2PYFB

Crystal structures of high affinity human t-cell receptors bound to pmhc revealnative diagonal binding geometry unbound tcr clone 5-1
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
241
structure length
241
Chain Sequence
GVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGTTDQGEVPNGYNVSRSTIEDFPLRLLSAAPSQTSVYFCASSYLGNTGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of high affinity human T-cell receptors bound to peptide major histocompatibility complex reveal native diagonal binding geometry
pubmed doi rcsb
molecule keywords T-Cell Receptor, Alpha Chain
molecule tags Immune system
source organism Homo sapiens
total genus 54
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2007-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2pyfB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2pyfB02
1RZFH 1J8KA 1PQZB 2VDLL 3BEVA 5CGMA 5BQ7B 1DSFL 1QSFD 4RX4D 4WHYH 1TTUA 2QJDA 2P5WB 4WU5B 2J88L 1MY7A 2YSSB 5IWLA 4J8RA 1SM3H 1B88A 5T1KD 2AJUH 5C0DA 2C5DC 2AQ3A 3B4NA 3T77A 3MCLL 3IDYC 5GGVL 5IHUH 4O51B 1EXUA 3FOMA 2OZ4A 5IFAH 2Q7YA 5KSUB 4CW1A 4U1JB 2FIKA 2JJSC 3TBSB 3BE1H 4ONOA 1CD0A 1JF1B 4HF5H 3WFHB 4JRWA 2OR9L 5C70A 3G5XB 3BUYB 4UNTA 1V7ML 4BKLB 3W2DL 3P73B 3BP4A 2WINB 4HCRL 4RFOL 4ZS7L 4KI5D 4GG6B 2R1WB 1RUPL 3DTXB 4Z76A 5HBBA 4GG8B 4NO3A 5T3XD 3A67L 4JN2A 4DKFL 1LK3H 3L5WB 4HBQA 2QTEA 1HE7A 3NCJH 4Z95L 3H3PH 1TJIL 3DMMA 2QQKL 4FMKA 3T2OA 2AXJA 2NXZC 3QWOB 1FAIH 4Y5VC 2HTLD 4EI5D 1AD9B 4Q2ZB 7CGTA 3DYPA 4WI6A 4X9BA 1GOGA 4GLRI 4NUGH 3SJVD 4X9FA 4XNYL 2QQLL 2V5SA 4TRPL 3ARGB 1YN6A 1NFIB 3E1F1 5E2VH 3MLSH 1F90H 2UY6A 3FCTA 4WWKB 2H9GA 5DT1L 1OGAA 3VGAB 3VG0L 1JJUA 5DJ8B 3H7LA 3QUYD 4XAWL 1RQ5A 3FN0H 4PR5A 4JDVA 5EUOB 3G9AB 1Z6JT 1K8DB 1RZ8A 3KYOA 5GGVY 1X4ZA 4MSWA 5HDOA 4AZ8A 1BQLH 3WJJA 4FTVB 3ULVC 4XMPH 4R2GB 3MUY1 5FK9A 1LD9B 4P2OC 1ZK9A 3EYVB 1OAQL 3HI6H 4OLZL 4G5ZL 4JFQA 3SE4A 1ZGLP 4X98A 1AI1H 3D9AH 3E2HB 3WIFA 4YHML 2VXUH 5EO0A 3MFFB 3BSZH 5DQDL 5CZXC 3FT2A 4ZPVA 2H6PA 5IEHB 3U48A 4HWBL 3R0MA 3AGVA 3MJ7B 2XPGA 3BKYH 5E8EB 4LHQB 4ZODA 1K2DA 5JQ6H 4P23B 1R5IA 2AK4D 1JWMA 2H41A 4GJTB 3N85H 4FFYH 2XQBL 3CK0H 1WTGT 5FGCB 3Q6GL 5ALCL 4G6FB 1DUZA 5F9OL 2BMKB 4HHAB 3U2SB 5J8OA 1N7ML 3VD9A 3NABL 2VZ3A 1BBJB 5IVZA 5H2BA 4F7TB 4Z6AT 4EJ1C 5F7DB 5IR1B 5C6PB 3GI9H 2XTJE 3S97C 1OAUL 2YXMA 5H8DA 3ET9F 5L9DH 4GRMA 3OKNB 4OF3A 1INEL 1YQ2A 2AXFA 4E42A 2X44D 3JUYA 4O2EB 1I1AA 3ARDD 4KVCL 4BZYA 2HFTA 2CIIA 4CN4A 4M62H 4AEIH 3K1DA 5I1DA 4N0CC 2YPVH 3IF1A 4KGJA 1DTUA 2R39A 3UX9B 2N1KA 4Z18A 4KHXL 3UEZA 1K8IA 2A6IA 3K74B 4J8RB 3K2UL 5C0DB 1UEMA 2BRRH 3QHZH 1A14H 4HX1A 3ULVF 3T77B 5EWIH 3PWUA 4OGXH 4XNUL 1N0LA 1EXUB 2M8XA 4ZDHA 5EPMA 2FSEA 2VR4A 1U3HD 3FOMB 2UUDK 5JHDD 3VG9C 2Q7YB 1SYSA 4CW1B 4K94C 1ZHKA 2FIKB 3DNKA 1IQWH 1HKFA 5LBSH 2PTTA 3MRNA 4R90H 3IDIA 5BS0A 2FEEI 3IDNA 1JHKL 3KLHD 3NACH 5FA3A 2R2EA 2VDKL 1EV2E 3BP4B 4B5EA 3PWPE 3CMGA 2V9TA 4Z76B 4NO3B 4JN2B 4PJIE 5HVGB 1ORQA 2HKHH 2VZOA 4KJWD 2X42A 3DMMB 1D6EA 3EO1A 3T0ED 1AGDA 4P5TD 3M8OH 1FC2D 2WBKA 4YNYA 4EN3A 3QDMD 5SWSE 1DBML 3V7MA 1YN6B 4OZFA 2LU7A 3OJVC 4ZUVA 1DQDL 3QPXL 4RMQA 5C0BE 4JQIH 3FCTB 5F3HA 2ED8A 4OLXH 5IVXA 2H9GB 3MRJA 1YEKH 1II4E 1AC0A 3IS0X 1NL0L 4PR5B 4JDVB 4OQTA 3CSYA 5F7FA 4TPRL 4HGKC 2E27L 1RZ8B 2L7UA 3KYOB 4DGVH 4CU6A 3GSXA 4MSWB 4RAVA 2VZ1A 5GRJH 1UM5H 3BAEH 4HK0A 5FK9B 5JA9A 4Q74A 3V52L 1JTOA 2D31A 4JHWH 4LRIA 4MAUH 3B3IA 3VGHA 1KFAL 2NYYC 3GMRB 4JFQB 1MCFA 4QRUA 4X98B 5MP6L 3KPQA 2WQ8A 3WIFB 25C8L 3N0PB 4KZEL 4NFBA 4GMSL 1FYTA 5EO0B 3CFDA 1C16A 4AT6A 1QRNA 3FT2B 2Q3AA 2QBWA 3CFIC 2H6PB 4ZPVB 1QHPA 3SE3A 5FYLD 3FZUD 1MF2L 3A6BH 2VR9A 2Q1EA 4Q0XH 3LDBB 2D0GA 2J8UE 4PBWD 1K2DB 3QG7H 2F5AH 1R5IB 2EDTA 5IESH 1JWMB 1JFQL 1KELL 2LVEA 4L3AA 3LMJL 2F58L 5FXCH 1CIUA 4OLVH 1FL5A 3MLVL 1DUZB 3WNOA 4AMKH 3UMTA 5IVZB 5H2BB 1Y6NR 5E03A 3MLUH 5FHBL 2R8SH 1L9NA 3RA7H 4RIRB 4GRMB 1AHWC 4OKVA 5TE4H 5FHAH 2AXFB 4JY4A 4E42B 4YDLB 3GM0A 1I1AB 2IPTH 1JGUL 3DXAE 5T5NF 3S88H 4LNRA 2CIIB 1I9IL 4XXDA 3TH4T 3IF1B 5CMAA 5ACZB 4HIHB 4RFEA 5D7IE 3B83A 3RRQA 2EDLA 2GY5A 1K8IB 2A6IB 1XGPB 4J4PD 3CFKA 4ZFGH 4HX1B 1B6DA 2V5YA 4S2SA 3PWUB 1MRCL 2CLZA 1KN2H 4JO2H 1RJLA 4M03A 4X6DE 3ARSA 5EPMB 4ZDHB 2FSEB 2Z0BA 2AEIT 3FRUA 1V3JA 3H9HA 4LLYA 4LSRH 4H0IA 4JO3L 4QOKE 3I6LD 4Y2OA 1SYSB 4XPBH 1AR2A 3X17A 1ZHKB 4M48H 4U3HA 1FFQA 4F9LC 2PTTB 3MRNB 1A21A 3NCEB 2A6JA 2YPLD 3IDIB 5BS0B 4N8VG 2F5BL 3IDNB 4J3OC 3ARUA 1HOCA 5FA3B 2OYPA 2RR3A 1MFEL 1NCNA 4N0UE 4X7FC 9CGTA 2DKMA 5I75B 4OZIE 1Q1JL 4KWUA 3U79A 4XH2A 5FYKL 4IJ3C 1EIBA 3KNBA 4HSQA 4LAQL 1GPOH 1G7PA 1ORQB 2WZPD 4LPCA 1C7TA 5IMOA 3BFOA 3KHOA 1IM9D 4FABH 1T83C 4RRPG 1GAFH 3BMWA 4JR9L 1JPTL 1D6EB 1OLZA 3EO1B 2YRPA 5E8DL 4PLKC 1AGDB 4NN5C 5DVLA 1YMME 4OF0A 3CVIH 5I66B 2FHBA 3FMGL 3QI9C 4YNYB 3MBXL 5D2NE 5DZLA 4HDIA 3OL2A 4EN3B 2KUTA 4N5UA 3TNNA 4KQ3L 5FIEA 1AXIB 2C1OA 1EO5A 3VRLF 1AKJA 3HFMH 1NEZG 1A7QL 1G6RH 4PS4L 4ZUVB 3SDCD 35C8L 5K59E 3DYMA 1W8NA 5IVXB 3MRJB 3X11A 3BQUD 4BFGA 1BVKA 2EIBA 2HA1A 1RIUL 3CSYB 4CL7A 2P46B 2CJUL 2AQ1A 2JJSA 3VXMA 1JK8A 4DWHA 3GSXB 4LKCA 3PHSA 4RAVB 4X7SH 4BFBD 4HK0B 2DJUA 1Z2KA 3RGVD 2D31B 1U8IA 3O2DL 3B3IB 4HLZH 4L4TE 3DX7A 1F6FB 4LIQH 3UXFA 3O0RL 4QRUB 1SJVA 1DLFH 4WFGE 4FQCL 1CZ8H 1FPTH 1YEGL 1ACYL 1E6OH 4XI5D 2H1PL 1I8LA 3PXHA 4MXVE 4D9LH 5KG9A 4XVUD 5CILL 3P0VH 3CFDB 1C16B 5DHXB 1QRNB 3I6KA 5ERWA 4AT6B 5BZDA 5JO5A 5KTEH 4D9QD 1QFUH 2X4QA 5A2IH 8CGTA 4RMVA 1JYWA 2W59A 1EHAA 3OHXA 2FB4L 4LSQH 4UI2A 1PG7H 3R8BB 3S5LA 2R4RL 3N1FC 4RQQA 2B1AH 3TBVB 4WI5A 3NA9L 3QEHA 1AIFA 4J3WA 4N8PA 1FL5B 5KS9E 2IMMA 1F4XL 4PP1D 5JNYA 3O3AA 3CX5K 5JZ7D 1I9JL 2R0ZL 3VI3F 1A7OL 3TJEH 3O6ML 1AO7D 4H88H 1KIUA 3GGWA 1DVFD 1CGSH 4ONGH 4RA3A 2UWEE 4YDIL 5F7UA 4BSWA 4OKVB 3WFEH 2OZ4L 4P2OA 3IDJA 4NPYA 1S9VA 4JY4B 4RISH 4IDLA 2COQA 1T03L 3VXRD 4LNRB 4R4FL 3HG1D 4XXDB 3ESVF 5CMAB 4JJHA 5C07D 1RJZB 2Z8VC 4RFEB 4LU5H 4O4YL 4MJIE 4P49A 1A1NA 2BVQA 1T04A 3MRQA 1NJ9B 4W68A 4PJ5E 1XAUA 4GRWE 1NAMA 3CFKB 1R0AH 1OP9A 1C5BL 3AB0B 2P47B 2AKRA 4S2SB 2CLZB 2JCCE 2XN9E 3WCYA 2EH7L 4LPTA 2QQNL 3FRUB 3H9HB 3N1PC 4QRQA 3VFPA 3SY0A 3HUJF 2EDEA 3MRDA 3P3YA 5SWZE 3WNMA 1BM3L 3HRZA 5KSVB 3WKMH 5L2KB 2A6JB 4PRAA 1HZHH 4JZNA 4X4ZA 2VDMH 3GMPA 5GS0C 1HOCB 2WWKT 1JTPA 2I07A 4KHTL 3V95A 1YEFL 3QWRA 1QSFE 4XH2B 1YEJH 5L8LB 2GK2A 3KNBB 2FBOJ 2J4WL 1G7PB 2HKFL 4LOUD 4KY1L 5IMOB 3JZ7A 1REIA 1GGCL 3VXPB 4WUKH 4EVNA 4Y1AA 1S7XB 3PUCA 3L7FB 4YC2B 3AUVA 1U8QA 1R3IL 4NN6C 3T8XA 2VC2L 1EJOL 4HDIB 4ZAKD 2R23A 3I3EA 4NQXA 4DK3A 4NC2B 5CINH 1HKLL 2PXYD 3TNNB 4TN9A 1LP9E 2C1OB 4NKDA 1AKJB 3IDYB 4ORGA 3RVTD 3TJHD 5I74C 1NLBL 3X11B 3AS0A 1NCAH 4Z7WF 4R8WH 1BVKB 4UQ3A 4NQEA 5FCUL 4KI5E 3MNZA 3U82B 3UJJL 2CSPA 2BFVL 4WEUD 4YBLC 3VXMB 1JK8B 3UDWC 4LKCB 1G1YA 2GJJA 4MNQA 2ZG3A 1U8IB 4NQVA 3MLTA 4ZOAA 2GT9B 3D1MC 1NLDH 1LGVA 3KPNA 4QHUA 4PRIA 2JJUA 3HC4L 2OK0L 4GXVL 5KG9B 4KK6D 5CP3H 5ICZA 4DGIH 3SJVE 5TFSH 5BZDB 5EBMA 3I6KB 5ERWB 5JO5B 2YA2A 4KRMB 1ADQH 1WK0A 2X4QB 1VEPA 3S3SA 1SJXA 2NXZB 2OJZL 5K9QI 2PYFB 3OHXB 2AEQL 3KAAA 3S5LB 4RQQB 1LO3H 2AABL 3LEVH 5GGRA 5H37H 4M7JL 1JWSA 3QEHB 1AIFB 1F4WH 4HKZA 4Z0BH 1CL7H 1LNUA 3BW9A 1QUNA 2C3HA 1FV1A 5D70H 5A2FA 1UQSA 4M7ZC 2IEPA 5JNYB 1RJCA 3LN5A 3QCTH 2FGZA 5EOTA 3S34H 4KUCF 3D39E 3R06A 3BWUC 4KDTC 4XPTL 1OTSC 5I6XC 2HT2C 3GGWB 3LKPA 5FYJU 1ZE3C 3O6KH 2WBJC 5ADOH 2PR4L 2NZIA 4BSWB 4P2OB 3IDJB 4NPYB 1S9VB 1HN1A 3HB3C 3TVMC 2QV2A 3IDMA 4XNMA 4WI8A 1F58L 1WCBA 3MLYL 3BZDA 2D7PA 4P5KA 4B7IA 1UWGL 2VXQH 2YK1H 1A1NB 1YJDL 4Y19E 1WBZA 1T04B 2BVQB 3MRQB 5HPOA 4JB9L 5BVPL 3F5WA 1NAMB 3SE9H 4KTYA 4KRNA 4QRPE 2CK0L 2AKRB 1NUFA 1JGLH 5E9DE 2EE9A 1EDQA 3AY4C 1J8HE 5EC2A 1MJ8H 2NX5D 1EZVX 5CEZH 4QRQB 3VFPB 5HVFB 3SY0B 3MRDB 2LTQB 4XHJC 4XNXH 3ZKXC 1X4YA 1U8MA 3HRZB 5HHOD 3P11L 4JO4L 5FO9A 3KXFD 4CJ0A 1SVCP 4PRAB 3LQZA 4OM1H 4JZNB 1C12A 3GMPB 4LSUL 2GUOA 2EZ0D 4MQTB 1A1OA 4JPIA 4PLNC 2I07B 3EDDA 5C0IA 4KJPD 2GJZA 2APVA 1T1YA 4G9FD 1J1OH 4U2YA 1QTYT 3U9UA 2C4FU 4R2GD 4TVPD 1MUJA 2X89D 7FABH 2B4CH 4HKBA 3U7WL 4JFOA 3VXUA 5IUSA 3T1FA 3UJIH 4OCLC 3VXQA 4OQTL 2EYSA 4NKQB 3D5OF 1DBBL 5DC0A 1CXIA 4PRNA 3UTTD 4EVNB 3ZKQD 3H9SA 1XIWC 4Y1AB 3QXUA 2QHRH 4MXQD 2O93L 5JHDE 3ALXA 4NC1E 5I16A 1U8QB 3T8XB 2C9AA 2R23B 1X4XA 3L3KB 1K9TA 3CDFA 4NKDB 2CPCA 4NQTA 5IQ9A 5CCKH 5F1SA 4ORGB 4YFLF 3GKWH 4P23D 2ITDA 4X99A 5HGHA 4U0RC 1UB5A 3PWJA 4UQ3B 2AJUL 4NQEB 3MNZB 4P3CL 3GFUA 1MJUL 1G9MC 4F9LA 1PX3A 5IHUL 2FJHA 5TQ0H 1EMTL 3V4PL 1IGMH 1K3IA 4MNQB 3T4AA 4FP8L 4IS6A 4KJYA 5JHLL 4NQVB 1MIEL 4I48A 5IJVA 2CRYA 2ID5A 3MLTB 1UEYA 1XEDA 4S1SH 5IF0A 3K8MA 3KPNB 4PRIB 4QHUB 3HPJA 4LVNB 5ICZB 3QWQB 3VWKC 1WT5C 3RQ3A 1T83A 2J1KA 4KKNA 2R29H 5L2JA 1X5HA 5IB2A 1NGWA 5HJ3A 2XZAL 4PLOB 5GGRB 1MCPH 2HFEA 4HWUA 4YPJA 1MOEA 4L1DA 1JWSB 2HTKD 4AEHH 5B3NA 4HKZB 5ANMA 4X80H 1LNUB 3BW9B 1FV1B 3B9KC 5HGGS 2L4OA 1KC5H 1UQSB 3BGAA 5FDWA 4IDJH 2A1WH 3LN5B 1QSEA 4PJFF 1AXTH 2X70A 2XZCH 4HPYH 5EOTB 5IGXL 1DBJL 3CDGA 4GAJL 2UZIH 3R06B 4YQXH 4FQJL 3LKPB 4PV9A 5CGYC 5E2VL 3G08A 2XV6B 1F90L 3CVHH 5AAMA 3C08L 5C7XH 3D85A 5DURB 3CDYA 2YUVA 2E9BA 4XNMB 4EKXA 2D9QB 3NIDE 1WCBB 1CLYL 4LSPH 1EHLH 3GI8L 3LRSA 1E4XH 4XMPL 4OGYH 4P5KB 1HINL 5D7LE 3HI6L 5B22A 1WBZB 4HLJA 1LHZA 1WIPA 2DQDH 2H8PA 2PUQT 3RIFF 3F5WB 2CR6A 1AI1L 3O9WA 1QSVA 3FHAA 1XF5A 1JI1A 3SDAD 4R97C 5EC2B 4ZNEA 1WV7T 2W0KA 5B8CA 2FIRT 2AJXL 4Z0XA 5HPMA 1U8MB 1NBYA 4OF6A 4UB0H 3DX6A 4L4VA 5FO9B 5J06A 2VH5H 1H3WM 3QEUA 3LQZB 5JQ6L 5E1AA 2HH0L 2GUOB 1A1OB 3PV6A 2F54A 2GJZB 2EDBA 1M05A 1T1YB 2N4IA 3IYLW 3CX5J 5I1EL 3U9UB 1MUJB 3HNSL 4HKBB 1G6VK 5HGBA 1ZT1A 3MV7D 4JFOB 3VFGH 3VXUB 3T1FB 5F8RC 1IE5A 4JRXA 1OQXA 1T7ZA 3VXQB 1EAJA 3EOYG 2EYSB 1HHKA 2J7LA 2NY2D 5HD8D 5KSAC 5HYIA 4JPKH 4PRNB 5D1QC 3H9SB 3IJYA 2NY5H 1YEIL 3MOBL 5L9DL 1G0YR 1KJMA 3I6LE 5I16B 4LQFH 5HVWA 4KKLC 4WFFE 3OAYK 2UVEA 1S3KH 5IQ9B 5KVEH 2P4AB 2UYLA 1NGQH 3SGDI 1OWRM 5JOFA 4YUEH 2YWZA 1INDH 1U8LA 2DIAA 2ITDB 4WEBL 4X99B 5HGHB 2V17H 1UB5B 3PWJB 1WISA 4EEEA 1J5OL 4KRPB 4HJ0C 2YBRA 1IC5H 1TZHA 4UIKL 3UBXA 1YECH 3U46B 2FJHB 4BQBA 4LMQI 3R4DA 1HHHA 3LS4H 4IS6B 4KJYB 5GRUH 1E4JA 1CDHA 4I48B 3OXSA 3MRBA 3BN9C 4K8RC 2DQFA 3LH2H 3FOLA 3SEPA 5IW1A 2CGRH 3KLSA 1MJ7L 4D8PA 1QOKA 2ADJA 4IJ3B 4PJAE 3HPJB 1QO3A 1QKZL 3RIFK 1EUUA 1I1AD 3NACL 1ZVSA 2BNQA 4M7KL 1A2YA 4XP4L 3G5YA 5FV2A 3OAUH 4KK9D 5C8JA 3GSOA 1A4JB 2FJFA 3QHFL 5IB2B 4WFED 1NGWB 5HJ3B 2HFEB 5E6ZA 3QO1A 2DI9A 3TO2A 1SVZA 1WIOA 3AMKA 4MAYC 4JO1H 5F70A 5ANMB 3JUZA 5F71A 5IP4A 1LK2A 4MS8D 3I84A 4GW1A 4PLJD 5JR1H 2E7LC 3E6HA 5FDWB 2X70B 5ISZD 1NAML 2AP2A 2YZ8A 1OW0A 3CDGB 3WUWA 2XTJC 1IC7H 2IANE 3PWNA 3VE0A 4PV9B 3UDWA 1OSZA 2D7QA 1JZ8A 4UBDD 1JCKA 3F58H 3FO2A 3JWOC 4DVRH 4RGND 4EBQL 1T2QL 4OGAD 1YEKL 2FH8A 1TZGH 4D9QE 4C56D 5INCA 4B0MM 2Z8SA 3H3BC 4NBZB 1RFDH 3DHMA 4FG6D 5HGDA 4WWID 2R9HD 4DGVL 5C6TH 4JHAL 3C60C 4P59L 4Y2DB 2O61A 3LRSB 1T7XA 4JHWL 1CG9A 2CKNA 3ULUL 4J2XA 5IVNA 2OJEA 5TGBA 3TT1H 2DLFH 1MREL 15C8L 1ZWIA 3O9WB 4JFFA 1XF5B 4GAYA 1C7SA 1C1EH 5B8CB 4Z0XB 4O2FA 5GZND 5HPMB 1S7WA 1NBYB 1VACA 1ZT4A 3DX6B 4L4VB 1BFSA 3A6BL 4Q0XL 4LQ1A 3GBNH 3QEUB 1RPQA 5E1AB 2XOTA 3MRGA 4NRZA 5DZNA 1D5IL 3PV6B 3VXRE 5MEND 2F54B 3HG1E 4KDTA 1M05B 1UKTA 5CJ8A 5C07E 2WBJA 4QXGH 4XVTL 5KOVC 3DETC 4G8EA 5HGBB 1ZT1B 4TOYH 4AMKL 3SDXE 3MV8A 4GOSA 3L5XL 4JRXB 5D5MA 4H26A 4XPAH 1HHKB 1N6UA 2DYPD 4QXUH 3IJYB 1YNKH 1KJMB 3P4LA 5FHAL 1I3UA 3ZDZF 2D0HA 5E2UH 2DQCH 3MLRH 4UV4L 1IFHH 4P4KD 4MXWH 3IFOA 1FO0H 3WFCH 2UYLB 4CVZB 5K9JL 5JOFB 2N56A 1AE6L 2WUCL 1U8LB 1A7PL 5CJBA 4Z7VE 1Z9SA 3I50L 4F80A 1L7TL 2HVJA 3TH3T 3RWEB 3ESUF 5CAYB 2YBRB 4GAGH 5IIEA 4XPFH 3KPOA 1TZHB 3NIGF 3UBXB 4WI2A 1W72H 4HIJA 4AH2A 1HHHB 1MAMH 5F7EL 1EEUA 4GS7C 3OXSB 3MRBB 3V7AE 2DQFB 1ZA6A 1HCFX 5CEXA 2VB5A 2GI7A 3FOLB 3KJ4B 2DDQH 5IW1B 4ZTOH 4D8PB 5DRWA 5GS2H 3CGTA 3ROLA 1QO3B 1V3MA 1XF1A 1WZKA 4ZMAT 4Q9QH 1ZVSB 2BNQB 3GBMH 1A2YB 3G5YB 4PJEA 4PJFA 3ZSTA 4XMLL 5C8JB 3NGBC 4DAGH 3GSOB 2FJFB 1XIWA 5HHVL 4UOJA 2UUDH 4NN6B 2C3WA 4H5SA 4OF7A 4BA8A 3QO1B 2FD6L 3TO2B 5T1LD 4Y5YA 3QQ9D 4FABL 4L4JA 2JJTC 4GW1B 5DZOA 3STLA 4CBPA 3V5HA 4UTBL 4QHKI 5D1XA 5I8KL 1M71A 3E6HB 4LHJB 4R7DA 2EC9U 1F5WA 4OCRL 2Y6SD 1D5XA 1X5KA 3NAAL 3WUWB 2B1HL 4GAFB 1MCRA 3PWNB 2X4UA 4YBLB 3VE0B 1D9KC 1OSZB 4ZO7A 2ITCA 1NMBL 5L2KD 5I8OH 1KJ2H 3FO2B 1D6VH 2DTSA 2AJ3A 32C2A 3NFSH 4KKCD 4U1IB 3SN6N 4ZOCA 5INCB 12E8L 4YXKL 4OJFH 4Z7NE 5HGDB 4QEGA 1FP5A 4KPHH 1HH9A 2GY7B 2P5WE 2WUBL 5GGRY 2Q86B 4APQC 5A2LH 4F8QA 2O61B 1X6NA 1JYXA 2EKSA 4HBCH 1WT5A 1CG9B 4QY8A 2YUZA 3THML 2OJEB 3QUKA 3AFLA 3W11D 3M1BA 1ZWIB 2KZWA 4JFFB 5DJ2A 3TESA 1T2JA 4OI7A 4XPGL 4GAYB 2RCSL 4N8CL 1FZJA 3HCVA 3BPNC 3KJ6L 1FH5H 4NQCA 1CU4H 3IB4A 2MQCA 4R9HA 3V6OE 1AKJD 4O2FB 1I1FA 1S7WB 2R0WH 1VACB 1ZT4B 2NY1C 3T08A 1J0IA 4PIRF 3TN0A 1PLGH 3WKNA 4KKBC 5F96L 5L88H 3OB0K 3MRGB 4NRZB 2GEEA 4TSAL 4GG6E 4GXUM 1KEMH 5CJQH 4DKAA 1VFMA 2WBJB 4N90E 5TDNA 5LCVH 4M61A 3MZTA 4G8EB 4JQVA 2B5IC 1PG7X 3EUUA 3ULVH 3MV8B 5D5MB 4H26B 4JRYD 1LO4H 2F19H 3K4AA 4WFHE 3NN8A 3IS1X 4XNQA 1QLFA 4AIOA 5GS3A 5J12B 1BFTA 1LE9A 1OAZL 4K9EL 2J5LC 2ZG2A 1NC4D 5IW6A 4JLRA 3IFOB 4Q9RH 3OJDA 5FYKE 2EC8A 2H2SD 2VN4A 3MRIB 2JIXD 4QXWA 1C08A 1KCSL 4XVSL 5EUOE 4CNIA 5TF1L 4PG9A 1YQVH 3V0WH 2HVJB 2DBLL 3T2NH 3WHE0 1R0AL 2ZOLA 5IIEB 3KPOB 5D7IF 4FTVE 4X4XA 1U95A 4HIJB 2WWMC 4AH2B 1N5YH 3I75A 2EDRA 3MLZL 1ZA6B 5DFVC 5CEXB 5BW7C 1TENA 4X6DF 1JPSL 5DJXB 5MHSD 1UH4A 3RBSA 5D6DC 1RURL 5DRWB 3K8LA 3ROLB 4M43H 5TQ2H 3C6LA 5JXEA 1C5DA 1IRAY 5I1HH 1AP2A 1KCUL 4PJEB 4PJFB 5KSAA 2PN5A 4P2QA 5E8PA 5D1QA 1XIWB 5AWNL 1PY4A 1RIVL 4MDIA 4GKZA 4L5FL 5J6HA 4IOFC 3NVQA 4H5SB 5EU6A 4MX7B 4OZIF 2ICEA 3NIFE 4Y5YB 5FGCE 4Y4KA 2G5BA 3EJYC 5IMMA 3STLB 5BO1H 3V5HB 3PP4H 5D1XB 1CVSC 1M71B 1SQ2N 4U0RB 4R7DB 3IFLL 4BQCA 4QTIL 2OS7A 1D5MA 5JMRA 4KDWA 1D5XB 1JNLH 4QHMA 4TUKH 5CINL 5CUSH 4DTGL 1LEGA 4CU7A 1KF9B 2X4UB 2FCBA 3HTLX 4IRSA 4K94H 3TT3L 1O5DT 2ITCB 1WWBX 1ZVYA 2EE2A 2LABA 5CD3A 2DM3A 2AJ3B 32C2B 1D5ZA 3B43A 4FZEL 2ARJQ 1NCAL 1RV6X 3C8DA 4H1LH 1CFVL 1KXQE 4OI9A 4HIEA 4WCYL 5BCAA 3EYQD 4X6BA 1QG3A 2PETA 5K59F 1MY5A 2JLLA 3O6FA 2EIZB 1HH9B 2DM2A 4YAQA 2Z31C 3WIHH 4WV1A 4YWGH 3RNQA 3SOBH 4PJBA 2EKSB 3HRPA 5IBLD 4QY8B 3QUKB 4R0LC 3V5DA 4KKAD 3M1BB 4U1MA 4Y1AD 5F7HA 2F9BT 3HMXA 1IJ9A 5DEZA 1LDPL 5DJ2B 3SDDA 3DV4A 4TYUA 1CQKA 5F9JA 3ILQC 1F11A 1FZJB 3B6SA 4PJDA 3HCVB 4DGIL 4NQCB 2W91A 2O5XL 1NCWH 4LSVL 5DJZA 3BJ91 4X6EA 4MXVF 1I1FB 4H8WC 4WW2F 4FQHA 1W72A 4LLMA 3TN0B 4Y4FD 1LO3L 3VCLB 1OY3B 5DMGD 2VZUA 4ESKA 3FO0H 2EIEA 3B9EA 2V2WA 4ZYKA 3MZGB 1TLKA 1F4WL 4AG4L 2EDHA 4CN1A 2Z9TA 4XCNA 5IT2L 1CGVA 5TDNB 3EIFA 4JCMA 3L1OL 1T7WA 4PREA 5KS9F 1A4KA 2R69H 3HLAA 3S34L 5B3JE 3NN8B 3FONA 4NQSA 2VERN 3GMOA 5LQBH 2VIRB 5D2LE 3GHBL 4XNQB 5ADOL 3C60A 1QLFB 1M7IA 5B4MD 1LE9B 1BBDH 1H9VA 4D3CH 5I1CH 4JFPA 5EU3A 4GRLD 2UWEF 4M8QA 4ODTL 5A40E 4NGHL 5IW6B 3DV6A 5A3ID 3TFKD 3SE8L 2Y5TA 4JLRB 3OJDB 3V4UH 4KUZL 1F6AA 3ULSA 1CLOL 4RGOH 2MWCA 3KVQA 1C08B 5D71L 4CNIB 5EOCJ 5TH2A 2EDYA 4PG9B 5C0JA 4KI5C 3MRCA 3OKLA 3PABA 2E6QA 1BFVL 2ZOLB 1RMFL 3G6JA 1BX2A 5F72S 4X4XB 1U95B 5C2BH 2LAGB 1NC2D 4M8VA 4GRWF 2OSLA 1N3NA 1TVDA 3MRLA 1RZ7L 1KGCD 2JCCF 1HHJA 4OD1L 4MWFA 4LEXL 4ODHL 1U8JA 2GCYA 2HTLC 3O11A 4YHZL 5GRVK 3WLBA 1ZANH 4F33A 4GO6B 1I9RL 1OAXH 3C6LB 3LKQA 3D0LA 2A6KA 1C5DB 1AP2B 2VNCA 3UCRA 3Q48A 5KSAB 4P2QB 5CJXA 5D1QB 4HIIA 3JTTA 4MDIB 4ODUA 1GGTA 4GKZB 5J6HB 2FEDD 3IKCA 1W0VA 2CMRH 3QUYC 2FO1A 5IK3A 5EU6B 5SWSA 3MXVL 4HQQL 4HXAH 2ICEB 3QXVA 3T0VA 4Y4KB 5ESAA 5DJAA 2G5BB 5IMMB 3IU4H 1MQKH 2DQUH 4I9WD 4LLDA 3TCLA 5E2JA 3LPWA 3FO9A 4KAQH 2VXVL 1ORSA 1D5MB 1JNNH 4U1KA 4QHMB 1HSAA 3KPSD 4YBHA 1LEGB 4IRSB 2OBGA 4CVUA 4MD4A 5CCKL 1BOYA 1LP9F 5CD3B 5CD5D 2PYEA 1D5ZB 2OR8A 3QG6A 4HIEB 1T21A 3JXAA 4X6BB 2N7AA 3O6FB 5JXAL 2DQTH 1TCMA 5DHYA 5TQ0L 4YAQB 2IH1A 4KI5F 4WV1B 3QEGH 3PIQA 3RNQB 3V7AG 4PJBB 1JZ4A 5TF0A 1QNZL 4LHUD 3V5DB 5CSBA 1OP5K 3UTPD 5E5MB 2ZSVA 1FO0B 3SDDB 4ERSH 3DV4B 5DEGA 2BERA 1FNAA 5F9JB 1F11B 3B6SB 4PJDB 4P9ML 3U1SH 5DJZB 3L5IA 4X6EB 4J12A 1TDQA 4DGYL 2JE8A 1EHNA 3CC5A 5BS0E 4U6HA 1VFAA 4FQHB 2VLRA 1W72B 4LLMB 1WFTA 1YEHH 4XC3H 3WS6A 5GS1C 1NSNH 4EOWH 2K1MA 3ARDC 1BGXL 1YYLH 2V2WB 4ZYKB 4F57H 4S10A 4I8DA 4MQSB 4TTGA 2NCMA 4PJ8D 1WFUA 3ZYIA 1BEYH 5FKPB 1YN7A 4PREB 1DQLL 1A4KB 3HLAB 1N6QL 5E4EC 1F4YH 3KDMA 4OIAA 4NQSB 4RMWA 3GMOB 1I8MA 3EDJA 5DVKA 4KVNL 3BGFC 1A3LL 1U3HC 3UJTL 1CFQA 1GZQA 1M7IB 5EZIH 4NC1C 2E8ZA 4JFPB 5C6WH 2DIBA 5EU3B 4M8QB 3ETBF 4F7CA 3PV7A 2BXYA 3DV6B 4ZO6A 5AZ2H 3F7YA 5MEPA 5IVXE 1F6AB 5EIVA 3ULSB 1EHLL 3KLHC 1CBVL 2ZCKL 5TH2B 2HLAA 5MENE 2ZCLH 2DQDL 5C0JB 3MRCB 3QQNA 3OKLB 3PABB 3G6JB 2P7TA 1DR9A 1BX2B 4KTEH 4M93B 2KPNA 4XRCA 4PJ9D 3O3DA 4NQDD 5I8EB 2OSLB 4L8CA 3MRLB 1V3LA 4KJWC 1XCQA 4KK5D 1JN6A 1TNNA 1UGNA 2MCPH 1HHJB 1DE4A 1RSFA 4LGPB 4MWFB 3T0EC 4P5TC 2AGJL 1U8JB 2GCYB 2QSQA 3CX2A 1XCTB 3O11B 3OF6A 3WLBB 1X7QA 1QRNE 4OLYL 4F33B 1A3QA 4PGZA 2P8MA 1ZMYA 3W9DA 3WIHA 3LKQB 4IRJA 1QFHA 3BH8A 4OUUB 1JF5A 5EN2A 3D0LB 2CO6B 2A6KB 2BNRD 2D7TH 5EUKA 4G6JL 5IB3A 1EFXA 1JGVL 2FZ3A 4Y2DD 3JTTB 4ODUB 4CVXA 1W0VB 2J6EA 1GGBL 2VDNH 5IK3B 5T3ZH 2FATH 2FHCA 4I3SH 4OSUL 5GGQL 5ESAB 3O9WD 5DJAB 2VAJA 1KULA 4JY5H 3NOIA 1NGZB 4RGMC 5F44A 4NFCA 4LLDB 3TCLB 1V3KA 2W38A 4PRHD 3VW3H 4OB5H 3FO9B 4LQFL 4NDMA 1ORSB 1MFCH 4XNZB 4NZTL 4U1KB 3E3QE 1HSAB 2VO5A 1AH1A 4U6TA 4OV6F 1NGQL 4MD4B 2Q7NA 1T66D 3KLDA 4M5YH 2CDEA 4ODVH 3TV3L 2PYEB 1VFBA 1RU9H 2ICES 3QG6B 1T21B 2IBBA 1OB1A 5GS0H 2OR7A 1A5FL 2IPUG 3RI5F 5D6DA 2Q8BH 3A0OA 1PZ5A 2B8OT 3OR6A 4JFXA 4M6OH 5JTWA 2HJKA 5DHYB 1S78D 3HA0A 2D03L 1INQA 5GXBB 3PIQB 3RL1A 4JRXD 1CDGA 1RUAH 4LSSL 1PEZA 4I3RL 3RU8H 3TA3A 5L8KB 1VDGA 2ZSVB 3L3JA 3C2SA 4KTDH 5DEGB 5EOCL 1EFQA 5FM5M 2NZ9D 5FYJH 2Y36L 4R26L 4NZJA 2VLKA 5ELIA 4PB9H 3LS5L 6FABH 5L2KE 1VFAB 4DFHA 2VLRB 3O45A 1ZLVH 4OFYA 1KTRL 1E6JH 5DFWH 2H26A 3ARTA 4B50A 5GJTH 1BP3B 2Z92A 4YXLL 4LRNL 5GHWH 4C58B 1ZVHA 3VDBA 1GGIH 4M7LH 4GMTH 2YD2A 1IKNA 3GRWA 3EO9L 2HVKA 2NY6D 1YN7B 4J4PC 3QUXC 3GIVA 3RVVC 5BV7C 1Q9WA 5DD5L 5HXMA 2IQ9L 1TQBC 2VZVA 3SCMA 3KDMB 4LDLB 1I8MB 3MUGA 3O2VL 3WD5L 2Z31A 4DVRL 2GKIA 4HS8H 4MJIA 1GZQB 1BWMA 2BNQD 1LDSA 4GSDH 5IBTH 4F7CB 4R0LA 2IBZX 5KAQG 4U1LA 2BSED 5M94B 2AK1H 4NP4L 3F7YB 4FQLL 5MEPB 4BFEA 4YX2H 5C6TL 4GW5A 1Q9OA 1CQYA 3RWFA 4M9OA 2R0LH 3BPNB 3UO1L 5CEZD 1U91B 2HLAB 3NIDF 4PRPA 3TT1L 1BD2D 4ZD3H 3IGAA 3V9FA 1Q9KA 2P7TB 3S35H 4GUPA 3VRJA 3VFMA 4XRCB 2VL4A 3O3DB 4CRPA 3WXWH 3BZEA 4L8CB 1NGPL 1JL8A 5DD3H 1XCQB 1EA9C 1JN6B 4U6XA 1MCBA 1CXLA 2X40A 1C1EL 1DE4B 3RI5K 4J6RH 3I3DA 2YMXL 4RX4A 1WF5A 1T89C 4TSBH 1FLRH 5BVJA 2HMID 1EO8H 2IGFH 1X7QB 5HVHB 2EXYD 2P8MB 1HYSD 1J0KA 2MMXA 5T1KA 3W9DB 4IRJB 3EW3B 3N9GL 5E2WL 5EN2B 4P46C 1G9EA 4LLWA 3DRTA 1OTUD 5EUKB 1CDCA 1IZJA 4X5LA 2DICA 1F6LL 2VUOA 3L3IB 1XF4A 4XTRD 1X5GA 4MHHI 1EFXB 3SDCC 2AI0H 5IB3B 3RZWA 4CVXB 1G9NH 4JFZH 1MCQA 3KS0J 4TOYL 3BKMH 4XP6H 2J5LB 4NIKB 4K8RL 4TQEH 3U36A 4NZRL 2CIKA 1IGFL 3B9AA 1MWAH 1F45A 5T1DL 5ALBL 1I9EA 3H0TB 4GQ9H 3RKDC 5ADPH 3BHBA 3RGVC 3HE6A 1YNKL 2CUMA 3KPLA 5DUMH 3MTRA 4Y4HD 3UPAA 2DQCL 4NDMB 4QCIB 3MLRL 3V79C 1IFHL 5LWYH 2VUYA 1AGCA 3VJ6A 3U7YH 4XI5C 2EDXA 3HMXL 1OL0A 1FO0L 2Y4SA 2EDFA 3REWA 4M1CD 4XVUC 3RZCA 3EJZD 5L0QC 2CDEB 5D8JH 5E95B 5I18L 1VFBB 4LLAA 5DQ9A 3U4BL 4IRZL 1RUQH 1XGUA 5B39A 1OB1B 1RZKL 4EI5A 4POUB 4HS3A 1PZ5B 1W72L 3OR6B 4BYHA 4JFXB 2HJKB 1DJSA 1INQB 4JG0L 1MAML 4XCCH 3BPCA 1U36A 2X7LA 1A6VL 3CLEH 3OAYH 4U2ZA 3TA3B 4Z9KB 4NJAL 5DMIL 5JZ7C 4PP1C 4ZTOL 4NQUA 1MRFH 3L3JB 3FQTA 2E6JA 1KPVA 4FQXD 4N0YL 3QUYA 1T1ZA 1FL6A 4PP2A 2WP3O 4L9DA 1FAKT 4JZJC 2OP4L 2DJSA 4Q9QL 3GBML 2VLKB 4PJAF 3W0WB 1SEQH 1DVFC 3EZJB 3MO1A 5FCSH 5ICYA 2G60H 4K71B 1JI2A 1GYAA 3O45B 1XF2A 3ZTNL 3ULUE 2W0LA 1WGOA 2H26B 2Z92B 3EYFA 4XBEH 3L3OA 4G9DA 4ENEC 1G9MH 2C3GA 4YDKH 3BD4A 2HVKB 3FFCD 3GIVB 3QHTC 4L8SA 4Y1AE 3SCMB 1L7IH 1CYGA 2CLVA 4YGVA 3MUGB 2WIIA 3BIKA 4NO5A 4O5LH 1N5AA 2AK4A 1WAAA 3RY4A 1KB9K 2Z31B 4JFED 4P5MA 1D6VL 3IAGC 2R4SH 5KVFH 2X1PA 2X2YA 4XC1L 4U1LB 2ZUTA 3MLWL 2Y1VA 4ZXBD 3QFJA 4ODXA 3CMOL 1FNLA 1R24A 1Q9OB 5F1IB 3IFNH 1IGYB 1AQKH 3RWFB 5DGRA 1RK1A 4NQEE 1V7NL 4ELMF 4PTUA 5LG1A 5CIPA 4JG1L 3UC0L 1CGTA 4UV7H 3PDOA 4PRPB 5I19H 2LVCA 3IGAB 1Q9KB 2A6DA 2I9LA 5IMKA 5D9SA 1R3KA 4MNQE 4GUPB 4YHKH 5HI3D 5I1GH 2ESVD 5D1XD 3SKMA 3VFMB 3BZEB 3TGXA 4LOUC 4YHNB 3ARDA 1FH5L 2EH8L 2Y07H 4U6XB 3UYRH 2BVUA 2OL3A 3L95A 4PRIE 5JMOC 4K3GA 1BJ8A 4GQPH 5BVJB 1WCQA 3GSUA 1MCEA 3EHBD 3MODH 4ZAKC 3U30C 2PXYC 2EO1A 4M4PA 3OKMA 4LLWB 3BP6A 2IFFH 2DMCA 1XF4B 1J0JA 2VDOH 3RVTC 3PGFL 1X5XA 2J12B 1U3HA 1N64L 3MJ6A 5GGTA 4A6YA 1Q9LA 4KMQA 3LIZH 2ZPKL 3U36B 2Z8RA 2A2QT 2CIKB 3S36H 2FO4A 4JM4H 1PZUB 1RK0A 3SDXF 4OQ1A 4JM2D 2VXSH 1QLEL 2ZSWA 3A6OA 3HE6B 1QBLH 1XGTB 3KPLB 2FH6A 4OZFG 5LAXA 5KOMC 2VZTA 3QO0A 5LKNA 4XP1L 1AGCB 5F1KC 4P2RD 1BQSA 3REWB 4LSDA 4DN4H 3TN0D 3RZCB 2CRIA 4ELKB 2D7MA 4K3EH 1NCDH 4RDQG 4Y16D 5DQ9B 4XAKD 1K4CA 2XY2A 3T0EA 1XGUB 4P5TA 5B39B 1FG2A 1I7TA 4EI5B 3F65A 1CXFA 4HS3B 1K6QH 4UILH 4Z7VF 4Y8AA 1FYHB 3QDMA 1SYVA 3GZKA 2HT3C 2X7LB 4KFZC 1MFBL 2O5YL 3ISWA 1P7HL 5I1JL 2D2OA 5KSBA 4XMKL 1QZ1A 1MELA 3FQTB 1KPVB 1U8NA 4PP2B 1T1ZB 1FL6B 4HT1H 1UM6L 1CL7I 5GSVA 3MXWL 3BZFA 5I0ZA 3TC9A 1LO0H 3MO1B 5ICYB 4X9IA 1XF2B 2DQGL 5GJSH 3T1WA 1JIBA 3EYUL 3QDHA 3LEXA 1MPAL 4LIQE 5C0CD 1KBGH 4AL8H 3EYFB 3L3OB 4NM4H 4M4RA 4G9DB 3HZMA 3VXUE 2DQJL 3PGCA 3RWCA 5T5FL 4O58L 1YDPA 5D72H 3EO0A 3G6DH 4CMHB 1ZEAL 3F6LA 4X8XA 2DMBA 2Q87A 4TUKL 3H9SE 4L8SB 3UTPE 2HYMA 1A7BA 2BY1A 4LL9A 2CLVB 4YGVB 5FUCE 2WIIB 3BIKB 2EYRA 3VWJD 1N5AB 2AK4B 1ZLSL 4P5MB 1DEEA 2CRMA 3JV0A 3ARGC 3W39A 2R0KH 1P6FA 5DD0L 3I9GL 1OP3H 3U83A 3CAFA 3VFRA 1FIGL 5IQ7H 3QFJB 4ODXB 1MLBA 4RCAA 3VGAC 4HPOH 1R24B 3IXAA 4F15B 1BAFL 2EXWC 3WIHL 1RK1B 4Z7NF 4IIQA 2EZ0C 4JVUA 4PTUB 4KJPC 5CIPB 1EGJH 3PDOB 4Y4KD 1NCBH 2WBWB 2ZKHL 3MACH 1KCKA 5T33H 5EULV 2A6DB 2I9LB 3O6LH 4FQ2L 4R2GC 5D9SB 3VD5A 1R3KB 3TZVD 5IMKB 5JW3L 3SKMB 4DJMA 2J6EL 5AG9A 2VDQH 3U7AA 2QR0B 3QA3A 3ARDB 1OCWL 4O2CA 1QFWH 4FQIH 3E2HC 3EYSH 3NZ8A 2OL3B 2H2PC 4LASH 4QHNA 2MKWA 5FUOH 2V2XA 4MXQC 5HYJD 2FEEL 3GSUB 3ZT7A 5HYFA 5DR5L 1N4XH 3JWOH 1A7NH 1OGTA 1TETL 1C5CH 4LCWD 1HILB 3OKMB 2DQEL 3BP6B 3KPRD 1QBML 3O6FD 4XXCA 2GJ6D 4TNWF 4OBSA 4P23C 2Z8WC 3VMOA 4GG6F 4HIXH 1MI5A 1BOGA 2O26U 3RDTD 4A6YB 1Q9LB 2XKUA 1Y18A 2W1NA 5ANME 5L7XH 2FO4B 1R3JA 4PFEA 1BF2A 4JE4B 1UH2A 1RK0B 1S5IH 1UZ6E 2YPLA 3SDDD 5I76A 1SJEA 2ZSWB 2VKWA 1H8SA 1PSKL 5D7KE 2CDFA 1BBDL 3OB0H 4PJCA 5LAXB 1WICA 3QT2A 3QO0B 1WEJL 3RWHA 3O8XA 1U8KA 2D7OA 2WQRA 3T3ME 1EAPA 3V4UL 5J4MA 1A9EA 5TE6L 4JKWA 4EDXA 3DI2B 1MRDL 1GRWA 1K4CB 4R4ND 5DUBA 5FYKU 3T0EB 3RJQB 1FG2B 3P0YH 1I7TB 1U6AH 3VXSD 5F21B 4GW4A 1T89A 2W9EH 4PJAA 1XT5A 5GS2D 2MHAA 3HC3H 5IWLC 1ND0A 3QDMB 1FDLH 1SYVB 4M1DH 5K93A 1VGEH 2HTKC 3JVGC 4DUWA 3LSOB 1BHGA 5C0AD 1OAKL 3TBTA 1OSPH 3SDCA 1X3DA 5EZOL 5KSBB 1H3VA 3GRWL 3BQUA 1U8NB 4ZNEE 5KVGH 2X1QA 5GSVB 3BZFB 3S5LG 4L4VE 5B38A 4NJ9H 3VFWA 4Q9CA 3K46A 4RGMB 2YD6A 3RGVA 2BVEA 3LEXB 2F54E 3ZL4L 5JW4Q 5C08D 2A83A 1ZHLA 3Q1SH 5K33A 2MPAL 4UTAH 5CFHA 3HZMB 1F3DH 5HHXH 1JHLL 3PGCB 3U0PA 3NIFF 5C0RH 3RWCB 4JRXE 3DMMC 3QUMH 4Z7OE 3WIIH 3EO0B 5E99H 2ZCHH 2VITA 3WFDL 1FNSL 4TNWK 4ONFL 3BWAA 1OT2A 4ELMA 1J1XL 1E4XI 1PBYA 1SMAA 1VGKA 1U58A 1JTTA 2EYRB 4Q9BA 1DEEB 3BKJH 2B2XH 3W39B 1NH6A 2MOVA 1TIUA 2OXGA 1FE8L 2YHGA 3EDKA 2DL9A 4IMLA 1MLBB 5GISH 2Q76A 4QTHA 3IXAB 4IIQB 4JZJA 4GKSA 2GSIA 4XWGH 2YC1A 3BX7C 1AO7A 4TTDD 4UDTA 5I71B 3LAFA 1DVFA 2EE3A 3WJJC 2H45A 3W5NA 3IAQA 4X4MA 2E9WA 1YEEL 5DD1L 3SE4C 3QA3B 4W6XB 1CD8A 2ATKA 3FT3A 3KGRA 2VDRH 2NY2C 3B2VH 4O2CB 3U1SL 3ZE2E 5HD8C 3HG1A 3NZ8B 1X5AA 4QHNB 2QSCL 4A2LA 2V2XB 3X13A 1FORH 2XQYG 3UPCA 1DANU 2BNQE 4DKEH 4WUUA 3FL7A 2IPUK 3ULVD 3I2CH 1OGTB 1JPFA 2J8HA 1KEGH 4MA8H 5BV7B 1YYLL 2PO6B 3R1GL 1J86A 1TQBB 5T3XL 5LXGH 3LDBC 3GIZH 4NNPL 1VPOH 2ENYA 3V4VH 5MERA 1GGYA 1BOGB 1MI5B 5CEZE 3TPKA 5E8NA 1Y18B 2XICA 1OM3L 4KZDH 2ZUVA 5CZXD 3MOAL 5EDXA 1GZPA 4QRRA 1R3JB 3QIWD 1VSCA 2YPLB 2APXA 3NCCB 1KB9J 5I76B 3CXHK 4LFHD 4RZCA 1SJEB 4WGWB 3BIAX 5HDLA 5B3JF 2CDFB 3JV5A 1ZLUK 1SBSL 1I4FB 4PJCB 5D2LF 2PCPA 1UA6H 3CH1A 4NKIH 2B0SH 3RWHB 1CICD 3HMWL 3QULA 3O8XB 5AZ2L 1U8KB 4HC1A 1A9EB 4HW6A 5E2TL 1CDBA 4EDXB 1I1AC 3GDBA 2XKNA 3J7HA 2ZCLL 2A9MH 4KK9C 3DVGA 5DUBB 5D7SH 2XY1A 4X0KB 5A16A 4GW4B 5HYEA 1CF8H 1L0YA 4PJAB 4S1RL 1JYNA 1G7HA 2MHAB 4W81A 1GC1H 4OV5A 4HFUH 2PXYA 1TITA 5DMJB 3AAZA 1FN4A 3LQAL 1OARL 1NPUA 4PLJC 5I17A 3LHPL 4OIIL 2BNUA 3NTCH 3TBTB 1CXKA 3JV6A 3SDCB 4F7MA 3BQUB 1I3GH 3F7RA 1LO2L 4HH8A 4PRDA 2FLRT 4NM8H 4G42A 1WZMA 4LARH 4DVBA 4UBDC 5B38B 4QXTA 3VFWB 3I6GA 3RGVB 1AY1L 4OGAC 3WSQH 5BRZD 1YC7A 4I3SL 1P4BL 2ICCA 5CZVH 5EIQA 5I1KH 2A83B 1ZHLB 1QBBA 3MGAA 3B8SA 1FNFA 2VQUA 3U0PB 3MV8E 4F37F 5L0QB 1TVBA 3AC0A 5D5ME 5M7QA 4OB5L 1IGCH 4RWYH 2W65A 5H35A 1OT1A 2VITB 5J3HC 4IEFB 2J3SA 3BWAB 5TPWL 4ELMB 4H20H 3OF6D 1DP0A 1VGKB 5AZEL 2D7NA 3GJFA 1U58B 4HEPG 1RUML 1WBYA 2UV3A 4EN3C 2FRGP 3QDGD 5LGHL 2EICA 3RP1A 1FRGH 1MCOH 5ITBL 2OL3L 4PG2C 5GZNC 4OLUH 5CSZA 3DVNA 3V6ZA 2NXYB 1EFXD 3HI1A 3U9PH 3NFNA 4IMLB 2Q76B 1XGQA 4QTHB 5E8OA 1UACL 3KYKL 4JZJB 4GKSB 2GSIB 2YC1B 4HMCA 1AO7B 4UDTB 1DVFB 3E6FA 4MVBD 1RY7B 3IDUA 4XT1C 2AJYH 4LRIC 2FBJL 5GGTL 2I5YL 4A6YL 3CFJA 2PTUA 5KW9H 4JPVH 2ATKB 2R2BA 2X4TB 5FAAA 3FT3B 3HG1B 3AMLA 2AJZA 3X13B 2MQ3A 3ALWA 4JFEE 4TULH 1H8NA 4P0DA 3TH2T 4OD3L 4UT7L 4WUUB 3SE3C 1JZ3A 4PJEE 4PJFE 1JPFB 4G6ML 3GB7A 1H3PL 1EEZA 1OP5H 3K3QA 4ODSL 2NYYD 3MREA 1HH6A 5DJ6B 5L6YH 2NX5A 3H2WA 3HC0A 5MERB 1BMGA 4WENB 4X6FA 1I3VA 5E8NB 4XHQA 4N1HB 4OLEA 3TA3D 2E7BA 5HHOA 1GZPB 4QRRB 4LPXA 4GRWH 2ESVE 3MRRA 3KXFA 4RZCB 3SKJL 1OOAA 2XRAL 2VXTH 2JB5H 2W9DH 1UC6A 2PCPB 4KQ4H 3CH1B 5DS8A 3TYGH 3W0WD 1AFVH 4CAGA 4G9FA 1X9QA 3E3QC 1FGVH 3QUZD 3QULB 2X89A 2YN5A 4F37K 1GCFA 2DTMH 2EDJA 3VA6A 2X9WA 4B41A 4H8WH 2XKNB 2FX9H 1R3HA 5IVXF 3GJEA 1U3YA 3DVGB 3UTTA 3HAEA 5DLML 5A16B 2VLME 1ZV5A 3JWDL 5DHVH 1H5BA 4MA1B 4OT1L 3MA9L 1G7HB 2FHFA 4RDQF 5C0ND 1KG0A 3LPGA 3WXWL 2VDPH 1DBKL 4OV5B 3U30B 4F58H 3QQ9C 1HIML 3AAZB 1FN4B 4NC0B 3SCMD 1JZ6A 2HP4A 3MJGX 3HNVH 5I17B 2BNUB 3JV6B 1NAKL 4PYHA 4F7MB 4P23A 1A6WL 4YE4L 2EEAA 5GPRA 5SX5K 1EO8L 4NQCE 2DS4A 4EQ3A 2Y6SC 4OUOA 5FYLL 4PRDB 2ADFH 1TQCC 4FQ1H 3HZVB 4G42B 1HDMB 5C0GA 1FGNH 3QJHA 1J1PL 2R2CA 2I60H 1A6UH 4QXTB 4J3UA 3T09A 2NY4D 4JREB 3V2AR 4F7TA 3WNPA 2FX7H 1KB5A 4JFZL 5DC9B 2FGWL 4XP6L 4AEFA 1T0MB 4PRPD 3RY6A 3Q0HA 1MEXL 1N26A 4PB0H 3MYZA 3GK8L 4NO0A 5D7JA 1NKRA 1TVBB 4OCWH 3V8CA 3BP5A 1I8KA 2BHUA 2W65B 5H35B 3W11C 1FNEA 4D0BA 4WJ5A 1GJIA 4M6MH 5LWYL 3CJJA 5E7BA 1IKFH 4YC2C 4ORZC 5I15L 1DFBH 1MHHA 4BZ1H 3GJFB 4G6KH 1WBYB 2HWZL 4XCFH 5JA8B 3QDJD 1MIML 3JVGA 5CSZB 1IT9H 1Z3GH 4LCIH 3DVNB 3V6ZB 1EUTA 4KMLB 3HI1B 3NFNB 5MEOA 1JZ2A 1XGQB 4OF8A 1CGYA 5EFIA 5KJRH 3UTSA 5E8OB 4MA7H 5HHPA 5BV7L 5E56A 2IG2L 3QI9D 4PJGA 3E6FB 1WZ1L 1IBGL 4WHTA 3HE6D 3BRFA 3LEYL 3MJ9A 4OTXH 3CFJB 5JDSA 2R2BB 2ZJSH 4PGBA 3D48R 1I8LC 2AJZB 4MYWB 5DRZA 3ZE0E 5KVMC 3RZCD 3FB5A 2XT1B 3CUPA 4DFIA 4XVJH 4C4KO 4UT9L 3SBWA 3GB7B 4KROD 4P2QE 4OZHA 3TBYA 1EEZB 1IC4L 2H2SC 4JKPH 4XBEL 1KN4H 5D2LA 3MREB 4V1DD 1HH6B 5GRZA 3SDAA 1TJHH 5AYUH 2VQ1A 2NX5B 1YA5A 3S4SA 3HC0B 3QDAA 5EU6E 1PD6A 2CQVA 1A0QL 4X6FB 4WRLA 1G7MA 4PUBH 3DX8A 3EOTH 1UXSA 5HHOB 3OXRA 3MRRB 3KXFB 3WBDA 3E8UH 3GSNH 3MOQA 4PV8A 1QYGL 2X1XR 3OKOA 5DS8B 2ERJC 4G9FB 3S7GA 1KLFA 3MRHA 3GMNA 5EORH 3ZO0A 3MV7A 3EDFA 4MB3A 3GMRA 1EEYA 2JELL 1PDKA 1R3HB 1PX4A 3QXWA 3UBXG 4CJ1A 3GJEB 4JPWH 3UTTB 3HAEB 1RZJL 2AW2A 4PJXA 2XG5A 2LE9A 2DQIH 4DN3H 4RMUA 1H5BB 4AEEA 4PJBE 4HWEH 2YA1A 2HG5A 1KG0B 5F89A 3QISA 2BJMH 3OJ2C 5DK0A 1EBAA 2ED9A 3UYRL 4ZFZA 4X4YA 2HJFA 2HFGH 4OCSL 1BQUA 2ORBL 2B20A 3LQMA 1RUKH 4PJDE 1YNTA 2A77H 5F7KC 2LTQC 3WFBL 4BQ9A 4LVHB 5J57B 5T3ZD 4GXUN 5C0GB 1TJGH 3QJHB 1T1XA 4HXBH 3S37H 3QFJD 1L6XA 3ZKMD 4I0KA 4L3EA 4NZDA 2ED7A 1LO5A 2F8VA 5C0FB 4Y0GA 3ULUC 1KB5B 4J7RA 4PPTA 2RGSA 1BWWA 3D3VD 5EOQH 3EYQC 2CKBA 4P48A 4PY8I 3ZDZE 1CGUA 3O4LD 3VXSE 4RIRA 3CXHJ 3U0TA 5FM8A 4NO0B 4S1DD 5D7JB 1FZKA 3ARQA 4P2YA 3WUWG 3DECA 1Q0XL 3CLFL 43CAA 5D1ZA 3BP5B 1I8KB 5KBNC 1FNEB 4D0BB 4WJ5B 5ACZA 4OCYH 4HIHA 5GS0D 2ZNXA 4KJQD 3NIGE 1MHHB 4DN4L 1XGPA 2G75A 5IB5A 1SEBA 4K3EL 4FN0A 4G43A 3JWNC 1TCRA 4MZ3A 4WVRA 4CN6A 4BZ2H 2F53D 3MFGB 3GSWA 4PJ7A 4UILL 5MEOB 1A6TB 5DMGC 5EFIB 5GRWA 4LEOA 5ISZA 3P4OA 3QZWA 3U0WL 2HN7A 3UTSB 1QFPA 4MD5A 2AEWA 2PF6A 5DD6A 5FYJD 5HHPB 1K3ZA 4I13B 3G6JE 1UCBH 3OKYA 2HRPH 4PJGB 3OAZK 1B2WH 1F8TH 2DWEA 2I25N 4K2UL 4WHTB 3CFEA 4KMTH 4C56A 1IAIH 1M4KA 1UM4H 3O2WH 2OXHA 3LZFL 1IGIL 5JDSB 3MUZ1 4XP9L 4PGBB 4ALAH 4LCUA 3EGSB 2YUWA 4LVNC 5DRZB 5CJOH 4OM0L 1MVFA 5B4MC 1X5JA 3FB5B 4K3JH 4EDWL 2AJVH 3CUPB 4JJ5A 4HK3J 5I9QB 3DYOA 4QHKJ 4YHOH 3TFKC 2QLVB 5KVDH 2YEZA 1Z0NA 1WWWX 2BCKA 2BY2A 4LKXA 4OZHB 3TBYB 2YD8A 1NDGB 4WY7H 5E7FA 3BKCH 4YXHL 2NY3B 5ACMA 3ULUF 5D2LB 3CFCL 3H42L 5I66A 3SDAB 2ZG1A 4HC1L 2VQ1B 3LKSA 1Q38A 3S4SB 4ZOEA 1F4HA 5IFHL 3TO4D 1G7MB 3DX8B 4PG2A 3NBNA 1UXSB 2H32H 3M17A 3OXRB 1XR9A 4I18A 3DGCR 3TNMB 5C86A 4PV8B 5DUPL 1MNUL 4M1GH 5FGSA 1EBPA 5MENA 1DQTA 2D4DA 3OKOB 2R0KL 2XZQL 3GSRA 5GGSA 1OD9A 4E5XA 4EUPA 1AGBB 3MRHB 3GMNB 3MQIA 2VDLH 2PYEE 3MV7B 3RVXD 1DSFH 3K8KA 3BO8A 5FO8A 1IGJA 1I8IA 4Z7UA 4OZGE 1EEYB 2J88H 3KG5A 4H0HB 3AXLA 1I7RB 2NY2B 4I0PA 2DYPA 2N7BA 4PJHA 3O4OB 4PJXB 3MCLH 2FEDC 3ZZ1A 3LN4A 5GGVH 2HG5B 1N0XL 5F1OB 2DQHL 5F89B 2QSVA 3OG4B 5DK0B 1TZIA 1U3ZA 3PL6D 4P4KA 1Q0YL 4ZFZB 1GIGL 3QB7C 2W92A 4X4YB 2HJFB 5FUOL 2DLTA 2DBJA 3D18A 3TBVA 1YNTB 3MUJA 4ETQA 3CSGA 1N4XL 3MROA 2OR9H 3FB7A 3BYTA 1V7MH 3W2DH 1T1XB 2VLRE 4HCRH 4RFOH 4ZS7H 2X4OA 4L3EB 1LVEA 4CVWA 1LO5B 4X6CF 5CD5C 4HIXL 3A67H 4DKFH 1GHFL 4URTB 4AQOA 5E70A 2CKBB 5JOPD 1T22A 4W4OC 4LPYA 4Z95H 5EC1A 1TJIH 1NQBA 2BHZA 2QQKH 3IKKA 3U0TB 2FR4B 4Y8DC 4K07A 3VFOA 2OTUA 1FZKB 3I02A 4PYGA 43CAB 3PF2A 2GQHA 1IC1A 5D1ZB 1QD0A 5I8CA 2XQYK 4HJGA 4WI3A 5ABDE 4XNYH 5SX4I 2QQLH 4TRPH 2CK2A 4XCYB 1RJZA 5FUCC 2F8OA 5IJKC 2NNAA 1NJ9A 2G75B 4IOSD 5IB5B 3F7VB 5DT1H 1SEBB 5ETUA 5T1LA 4G43B 3VG0H 3MA7A 1TCRB 2PO6D 2YA0A 4XAWH 2YD9A 5JUEL 3NH7L 2ARJA 2GTZA 3GSWB 4PJ7B 1MI5D 4KRPC 4LEOB 5ISZB 3P4OB 3QZWB 2HN7B 4MD5B 5DD6B 1OAQH 1NMCB 4OLZH 3TP4A 1JRHL 5KSVA 1H3XA 4G5ZH 1DBAL 1NUDA 5L2KA 2CLRA 4PJ8C 1O7SA 1TPXB 4X8JA 2BRQA 2DWEB 4XB8A 4RGNB 3CFEB 4Y88A 4YHMH 4K9EC 4C56B 3A6CL 5DQDH 5F97E 2XXMB 5DWUL 2Q8AL 4HWBH 3O8XD 2C3VA 4LCUB 1NFDA 1AXSA 1F13A 1NCCL 1TTFA 4I2XA 4JJ5B 2NW3A 4G7YL 1YZZA 2EEDA 2YEZB 3VXPA 2BCKB 4LKXB 1S7XA 2RHEA 4TVPL 3L7FA 2XQBH 3Q6GH 5ALCH 5F9OH 3LKSB 4AJ0A 3ZTJG 4BK4A 4FFZL 1N7MH 1NGYA 1EX0A 3MUHL 3NABH 3NPSC 5E99L 2ZCHL 1ERNA 3PP3K 2WMPA 5F7LB 1GXEA 3M17B 1MJJB 4PJ9C 1XR9B 4I18B 3CDCA 4JN1L 5FGBC 4NN7C 3SGJC 4KK5C 1T0PB 1INEH 3BKJL 5MENB 1Q94A 1VA9A 3GSRB 2IQAA 5GGSB 4KVCH 2EDNA 4E5XB 4EUPB 2WLZA 3SKNA 4C55A 3GNML 1Z9MA 4QGTA 2CDGA 3TPUA 3MRPA 3BO8B 5FO8B 3B9KD 1IGJB 1I8IB 4Z7UB 4KHXH 4JRYA 2GT9A 3AXLB 4I0PB 3K2UH 4M5ZL 2DYPB 4PJHB 4Y2DC 5IROA 3LN4B 4FS0A 4XNUH 1KB5L 3H9ZA 1WITA 1KIPA 4MQXC 4U6VL 1NC4A 4LCCA 3RIAF 5EA0L 3ARRA 5EZJA 1TZIB 4P4KB 2PYFA 3O9WC 4U7MA 1OLLA 3GO1H 3FN3A 2JIXA 3P30L 3FHQA 1FORL 3D18B 1JMZA 1I75A 2RB8A 5B8CC 2IWGA 3Q5OA 4ETQB 1TTGA 2VLKE 2D0FA 1CDJA 3W0WE 3MROB 1U8PA 3I2CL 2AV1A 3N1QC 2O5ZL 1DQML 4BM7A 3FB7B 4LPWA 5FUZL 2VDKH 2NXYD 3H8NA 2IPKA 3HPLA 2X4OB 3GIZL 1T66C 4EI6A 3HN3A 5EU4A 4DQOL 4WNQA 4MB4A 5HSFA 1T22B 5I30L 4KZDL 5EC1B 1PAMA 3LVEA 1IEHA 1CLCA 4XBPA 1MFAL 1S78C 2FDBP 4OIBA 2NTSP 3VFOB 2OTUB 3I02B 5DA0B 4JZOA 1UZ6F 4UINL 5I8CB 5SV3A 4HJGB 2Q6WA 1DBMH 3DUHA 2NNAB 1DQDH 1RULL 3QPXH 3MJ9L 2NZ9C 4WUUD 2MFNA 1R5VA 5HDBF 4O9HL 5ETUB 5T1LB 3MA7B 2YR3A 3T3MF 1BVLA 4M3KB 3RKPA 3HNTL 4DOHE 2DRUA 2ARJB 2GTZB 3RHWF 4TPRH 5BMFL 4HZAA 3WLWD 5KZCD 4HJJL 1MH5A 1GC1L 4LVEA 4RFNC 2P5EA 4PRPE 3V52H 1VFOA 4HFUL 4LSTL 1TQCB 5CZKA 4QRRD 1KFAH 2DIJA 2GTWA 2CLRB 3MNVA 1B3JA 1PKQE 4NCC1 4X8JB 5MP6H 25C8H 4UZGA 4NHCL 3J8F7 2NY6C 1I3GL 2IH3A 4KZEH 4GMSH 2DN7A 2XI9A 3KJ4C 4XX1E 4NWTL 1UWEL 3PNWA 5ICXB 2C3VB 4Z8FL 5HHMD 1XGYL 1NFDB 1RHFA 2XFXA 1AXSB 1WUNT 3MSPA 1MF2H 4I2XB 1N2RA 3RIAK 4GKOA 2NW3B 4Q7DA 3WSQL 1MCCA 3MGOA 1N59A 3BEWA 5ESVA 1JFQH 1KELH 1G7IA 3JV4A 2F58H 3LMJH 3BN9D 4MJ5A 1CVRA 4NNXA 3MLVH 1BF8A 1RIHL 5I2IA 3EBAA 1M6OB 1NGYB 3L3KA 3GHEL 2X6MA 3GBLA 1LEIA 1MAJA 4Z7OF 1AJ7H 4Y4FA 4LPVA 1HYRC 3QIUB 1OW0C 3I85A 4RMSA 1B4JH 4L8DA 1UVQA 1Q94B 2FX8L 5ILTL 5T3XE 2IQAB 1JGUH 2EDWA 2X4NA 2HMIC 3IDXL 2BP3A 4MAYD 1KYOK 1I9IH 3SKNB 2EXYC 1HYSC 2CDGB 5E6ID 3TPUB 3MRPB 5EG6C 3DO7A 3DVIA 4QHLB 4JRYB 4F9PA 1OTUC 2VWEE 4XTRC 4H0GA 4JDTL 2XTJD 2XA8L 1MRCH 4G3YL 4GRLA 4OCXL 2Y06L 1KIPB 1JHTA 3DLQR 2CKBL 1AD0A 1NC4B 2YOCA 4LCCB 4XWOD 3B5TA 4X6CA 5EZJB 4JO3H 1BZ7A 1BECA 4YFLI 3RHWK 2RJMA 3C87A 3WHXA 3RAJL 2JIXB 2AV7A 4OLWL 3O3UN 2NLJA 3ZE2F 1HXMA 2H3NA 1CLZL 3BI9X 3OR7A 2F5BH 3BDYL 1U8PB 2AV1B 2Z93A 4HUKB 1RVFL 3FQNA 4UMGA 5D96C 1MFEH 1DUYB 2Z4QA 3STZA 4M1CC 4D2NA 1NC2A 2IPKB 3HPLB 5DVNA 4ZS6D 3EJZC 1MFDL 3INUH 4EI6B 3DSFH 5FYKH 1NBVL 4LAQH 5EU4B 4WNQB 2NR6D 2ERJB 4P3DA 3K4ZA 1HHIA 4JR9H 1JPTH 4XBPB 5DYOA 5J0BA 4JZOB 2PNDA 4U0QB 1RI8A 3FMGH 3MBXH 4KQ4L 3TYGL 2VISA 1X5YA 2Q6WB 3SQOL 3HI5L 3MBED 4ZSOB 3X3GL 2AK4E 1WAAE 5J12C 1A7QH 2DTML 4PS4H 3PWPD 4K7PL 1CFNA 4DW2L 35C8H 3OPZL 1R5VB 1NBZB 1BVLB 4U1GB 1G6RA 1YY9D 3QFJE 1RIUH 1YMHA 3KR3H 2H32B 4MNGB 4YHLL 2CJUH 1O7VA 1BFOA 4G7VH 4UT6L 1MH5B 2QSTA 1ZLUH 2P5EB 2DI7A 4K7PX 3O2DH 4P9HH 3KPSA 4U7SA 1CE1L 2GTWB 3O0RH 3MNVB 3EFDL 4FQCH 1YEGH 1ACYH 4O02L 3C5ZD 4KI1A 2H1PH 2IH3B 4WO4D 1L0XA 1JZ7A 5C0BD 5CILH 3WXVL 4LBEA 1FBIL 4W4OA 1L4IA 4L9LA 3PNWB 4M7LT 1FGNL 5F3BA 4R6UA 2C1PA 2VLJD 5FECB 4S1QH 2XFXB 2FB4H 4DUVA 1N2RB 4WTZA 2R4RH 4Q97A 4LHUA 5HI5D 3MGOB 1N59B 3BEWB 5ESVB 2FECI 4U1HA 4JHZA 1W8OA 3NA9H 2F53E 4ZXBC 3IRZA 1G7IB 3JV4B 4PTTA 3QCUH 4MJ5B 5IJKA 5FM5O 4NNXB 2WANA 3FFDB 5I2IB 3VGFA 1F4XH 1A7RH 3C6SA 1I9JH 1RZFL 4Y5YC 1A7OH 4OCWL 3O6MH 3ZKND 3X12A 3UTOA 3ARFD 1LEIB 5GIRA 3W9EA 1EZVY 1UCTA 5D5MF 5HI3C 5D1XC 4K7PY 4Y4FB 3TBWA 1ODAA 3K81A 1SM3L 1OHQA 2C4FT 2OZ4H 4Q6YA 3HZYA 2NY0B 3BISA 4L8DB 1UVQB 3ES6A 1T7VA 1T03H 1OWWA 1Z3GL 2X4NB 3U46A 4LCIL 1T20A 4HWZA 4PJ8A 2ZUSA 4Q58C 4R4FH 3EHBC 1L6ZA 5IFAL 1IARB 5I1AA 3DO7B 5IHLB 5KJRL 4O4YH 3T0EE 1GGUA 4K23H 2SEBA 3BE1L 1ED3A 4LVOB 4HF5L 4N68A 4NO0D 2NY5C 2B7DT 3QDME 5D7JD 5DO2C 1CIDA 4GRLB 2EH7H 1JHTB 2QQNH 1AD0B 4X6CB 1A4JA 3P9WB 5ID0B 4FFVD 1BZ7B 1TVHA 2ZJSL 4JM2C 3WHXB 5KSBE 5GSRA 1LK3L 2AV7B 1CWVA 2NLJB 1HXMB 3NCJL 2H3NB 3H3PL 3OR7B 5GGSY 4APQD 2Z93B 1FAIL 3FQNB 3LD8B 4U31A 4KHTH 1IZKA 2Z4QB 3STZB 4HKJB 4PJ9A 1T0NA 1NC2B 4NQDA 4PJEF 3TN0C 5FGBA 1M1SA 3UTSD 3QQ4A 4NUGL 3SGJA 4Y16C 3NMEA 3OV6A 2J4WH 2HKFH 3MLSL 1NCUA 3MV9D 4KY1H 4P3DB 3DI3B 4QOKD 1HHIB 3HR5A 1GGCH 4AENA 4GFTB 4JQVC 5DYOB 5DJCA 3FN0L 1YEDA 2NY1D 5FYLE 2BNRA 1R3IH 2VC2H 2VISB 2CXKA 1VADA 4G6AD 4YHYC 1FFOA 1BQLL 1HKLH 1BVZA 4NOFA 4BFIA 4Y2DA 3EOAA 3VFNA 4RBPK 5EU7C 1QHOA 1CFNB 3OB8A 4QWWD 3STBA 1NLBH 3Q5YA 1H3GA 5IOPA 4PY7A 3D9AL 1YY8A 2NY3D 1G6RB 1YMHB 5FCUH 2VXUL 3UJJH 3S9DB 2BFVH 3BSZL 4PRHA 1BFOB 1Z5LA 3L6FA 1YMMD 4JDZA 3NZHH 3KPSB 4TVSa 3BKYL 4FQQA 3ARXA 2YD3A 3HC4H 2OK0H 4GXVH 4U49A 1J0HA 1U8OB 1KCVH 3N85L 4FFYL 5BOPA 4LBEB 3CK0L 1ZKAA 4L9LB 43C9A 5F3BB 2C1PB 3L3DA 1VESA 1CTNA 3VWJC 2OJZH 3C6LC 5CP3A 4EXKA 5JXEC 2AEQH 3F8UB 3IXTA 1RJYA 2AABH 3GI9L 4LHUB 1ADQA 3QXAA 3ZMRA 4U1HB 4M7JH 3GM8A 2WSKA 4PTTB 2K7PA 4L4TD 3VXOA 1MI5E 3LCYA 5DFVD 5SX5H 1AR1D 4I77H 3MR9A 2W0PA 2APWA 3C6SB 4Y4KC 2DJ4A 3X12B 4M62L 4AEIL 3MLXH 3OKKA 1P7KA 2YPLE 4CVZA 2YPVL 5GIRB 3W9EB 4FOMA 3TZVC 1HEZA 4XPTH 3UPRA 2R56H 3TBWB 4PJCE 2PR4H 1J7VR 3RWEA 5CKAA 3HZYB 3QHZL 2BRRL 1A14L 2R2HA 2YRZA 4IRSC 5EWIL 3DPBA 3ES6B 3PDGA 4OGXL 3HE7A 4L3ED 1T20B 4HWZB 4PJ8B 3B9DA 4ZUWA 1N6VA 3LY6A 1Z9OA 1VENA 1KV3A 3MLYH 5I1AB 5FA4A 2E3VA 4X5WA 1QFWI 1UWGH 3ARED 1YJDH 5CS7A 1IQWL 3O6FC 5LBSL 2SEBB 4JB9H 4R90L 1ED3B 2YD1A 3W5MA 4E9LA 3WL9A 3RTQD 2CK0H 1B2WL 4WV1C 1EJ6A 3RDTC 4KU1A 3KPPA 1IAIL 5D1ZD 3X14A 1CT8A 1RZIA 1TVHB 3WMSA 3SDDC 4HWNA 5GSRB 5JQHC 3QSKB 3P11H 4JO4H 4K3JL 5BOZG 2HKHL 1KJ3H 3NPSB 1BD2A 3ZE0F 4LSUH 1RZKC 2F8XC 3M8OL 5IKCA 3BKCL 4OZFH 4PJ5D 4PJ9B 5DJDA 1T0NB 4NQDB 2VLLA 4NN7B 3QQ4B 5IBUB 2X5PA 2GYSA 2XN9D 1MHCA 3U7WH 5J1TC 1S9YA 2EDDA 1ULVA 4OQTH 1X44A 3T4YA 4JQIL 3HR5B 1DBBH 4AENB 4OLXL 1PGRB 5SWZD 4U1IA 3Q2CA 5DJCB 3ROOA 1YEDB 3DSNA 1A22B 2BNRB 5KANI 3N06B 4QNPE 4HAFA 4ELME 1F02I 1VADB 2Q86A 1FFOB 1KYOJ 3DVFA 4BFIB 5GRJL 3VFNB 3EOAB 1UM5L 3BAEL 3PHQA 3DUUA 4MAUL 1CD1B 4AIXA 5B39G 1ITCA 2P42B 1JRHI 2F15A 1BREA 2VKXA 1S9WA 3SDYH 1OTTC 5IOPB 4PY7B 1YY8B 4J3XA 4P3CH 1MJUH 4PRHB 1Z5LB 4Y4HA 2BVYA 1EMTH 3V4PH 5ID1B 3L6FB 1AO7E 4FP8H 5JHLH 5JPNA 4JDZB 1MIEH 2QADD 4M3JA 4PJBF 4M93C 4N5EC 1P9MC 3ZYOA 3CCHB 4X4ME 5CBAA 4FQQB 1UB6A 3B2UD 4MZ2A 3QG7L 2F5AL 4ISVA 5IESL 1NANH 2ZUWA 1MFNA 2DWDA 4JGMA 3C5SA 3G04A 4OLVL 4PJDF 43C9B 3RVWD 2FWOA 2AQ2A 3L3DB 2X41A 5E5RB 3IT8D 2ZUXA 4WUUE 3RNKA 4NKOA 1ITBB 3MLUL 3IXTB 1J0ZA 1KXTB 1RJYB 2XZAH 2R8SL 4I0PD 5T1MA 4O00A 2BOCA 3QXAB 5CJXC 2IF7A 3D2UD 3EFFA 5I1LB 3RA7L 3VXOB 5AYQA 5TE4L 4FQXA 1ETZA 3T0DA 4AK1A 1CTOA 3MR9B 2IPTL 4TTDC 4YGAB 3RUGF 3S88L 3QAZB 4QRRE 5J11B 5IGXH 3OKKB 1DBJH 1P7KB 3MRIA 1A47A 4GAJH 1HEZB 3UPRB 4FQJH 4ZFFA 1ZGLA 5J1SC 4RFNB 4XNZC 1T7YA 4ZFGL 8FABA 3C08H 2OLDA 2R2HB 3HR6A 4XB7A 5HHME 1KN2L 4JO2L 5F6HI 1JGEA 3HE7B 3CVHA 4ZUWB 4LSRL 5ITFA 3NFPA 1CLYH 2NY6B 3FFCA 4FXGA 2UY7A 3GI8H 5FA4B 4X5WB 4XPBL 1HINH 4BELD 3HS0A 4M48L 5DJXA 1J12A 1OF2A 2XIDA 3ARWA 4HZLA 5C1MB 3WL9B 3D39D 4JFEA 3M45A 3G6JF 3FKUS 2V2TA 2I27N 3KPPB 3X14B 1CR9H 1KSRA 3MX0A 3ZYJA 1YUHB 1CT8B 4E41A 5FGRA 1RZIB 2CUHA 4ZXBA 2AJXH 3QIWC 4MNHA 5JOEA 4UU9A 4IOIA 1GPOL 1FLTX 4MX7A 3WNNA 2HT4D 3E0GA 2EDQA 1GAFL 1BD2B 2HH0H 4NO2A 1CICC 3O3BA 1FFNA 1KJVA 4Y19D 3RL2A 3OAZH 5IKCB 2ESVA 3CVIL 5DJDB 4LMQE 2VLLB 3WS6C 4QRPD 5I1EH 2D9CA 1K5NA 3SO5A 3HNSH 2QHLA 5FFLA 2K3TA 5E9DD 2QL1A 2XKSA 1MHCB 1S9YB 2A9NH 2ZP0T 1VCAA 3HFML 1J8HD 1G6RL 3SHSA 1YPZA 3T4YB 4X83A 4TUOA 2NMSA 1CS6A 4D0DA 3ROOB 1YEIH 3MOBH 4R4BA 4YZFE 2EIZA 1CFBA 3FQWA 4OD2A 2DLIA 2DM7A 4X7SL 5LGKA 3PHQB 3DUUB 3IJSA 3BEVB 4YLQT 4WEBH 5GGUA 1DN0A 4LIQL 1S9WB 2EC9T 1J5OH 1DLFL 1CZ8L 3L5JA 1FPTL 4JM2A 3TWCH 1E6OL 4OZGF 2GK0A 2IAMD 1ZAGA 1J18A 4UIKH 4D9LL 3P0VL 5KTEL 1VFUA 4K3HA 4Y4HB 3LOWA 5INDA 1KIRA 1QFUL 1P5UA 5JPNB 3OX8A 4Z7QE 4XPHH 5D96B 4P2RA 3GO1L 2BVOA 4LSQL 1PG7L 5CBAB 3VCLA 1UB6B 2B1AL 5CKGA 1MJ7H 4ISVB 3PQYD 3QIUD 1EHXA 4Y16A 1QKZH 2DWDB 5IG7A 4KRLB 3C5SB 3G04B 4M7KH 4M6NH 4XP4H 1P1ZA 2FWOB 5HVHC 3ARBD 3DBXA 3QHFH 3TJEL 4IRJC 3RNKB 4NKOB 1AGEA 2FJGA 4H88L 5T1MB 3Q3GA 2BOCB 2VIRA 2YD7A 4ONGL 1CGSL 4DK6A 2G5RA 3EFFB 4FXLA 1QPXA 2NX5E 3WFEL 4LLVA 4NUJA 4FQXB 1ETZB 2G9HA 1HCVA 4BSVA 4RISL 3LN9A 5HHOE 4MVBC 5K9QG 1NAMH 1XFPA 3KXFE 2V9RA 4LU5L 4BH7A 2VMFA 1DLHA 4ZFFB 1YYMH 1ZGLB 2DOCA 2ZUQC 1FNHA 3D87B 4EBQH 1OGAB 1T2QH 4G9FE 5C0CA 8FABB 1BZ9A 5FM4A 1EPFA 1CXHA 4TVPE 2VLJE 3VDAA 5TDPA 1JGEB 4NBYB 2BZDA 3CVHB 4JQXC 5ITFB 3NFPB 4JHAH 3QPQD 3FFCB 4FXGB 4I1NB 4P59H 4QRTA 5K9OA 3HS0B 3UTTE 3ULUH 1OF2B 5FV1L 3WKML 2XA3A 4HZLB 1MREH 3VWJA 15C8H 4JFEB 2KL6A 1HZHL 3WFZA 5LVEA 3ECBA 2VDML 4JKLA 2V2TB 4MCZA 1DN2A 3C09B 3WDIA 2IBGA 3TA3C 4KXZI 4E41B 4ZXBB 1YEJL 4MNHB 4UU9B 1E27A 3BVNA 1VEMA 4MMZC 4F7EA 1NUGA 4IOIB 2XPGB 3GUTA 1A02N 4X7EC 1IAIM 2CRZA 5GQBA 4NO2B 3QUZC 3O3BB 1VB9A 1D5IH 4WUKL 4K71C 1FFNB 1KJVB 5D7LD 3RL2B 5HYSA 5K9KA 3TZVA 2ESVB 4L8BA 1BIHA 4XVTH 3W82A 2P5ED 1K5NB 1MAKA 4LK4A 5EB9A 3ARZA 4PGEA 4MMXC 4M6AA 1FIEA 3L5XH 1WC7A 4LP5A 2BXZA 1YPZB 5HYJA 4TUOB 4D0DB 1AJ7L 1IKNC 3O81A 4MB5A 5C0NC 4BJLA 4R8WL 3KHQA 4LCWA 4R4BB 3CU7A 1IAOA 3SCMC 1B4JL 1D7FA 3KPRA 2GJ6A 3CFBA 4MA3A 3FQWB 4OD2B 4UV4H 4U1SA 1AC6A 1NCTA 4AY0A 5I1DB 3IJSB 5K9JH 3RDTA 1LILA 1AE6H 4B53A 2WUCH 2ZNWA 3KYAA 5GGUB 1A7PH 1DN0B 1ZSDA 1T3FA 4K55A 1NLDL 3I50H 3PP3H 1L7TH 5E5MA 1B4RA 1FO0A 1S7SA 4JM2B 3QUXD 2NY4C 3RVVD 2GK0B 1M7XA 4UAOB 3UTSE 5TFSL 2QKIA 2VSDA 4HGMA 1ADQL 4ZFOA 1KIRB 5INDB 5F7EH 4PJGE 3L9RA 3MV9E 4YK4C 3BZ4A 3OX8B 4P2RB 5C9KA 2BVOB 1EO7A 1ZLWK 4POYA 1JPGA 4WFFD 1NDMA 3BP7A 3EKCA 3LEVL 1DEDA 2A0LD 1DZBA 4Y16B 3VH8A 2NY0D 5B38G 5IG7B 4Z0BL 1CL7L 1X5ZA 1GH7A 3VXSA 4ZOBA 2R2EB 3CZJA 5D70L 1P1ZB 2L7JA 4XMLH 3RUGA 3AM8C 1J05A 1HHGA 3NCMA 3WS3A 3DBXB 5HHVH 5FKPA 3QCTL 3INUL 4BH8A 3DSFL 3ZE1E 5F6IB 3QBTB 5BZWA 1R6VA 4LDEB 3WDJA 1AGEB 1NMAH 4OZHE 3OSKA 2FJGB 5C0AA 2DKSA 3Q3GB 2FD6H 4YHYB 3O6KL 4BK5A 1CFTA 4AQ1B 4LLVB 4NUJB 2G9HB 4UTBH 4BSVB 5I8KH 3WNKA 2Z35A 1S9XA 4GT7A 4OCRH 1HSBA 1AGFA 2VR5A 3NAAH 2B1HH 4P46D 3HE6C 4BH7B 4OZFB 1DLHB 2VXQL 2YK1L 1NMBH 4MD0A 3RX5A 1OAYH 1G1CA 5F3HB 3U4AA 5I1IH 5C0CB 3SE9L 3P4MA 1BZ9B 5C08A 12E8H 1WIUA 4YXKH 1JGLL 1P9MA 4NWUH 3KR3L 5TDPB 3MV7E 3RZCC 5I8EA 1KJ2A 1MJ8L 2WUBH 5CEZL 4G7VL 3RPKA 3S8WA 4QRTB 3RKDD 5K9OB 3BPOC 4KROC 4XNXL 4P9HL 4EI5C 1XCTA 1ONQA 4PJXE 3THMH 2VWEC 3VWJB 4OM1L