 4UTBH 3U1SL 4WGWB 4CUCA 4IIQC 4MD0B 4H0IA 2L7JA 5JPNB 3DETD 5DD5L 1R3LB 4NCDA 4KZEL 3CVHA 3BGAA 1JNHA 4Z7OF 3OAUL 3MXVH 1ORQB 1CFBA 3VFTA 1J0YA 5ADOL 2VIRA 2DI9A 1MQ8A 4N0RA 3QNZB 1JGUL 2IPKB 2DQJH 5HPMB 1TZGL 1INQB 2H1PL 1MFBL 2QQQA 3GMNA 1FZJA 5IB3A 2IAMB 3G9VA 5DTFA 1NCWH 5L6YL 1VADB 2OR9L 1CXIA 4NUGL 3P4LA 1AI1L 3UTQB 3AMKA 1DEEA 2BFVH 4H0HB 4F7MA 4NGHH 5B38G 1KJ2A 5EWIH 1WAAE 2DQIH 4JVWA 3W11D 1AY1H 4X7TB 2QR0B 2UY6A 1B6DA 1KLUA 5CZVL 1JWSA 5DFWH 5JLZA 3REVB 1HE7A 3CDGA 5E4EB 4DZBB 4I9WE 1FNEA 1IC7H 3QNXA 4NM8H 2ID5A 1T0NA 5D2NE 5C0GA 2BRRL 1F3RB 4O2CA 3QB7C 4FQ2H 5JW4R 3NIFE 3WNNA 3K2MC 2AXFA 5DC0A 5JQ6L 5DO2D 5GRVK 4NQCA 2YA2A 3MRNB 2OL3B 3NACH 1G1YA 2Y5TB 3CLFH 3HB3C 4JN1H 4CN1A 4XPFL 1CL7H 1GAFL 2GUOB 4YO0B 5C3TA 1Q72H 1HQRA 1EEYB 2OR8A 3RZCA 3IFOA 2R29L 4MJIE 4H0GA 1FVEA 2FJFB 5GSRA 3OAZK 2R1YA 2CJUH 2KZWA 4Z78A 4EI5A 4OQTL 3B9KD 4R8WL 3DGCR 1RZIB 1HINH 1VKXB 1D5ZB 4HKBA 2ORBH 1Y18B 3M1BA 2CKNA 3MRDA 1IKNA 1C5BH 3WN5A 1R5WB 4PY7B 1OAZL 1T89A 3U30B 4CL7A 5SWQA 2D31A 4IRJC 1F45A 4FQLL 1CD1B 3ARSA 1EBPA 1UEMA 1AO7A 3OAZH 4AT6B 5CMAA 2E7LA 4QXWA 3FN0L 5ILTH 4RISH 3PWNB 1ZA6B 3FQUB 4IDLA 2CRYA 4LSVL 3WCYA 5IFHL 4ZD3H 2DLGA 2P7TA 4HCRL 4CDHA 1U3ZA 2DYPB 4OLUL 3OQ3B 1JUFA 1SEBB 2BC4B 2ED7A 1T80A 1JHKH 3EHBC 5ICYB 4IIQB 3F62A 2NLJB 3T0EA 3GBLA 2PW1A 1XGQB 3CZFA 1AXTH 3BGMB 1D6VL 3RWDB 1DSFL 1KIRB 3SE4A 4W6WB 4Z76A 1J05A 4WCYH 2X4TA 3LKQB 1BECA 1NBVL 2IADA 4MHHI 3ORJA 4Y4FA 3IFPB 4HQQL 4HIIA 5JNYB 5DZNA 1N3NB 1NMBH 1ZVSB 2O5YL 2NNAA 1V3LA 5I1AA 5ADPH 5D7IA 5FO7B 4NC1C 4OGAD 3H42H 2J8UB 4ZFFA 4NO0B 4GMSH 3MX0A 1AGCA 4LVHC 2VERN 5MP6H 4NDMB 4NHUA 1ZLVH 5HHOB 1BOGB 5L2KE 3MTRA 2KZ1B 1FZMA 5IKCA 3RVUC 4I4WA 3ARPA 1RJZB 1T2JA 1F97A 4MQXD 4NQEA 5F7MC 5FYLD 4MDJB 5C2BL 4GRLA 5T1LB 4BFBD 5LWYL 1VFMA 2VZVA 3UMTA 1J7VR 3G04A 5JW3L 4OD1H 1QR4A 5EOTA 3IDYB 2QV2A 3SKMA 3TNNA 3RDTC 4QF1A 4JQXC 1AR2A 2C3GA 5EBWA 4PTTB 1OW0C 1NLBL 4WTZG 5I30H 3ILQD 3Q0HA 4NQDE 2X44D 5TGBB 4MNQD 2KQNA 4NZRL 3DGGA 3GM8A 3MSPA 3GZKA 4N0UB 1TXKA 4OZHF 3LV3B 3KYKL 5H35B 1LD9A 2X70B 3X11A 5MEND 5FECA 3KPRE 2CSPA 4K8RH 5D1QC 3FO9A 1WTLA 1F4XL 2Q20A 4JFED 3JWDC 5JHLL 1U58B 3FB5B 3FT3A 3MRQB 1MJ7H 3UTTA 1CG9A 4KXZH 2W60B 3T2PA 5HI3C 4X9FA 3HC3H 5DJ8A 1ACYH 2VLRD 3DUSA 4M4RA 2D7NA 2LABA 3WSQL 3VFSB 3LH2H 4XWGH 5J9PA 3DIFB 1FBIH 1NCAL 4J6RH 4YLQT 5AEAA 3T0XA 1JHTA 1KENL 1WITA 2XN9D 3QPXH 3VFPA 5HHXH 4H26B 3QO0A 4H8WL 4JO4H 1G7JB 3GI9H 3DETC 5CP3H 3ZE0E 5CD3A 3DUHA 3SJVD 2GAZB 4ZFZA 1RFDL 1QACA 1YEJL 4Z7UF 5GGSA 4URTB 1XIWD 5FGBC 4QHUB 2XA8L 4F57L 2DQCL 4IRJB 4M6NL 1T5XB 5M95B 4MQ7B 2XFXB 4K7PH 4IBLT 3VXOA 4JPVL 5CBEA 2D7TH 4HPYH 2C1OA 3F5WA 4L9LC 3ULUH 4Z7VA 1WGOA 1DQJA 7CGTA 1DQLH 4BUHA 3NFSL 1WZKA 5GZND 4R6UA 3A67L 4ELMB 3MMEA 2W92A 1UWXK 1BIHA 1EDQA 4EZMA 4XCNA 3W11C 5F7YC 3TVMD 3B6SA 1A22B 3TBWB 1NSNL 1TQBC 4HS6A 4JO1H 3NPSC 3WLBB 3CNKA 2IPUK 5D71H 4M03A 4CVUA 3O3BA 4XVJH 5E8EA 3MV01 4ZUSA 3VRIB 1E6OH 4X4MA 3TV3L 3D25A 2PKDA 5DD6A 5B39A 5E56A 3QIBB 3ZL4H 1SYSA 2DICA 4XCFL 1BM3H 4DKFL 5ID0A 4Y4HD 3CX5J 5DO2C 2VC2L 4R3SA 3RWGB 4HHAB 2NTFA 4LCYB 1EAJA 1F90H 3LDBB 4PRID 4GRMB 4NNYB 1CFSA 1BFOA 2W91A 1TZIA 1RMFL 5MHSD 3N0PB 1KCVL 3AY4A 3WFDL 4P2RB 2FWOA 1EXUA 4WFGE 5IEKA 1BQUA 2V2XB 4PJEE 5JDSA 2JJVA 3MGTB 4BKLA 4M6MH 5KTEH 5HD8D 5SWSD 4P3CH 2FYYB 3T1FB 3V79C 2B5IB 3LN9A 1GJIA 1LK3L 5ESQB 5CBAB 1U8HA 5DJCA 3B9KC 3O4LD 4DGIH 3RGVB 3RWHB 1FFOB 3MLWH 3ZDZF 1UKSA 3BKJL 2FLRT 4NYLB 3OXRA 4QRRD 1MPAL 1VPOH 3LQAH 3PWVB 5C0CB 1HH6B 2XI9A 1V3KA 1WCBA 3VXUD 5EC1A 5GGVH 1PAMA 3MXWL 5D1QB 1DVFD 2Y06L 3SGEI 1QRNB 5DFVC 5ALCH 4I0PA 4LLUB 1CICA 2VLLA 5GRYA 3RU8L 4ODHL 1OGAD 4JLRB 1F8TH 5JUEL 4Y19D 1Q0XH 2H8PB 2QSCH 3O45A 5KVFH 1I7ZA 3GKZA 3LKOA 4F58H 5JPMA 4R4ND 1CE6A 3O0RH 4RQQB 3TBYB 1I8IB 2MHAB 2JELL 4H1LB 2BVQB 2NZ9D 2VJXA 1I9RH 4APQD 3P9MB 1FAIH 3C09B 4ZS6D 4RGNB 1I1RA 2C7UA 3K0WA 3MREB 4X4XB 4EI5C 3D2UD 4N1HB 1K4DB 3BH8B 1XMWA 3QQ4A 2FIRT 4Z7NE 1T83A 4U7KA 3B43A 5DYOB 3GJEA 4JY6B 1BD2A 4MAYB 5E2VH 5T33H 4R96A 2CLVB 4XNZC 3RIFF 4PRHB 4ALAH 3WN5C 3T77B 1MLCB 1GXEA 4ONHA 4OGAC 2YD3A 5J12C 3EO0A 4U1SA 1G7MA 5TE7H 4RNRA 5HDQH 4Y2DA 2E7LC 5BVPH 3TN0A 2EE9A 4LLWA 4I77H 1NMCC 3QXVA 3B8YA 2PN5A 1TZHA 3HE6B 3MLSL 2E7CA 4YDKH 1BIIA 1HSBA 4JFPA 3RBGA 2FO1A 4I3SL 5DDHB 1JFQL 4BQ6A 5LG1A 2MPAH 1WISA 4LHQB 3W5MA 3UBXI 3F58H 5KW9L 1TQBB 1UM6L 1OTUD 4QXTA 4Q6IA 3RVVD 1FO0L 2VDMH 1RV6X 5LGHH 4LIQH 2IFFH 1DE4B 3K1KC 3MA9L 3PJSA 5ESAB 3ILQC 2HWZH 3MRIB 2I25N 2ERJC 4OD3L 1QR1A 5IJKA 4H5SA 3HI1A 4JDZB 5HSFA 2AK4A 5I8EB 1Q9OA 2BNUB 3CSYA 4FQIL 8FABA 1HI6A 4WFEE 4LSSH 5C0BD 3X12B 4OBRA 5D6CB 5D7IF 1JZ5A 1FC2D 4GRLC 3RL1A 1JN6A 4K8RD 5JHDD 2BXZA 4NKOB 3BZEA 4Z7WF 1A1NA 4XMLH 1D5XB 1IEBB 2RB8A 1N6UA 1NL0L 3WL9B 4TVPL 1AD9A 3B9KB 4P3DB 5CSGA 2W07A 4RMWA 2IQAA 5IVXE 4W6XB 5T5FH 2ICWA 3IDXH 3BGFB 3GBML 4UDTB 2GTWA 4RBPK 4GRWF 4L3EB 2I07A 1XIWC 1ACZA 2VDNL 2UYLB 2CRMA 2YEZA 4XPAL 2G75B 1CDUA 2MKLC 4LAQH 5FAAA 3RGHA 4YHLL 2A83B 2CUHA 3K4ZA 1A7QH 3MCKB 2PXYD 1FZOA 4YXKL 2A73A 4XXDA 2ENSA 2R1XA 1S9YB 4FFWD 4K3GA 3E0GA 2UUDK 4MB3A 1VFOA 2YMXH 4Y4KB 4OCRL 5C07E 1A1OA 5IEHB 4FRWA 3P4NA 5C0AA 5I1HL 2A6DB 3GMLB 4EDXA 5J7CC 4OCSH 3QUZA 3G6DH 4WV1B 5BS0E 2NY7H 5E6ZA 5GZNC 4P59H 3JWDL 5T1MA 1K4CA 3ULUD 3CVIH 4JDVA 3GIVA 3MLYL 3DVFA 3TJEH 1XR9B 2FH6A 4NPYB 3P30H 4LMQE 1JZ6A 3VFRA 1RHHA 3QEHB 3CX5K 2DQGH 3K8LA 1BWMA 3MFFA 5I15L 4QOKD 2I26N 4HUNB 4M9PA 3W0WE 5KVGL 3HHRB 4HIEB 2V5YA 1AGDB 5IBUG 3PL6D 4L8CB 4Y4HC 2HKHH 3KXFE 5A2FA 3NA9H 4QRPE 4TSBH 3S34L 5MEPB 1A7PH 3BMWA 5KJRL 4FTVD 1KIQB 3S9DB 3EYOA 4XAKD 1CLZL 3CFCL 3VFWB 1KC5H 3LSOA 1E4KA 4K3JH 5DGQA 1Q9WA 5SX4H 3O8XA 2DM7A 3S98A 1TCRB 1HYRC 2WK2A 3BHBA 3UXFA 4U4BA 3EGSB 3GIZL 4XI5D 1OWRM 5HD8C 1MF2H 4EN3A 1WBYA 3CFEA 4LPTA 1ZSDB 4YIQA 2F15A 4D9LL 4M1CD 2X89A 1A9BB 3MO1B 4Z7VF 4ZFGL 5I0DA 4V1DD 2K1MA 3Q3GB 1HNFA 2AJVH 5CGTA 4XMPL 4YBLB 3SPVB 5KSUA 4GG8A 4MNQB 1YPZB 1DQDH 1MI5A 5GGQL 2HJFA 3HMWH 1N5YL 3GSVB 4JCMA 1IQWH 4P48A 5JPNA 3BOVA 1DVFC 3CVHL 1R3LA 4WO4D 4DGYL 5EIIA 5ALBH 3BZFB 1CXEA 1K3ZA 3RWIA 4NN5C 5E24E 5CSZB 4PGJA 1NGWB 1VDGA 4I13B 1ORQA 4XNMB 5BZWB 3SKOA 4JFHD 2VLRB 3QIUD 4R4NC 2DKSA 4EOWL 1ZXQA 2GCYB 3QNZA 1LQSR 2IPKA 4U7SA 5E00B 2IBZX 5HPMA 4LLMB 2NZ9C 4PJDF 3IGAA 4I2XA 2M2DA 4APQC 2W9LA 3FHQA 3IDJB 3MRFA 4N90D 4ZS6C 2UZIL 4L5FL 1N6QL 2XN9B 4N8CL 2QADD 4NRYB 2YPLD 2WINB 1BF2A 5F89B 1VADA 5C6TH 1Y0LA 2OJZL 5HI5D 4PG2A 2ARWA 3WHE0 1AD0B 3H3PL 5EOCJ 4Z6AT 1KJ2L 4PJBE 1FORL 5F9OL 1GGIL 3CMOH 4B50A 1YNLH 2R1WA 3MROB 4KMTH 4FNLH 2OQJB 4TPRL 2QR0A 1A1MB 4OGXL 4ODBD 4P4RB 4NBYB 3ZSSA 5DJDB 4LQFH 3SE3C 1G9NL 3IAGC 1CFNB 1QLFB 4PJFA 3SOBL 5DC4B 1XF3A 5KG9B 2H41A 1YN6A 2FLBT 4BSWB 3IXAA 3FRUB 4YHPB 3OKKB 3L95B 4J4PD 1JI2A 1S9XB 1OAXL 5DJ0A 1U3HB 5E5MB 1SBBA 2OL3A 3R4DA 2WLYA 3J8F7 1JRHH 1JNNL 1UQSB 3MZGB 3TVMB 2GUOA 1JZ2A 1OTUC 1X4YA 3QEUA 3C2AH 1INDH 3U83A 4X5XB 2F53B 4NP4L 1DL7L 2F54E 2O5ZL 4XP6L 1ZLSH 3R1GL 1OM3L 3GMOB 4KJQD 4RFNB 1L7TL 2FR4B 1RZIA 2GIYA 3TCLB 1D5ZA 3EFDH 3VXMD 4EUPH 5FOBB 4PRIB 1Y18A 4L4TD 1FN4A 1EUTA 2AV1B 4G5ZL 1R5WA 2LQRA 4PY7A 4RAUB 4ZSOE 3WXVL 3ZYIA 4JFZL 4OB5L 2D0GA 5HYJB 4K8RC 1LO0L 1CZ8L 1CD1A 4Y5YC 1DLFL 1B2WH 2QQLL 3WJLC 3BW9A 4AT6A 5MERA 3FFCD 4MNHB 3EOTH 1MCHA 2X9YA 3QQNA 4XP1L 1FYTB 1B4JH 1P2CB 3DRTA 3BXNB 4LCWD 3O4LB 3OTTA 5FYLL 4EBQL 3WHXB 3GUTB 2DYPA 5BV7H 4XXCA 5CJXA 4Q7DA 2BDNH 3WFCH 5D1ZD 4K3DH 2BC4A 5B22A 4NQXB 3NCBB 1KJMA 2NLJA 1XGQA 4QRTB 3BGMA 3RWDA 2IEPA 1KIRA 4ZAKA 4WY7H 2DMBA 5HI4D 3HR5A 3WIHA 2UZYB 3S35X 3M45A 5FXCH 2ZUXA 4GXUM 1OGAB 3FAWA 4NN5B 2PXYC 1U8IB 5GRWA 1NCNA 1L0YA 3MBEA 4ODVH 4FFWC 1CYGA 1DBAH 4ZPTA 5FO7A 3BE1L 3K4DA 3NCJL 3JVGA 1MWAL 3MJ7B 5K59F 5E08L 4Y5XC 4WW1B 4OZHE 1JTOA 5EOQL 2EO9A 3M8OL 4NDMA 5HHOA 5EUOF 1BOGA 4QTIL 4TOYH 2GJ6D 4GLRI 4L3CA 3QBTB 3D3VD 5BXFA 1YEIL 1OAKH 3ULUC 1YMMB 2LE9A 4PJHF 5A1AA 4MDJA 4OJFL 2I5YH 4F8TA 1BPVA 3LN5B 4O02H 3HG1B 4JG1L 2CDFA 5B8CA 2YSSA 1DLHA 4HF5L 5JORB 2HVJB 1E6JH 4M7LT 1T03L 2BSRA 3MLXL 4IHOA 3PL6C 3QUMH 4PTTA 5GJSL 3NVQA 4ODTL 5HY9A 3TBVB 1BLNA 4OIIL 1NAMH 4NRXA 4YX2L 4ZG1A 4JREC 4HUXB 2EC9T 5D7KE 5C0FB 4MWFB 3LV3A 5A2KH 3BPLB 2J8OA 1DQML 3ARDB 2X70A 5AYUL 4ERSH 4AEIH 1IC5L 2GJZB 1U92B 1MFNA 4MZ2A 2P46B 4XI5C 1U58A 3MRQA 4JVPA 2APWA 2FD6H 2W60A 3QIWB 2UVEA 4JO2L 4M1CC 5GISH 4LFHG 5IBLD 3SDAD 5EH1A 3IETB 3G5VA 3DIFA 1WSST 3WFZA 2V5TA 3B5TA 4N0CD 4OLYH 3PGFH 4H26A 4YHMH 1G7JA 5F7EH 4NGHL 2V5SA 3RI5F 3LQAC 3QG7L 2GAZA 4HJ0D 4UOW0 1N7ML 2HH0H 3NMEA 1H5BC 2YXFA 2BVYA 3RQ3A 1DQQA 1AY1L 1ADQA 4MJID 4PLJD 4QHUA 5HGAA 3T3PF 2HJLA 3MJ6A 4MQ7A 3QIUC 1JWUB 1FGNH 2FX7L 4LDEB 1V05A 5B38A 4Z77B 3BDBA 4HFWB 2LU3A 3IT8D 2QADC 1FPTH 3B5GA 2A6KB 3QP3A 3U4BH 3VDAA 1UACH 1JBJA 2RR3A 1A4JA 5GS3A 4O4YL 1WFUA 3QYCA 4ELMA 4BELD 2RFXB 3KPSE 4ZTOL 5IVNA 1T5WB 4E41E 1IT9H 3T4YA 5FUZL 3TBWA 3HS0B 3VDBA 2XXMB 1F58H 4TN9A 2PXYB 4YGAB 3SKUD 1QFHA 3ES6A 2C3XA 3LRSA 5EOCH 5LJYH 3ZDZE 4GBXB 3VRIA 4G7YL 4JCLA 1YEKL 5IB2A 2VDLH 4ZUVB 4MGXA 3QIBA 4PP1D 5GRVL 2A6IB 4J4PC 5EZOL 5I75C 1DTUA 5DLML 2W9DH 3SE8L 1N4XH 4RFOL 1G0YR 4AQ1B 2VLJE 4Q97A 2BHZA 3RWGA 3WBDA 5KSAA 2EH7L 5IOPB 4TTGA 1EEQA 4XGZB 2ZOLB 4GRMA 4QY8A 2VSCA 1JPST 2W0FB 5KN5B 4P2RA 4FXKB 2V2XA 3RY6C 4QOKB 1A7OL 1MHEB 5ILTL 5EZLB 1EJ6A 3UJJH 2X6MA 5L2KD 3MRJB 3GI8L 4KJQC 2DTMH 4HUWB 3QHFH 5ESQA 4J3OC 4RWYH 5ACMA 3MUHL 2EYTB 3MR9B 5DMJB 1NGQL 1AC6A 3VRLE 3RGVA 3RWHA 4CN4A 4KVNH 3KLHD 2ZG1A 4J3UA 4TUKL 4FTVB 4NYLA 4MJ2A 4JREB 1JPFB 1HH6A 4WCYL 5IW3A 1LNUB 1T2QH 5DRNA 2X4PA