2PYGA

Azotobacter vinelandii mannuronan c-5 epimerase alge4 a-module
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
374
structure length
374
Chain Sequence
DYNVKDFGALGDGVSDDRASIQAAIDAAYAAGGGTVYLPAGEYRVSAAGEPGDGCLMLKDGVYLAGAGMGETVIKLIDGSDQKITGMVRSAYGEETSNFGMRDLTLDGNRDNTSGKVDGWFNGYIPGGDGADRDVTIERVEVREMSGYGFDPHEQTINLTIRDSVAHDNGLDGFVADYLVDSVFENNVAYANDRHGFNVVTSTHDFVMTNNVAYGNGSSGLVVQRGLEDLALPSNILIDGGAYYDNAREGVLLKMTSDITLQNADIHGNGSSGVRVYGAQDVQILDNQIHDNAQAAAVPEVLLQSFDDTAGASGTYYTTLNTRIEGNTISGSANSTYGIQERNDGTDYSSLIDNDIAGVQQPIQLYGPHSTVSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Poly(beta-D-mannuronate) C5 epimerase 4
publication title Structural and Mutational Characterization of the Catalytic A-module of the Mannuronan C-5-epimerase AlgE4 from Azotobacter vinelandii.
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Isomerase
total genus 169
structure length 374
sequence length 374
chains with identical sequence B
ec nomenclature ec 5.1.3.37: Mannuronan 5-epimerase.
pdb deposition date 2007-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12708 Pectate_lyase_3 Pectate lyase superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2pygA00
5C1CA 1O8EA 4Z05A 2PYHA 4XLCA 1RWRA 2X6XA 4XL9A 4YZXA 1PLUA 4XM3A 1BN8A 3B8YA 1O8DA 2VBKA 4OJ5A 1O8KA 2X3HA 2PYGA 2X85A 2NSPA 4NK8A 1O8HA 4XKVA 1IDKA 1O8IA 2QX3A 5C1EA 4YZ0A 4NK6A 3B90A 3FY3A 2Z8GA 2UVEA 3VSVA 4OJOA 4XLHA 2X6YA 2O1DA 1KCDA 3VMWA 1X0CA 1VBLA 1K5CA 1QCXA 4XKWA 1O8MA 2O0VA 3VMVA 1O88A 1GQ8A 3GQ8A 1WMRA 1DBOA 2O0WA 4XLAA 1AIRA 2QY1A 1JRGA 1IDJA 4MR0A 2PECA 4Z03A 1IB4A 4U49A 2NT6A 1O8JA 1H80A 3T9GA 3EQOA 4XNFA 4XONA 2NSTA 4YZAA 1O8GA 2BSPA 3UW0A 1EE6A 1O8LA 2VBMA 1OFLA 1PE9A 4XOPA 4HWVA 3ZPPA 1HG8A 1OGOX 4XN0A 1NHCA 2VJJA 3EQNA 2VBEA 1O8FA 4OZZA 4W8RA 4OZYA 2IQ7A 2UVFA 4W8QA 1OOCA 4XLFA 2EWEA 2NTPA 1OGMX 4Z06A 4W8TA 2QXZA 2X6WA 3SUCA 3VSUA 4XORA 4OJLA 1IA5A 4YEJA 3B4NA 1XG2A 2INVA 2NT9A 4AVZA 1JTAA 2NTQA 4U4BA 4XN3A 3GQ9A 3VSTA 4XOTA 1RU4A 4YELA 1DBGA 3JURA 4YZQA 4C2LA 1OFMA 2VJIA 4URRA 2INUA 3KRGA 2NZMA 2ODLA 4MXNA 1QJVA 1KTWA 4W8SA 4XLEA 1KCCA 3GQ7A 1PXZA 4XQFA 3WWGA 4XR6A 3GQAA 2O04A 4OJ6A 4OJPA 1RMGA 4PMHA 3ZSCA 4XMYA 1CZFA 1BHEA 4EW9A 2O17A 2NTBA 3GRHA 5AMVA 4I84A 3LMWA
chains in the Genus database with same CATH superfamily
5C1CA 1QA1A 1O8EA 2W7ZA 1WXRA 4Z05A 2PYHA 2XTXA 4XLCA 2BM4A 1RWRA 2J8KA 2X6XA 2J8IA 4XL9A 4YZXA 2QYUA 1PLUA 3SZEA 4XM3A 1BN8A 2QZAA 3B8YA 1QA2A 3N90A 4YFOA 1O8DA 2VBKA 4OJ5A 1O8KA 2X3HA 2PYGA 2XT2A 2X85A 1LLWA 2NSPA 3AK5A 1HF2A 2G0YA 4NK8A 1O8HA 4XKVA 1IDKA 1O8IA 2QX3A 5C1EA 4YZ0A 4NK6A 3B90A 3FY3A 3LJYA 1QRCA 2BM6A 2Z8GA 5AMVA 2BX6A 2UVEA 3VSVA 4OJOA 4XLHA 2X6YA 2O1DA 1KCDA 3SYJA 1TYWA 1K4ZA 4V02C 3VMWA 1X0CA 1VBLA 1K5CA 1QCXA 2VFPA 1QRBA 4XKWA 1LM1A 3TH0A 1O8MA 2O0VA 3VMVA 4YCQA 1O88A 1GQ8A 3GQ8A 1WMRA 2XT4A 1DBOA 2O0WA 1EZGA 1TYXA 4XLAA 4YDTA 1AIRA 2QY1A 1JRGA 1IDJA 4MR0A 2PECA 4Z03A 3RIQA 3SY2A 1IB4A 5JMCB 4U49A 2NT6A 2VFQA 1L1IA 1O8JA 4I84A 1LLZA 1H80A 3T9GA 2F3LA 3NAWA 2XTYA 3DU1X 3EQOA 4XNFA 4XONA 2NSTA 1TYVA 3P4GA 4YZAA 1O8GA 2BSPA 3NB2A 1EE6A 3UW0A 1O8LA 1OFLA 2VBMA 3SQVA 1PE9A 4XOPA 4YEIA 4HWVA 3ZPPA 1HG8A 1OGOX 4XN0A 3PSSA 2VJJA 3EQNA 1NHCA 2VBEA 4OPWA 1O8FA 4OZZA 1DABA 4W8RA 1K8FA 2XTWA 4OZYA 2IQ7A 2YUHA 2BM7A 2UVFA 2XC1A 4W8QA 2VFOA 3PETA 1OOCA 4XLFA 3BH7B 3PSZA 2EWEA 2NTPA 2V5IA 1TSPA 1OGMX 4Z06A 4W8TA 2QXZA 2X6WA 4OM9A 1CLWA 3SUCA 3VSUA 4XORA 4OJLA 1TYUA 3JX8A 1IA5A 4YEJA 3B4NA 1XG2A 2IOUG 2INVA 2NT9A 4AVZA 1EA0A 2VFMA 4YC5A 1JTAA 2NTQA 2BM5A 4U4BA 3GQ9A 4XN3A 3VSTA 1OFDA 4XOTA 1RU4A 3H09A 1QA3A 4YELA 1DBGA 2VFNA 3JURA 4YZQA 4KH3A 4C2LA 5JLVC 1OFMA 2VJIA 4URRA 2INUA 3KRGA 2NZMA 2ODLA 4MXNA 4JRAC 1QJVA 1KTWA 4W8SA 1QQ1A 4XLEA 1KCCA 3GQ7A 1PXZA 2O6WA 3WWGA 4XQFA 3BH6B 4XR6A 3GQAA 3N6ZA 2O04A 4OJ6A 4OJPA 1RMGA 4PMHA 3ZSCA 1OFEA 4XMYA 1CZFA 1BHEA 3LYCA 5DNSA 4EW9A 2O17A 1KQ5A 2B0RA 2NTBA 3GRHA 3ML3A 3LMWA
chains in the Genus database with same CATH topology
5C1CA 1O8EA 4Z05A 2PYHA 4XLCA 1RWRA 2X6XA 4XL9A 4YZXA 1PLUA 4XM3A 1BN8A 3B8YA 1O8DA 2VBKA 4OJ5A 1O8KA 2X3HA 2PYGA 2X85A 2NSPA 4NK8A 1O8HA 4XKVA 1IDKA 1O8IA 2QX3A 5C1EA 4YZ0A 4NK6A 3B90A 3FY3A 2Z8GA 2UVEA 3VSVA 4OJOA 4XLHA 2X6YA 2O1DA 1KCDA 3VMWA 1X0CA 1VBLA 1K5CA 1QCXA 4XKWA 1O8MA 2O0VA 3VMVA 1O88A 1GQ8A 3GQ8A 1WMRA 1DBOA 2O0WA 4XLAA 1AIRA 2QY1A 1JRGA 1IDJA 4MR0A 2PECA 4Z03A 1IB4A 4U49A 2NT6A 1O8JA 1H80A 3T9GA 3EQOA 4XNFA 4XONA 2NSTA 4YZAA 1O8GA 2BSPA 3UW0A 1EE6A 1O8LA 2VBMA 1OFLA 1PE9A 4XOPA 4HWVA 3ZPPA 1HG8A 1OGOX 4XN0A 1NHCA 2VJJA 3EQNA 2VBEA 1O8FA 4OZZA 4W8RA 4OZYA 2IQ7A 2UVFA 4W8QA 1OOCA 4XLFA 2EWEA 2NTPA 1OGMX 4Z06A 4W8TA 2QXZA 2X6WA 3SUCA 3VSUA 4XORA 4OJLA 1IA5A 4YEJA 3B4NA 1XG2A 2INVA 2NT9A 4AVZA 1JTAA 2NTQA 4U4BA 4XN3A 3GQ9A 3VSTA 4XOTA 1RU4A 4YELA 1DBGA 3JURA 4YZQA 4C2LA 1OFMA 2VJIA 4URRA 2INUA 3KRGA 2NZMA 2ODLA 4MXNA 1QJVA 1KTWA 4W8SA 4XLEA 1KCCA 3GQ7A 1PXZA 4XQFA 3WWGA 4XR6A 3GQAA 2O04A 4OJ6A 4OJPA 1RMGA 4PMHA 3ZSCA 4XMYA 1CZFA 1BHEA 4EW9A 2O17A 2NTBA 3GRHA 5AMVA 4I84A 3LMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C1C A;  1O8E A;  4Z05 A;  2PYH A;  4XLC A;  1RWR A;  2X6X A;  4XL9 A;  4YZX A;  1PLU A;  4XM3 A;  1BN8 A;  3B8Y A;  1O8D A;  2VBK A;  4OJ5 A;  1O8K A;  2X3H A;  2PYG A;  2X85 A;  2NSP A;  4NK8 A;  1O8H A;  4XKV A;  1IDK A;  1O8I A;  2QX3 A;  5C1E A;  4YZ0 A;  4NK6 A;  3B90 A;  3FY3 A;  2Z8G A;  2UVE A;  3VSV A;  4OJO A;  4XLH A;  2X6Y A;  2O1D A;  1KCD A;  3VMW A;  1X0C A;  1VBL A;  1K5C A;  1QCX A;  4XKW A;  1O8M A;  2O0V A;  3VMV A;  1O88 A;  1GQ8 A;  3GQ8 A;  1WMR A;  1DBO A;  2O0W A;  4XLA A;  1AIR A;  2QY1 A;  1JRG A;  1IDJ A;  4MR0 A;  2PEC A;  4Z03 A;  1IB4 A;  4U49 A;  2NT6 A;  1O8J A;  1H80 A;  3T9G A;  3EQO A;  4XNF A;  4XON A;  2NST A;  4YZA A;  1O8G A;  2BSP A;  3UW0 A;  1EE6 A;  1O8L A;  2VBM A;  1OFL A;  1PE9 A;  4XOP A;  4HWV A;  3ZPP A;  1HG8 A;  1OGO X;  4XN0 A;  1NHC A;  2VJJ A;  3EQN A;  2VBE A;  1O8F A;  4OZZ A;  4W8R A;  4OZY A;  2IQ7 A;  2UVF A;  4W8Q A;  1OOC A;  4XLF A;  2EWE A;  2NTP A;  1OGM X;  4Z06 A;  4W8T A;  2QXZ A;  2X6W A;  3SUC A;  3VSU A;  4XOR A;  4OJL A;  1IA5 A;  4YEJ A;  3B4N A;  1XG2 A;  2INV A;  2NT9 A;  4AVZ A;  1JTA A;  2NTQ A;  4U4B A;  4XN3 A;  3GQ9 A;  3VST A;  4XOT A;  1RU4 A;  4YEL A;  1DBG A;  3JUR A;  4YZQ A;  4C2L A;  1OFM A;  2VJI A;  4URR A;  2INU A;  3KRG A;  2NZM A;  2ODL A;  4MXN A;  1QJV A;  1KTW A;  4W8S A;  4XLE A;  1KCC A;  3GQ7 A;  1PXZ A;  4XQF A;  3WWG A;  4XR6 A;  3GQA A;  2O04 A;  4OJ6 A;  4OJP A;  1RMG A;  4PMH A;  3ZSC A;  4XMY A;  1CZF A;  1BHE A;  4EW9 A;  2O17 A;  2NTB A;  3GRH A;  5AMV A;  4I84 A;  3LMW A; 
#chains in the Genus database with same CATH topology
 5C1C A;  1QA1 A;  1O8E A;  2W7Z A;  1WXR A;  4Z05 A;  2PYH A;  2XTX A;  4XLC A;  2BM4 A;  1RWR A;  2J8K A;  2X6X A;  2J8I A;  4XL9 A;  4YZX A;  2QYU A;  1PLU A;  3SZE A;  4XM3 A;  1BN8 A;  2QZA A;  3B8Y A;  1QA2 A;  3N90 A;  4YFO A;  1O8D A;  2VBK A;  4OJ5 A;  1O8K A;  2X3H A;  2PYG A;  2XT2 A;  2X85 A;  1LLW A;  2NSP A;  3AK5 A;  1HF2 A;  2G0Y A;  4NK8 A;  1O8H A;  4XKV A;  1IDK A;  1O8I A;  2QX3 A;  5C1E A;  4YZ0 A;  4NK6 A;  3B90 A;  3FY3 A;  3LJY A;  1QRC A;  2BM6 A;  2Z8G A;  5AMV A;  2BX6 A;  2UVE A;  3VSV A;  4OJO A;  4XLH A;  2X6Y A;  2O1D A;  1KCD A;  3SYJ A;  1TYW A;  1K4Z A;  4V02 C;  3VMW A;  1X0C A;  1VBL A;  1K5C A;  1QCX A;  2VFP A;  1QRB A;  4XKW A;  1LM1 A;  3TH0 A;  1O8M A;  2O0V A;  3VMV A;  4YCQ A;  1O88 A;  1GQ8 A;  3GQ8 A;  1WMR A;  2XT4 A;  1DBO A;  2O0W A;  1EZG A;  1TYX A;  4XLA A;  4YDT A;  1AIR A;  2QY1 A;  1JRG A;  1IDJ A;  4MR0 A;  2PEC A;  4Z03 A;  3RIQ A;  3SY2 A;  1IB4 A;  5JMC B;  4U49 A;  2NT6 A;  2VFQ A;  1L1I A;  1O8J A;  4I84 A;  1LLZ A;  1H80 A;  3T9G A;  2F3L A;  3NAW A;  2XTY A;  3DU1 X;  3EQO A;  4XNF A;  4XON A;  2NST A;  1TYV A;  3P4G A;  4YZA A;  1O8G A;  2BSP A;  3NB2 A;  1EE6 A;  3UW0 A;  1O8L A;  1OFL A;  2VBM A;  3SQV A;  1PE9 A;  4XOP A;  4YEI A;  4HWV A;  3ZPP A;  1HG8 A;  1OGO X;  4XN0 A;  3PSS A;  2VJJ A;  3EQN A;  1NHC A;  2VBE A;  4OPW A;  1O8F A;  4OZZ A;  1DAB A;  4W8R A;  1K8F A;  2XTW A;  4OZY A;  2IQ7 A;  2YUH A;  2BM7 A;  2UVF A;  2XC1 A;  4W8Q A;  2VFO A;  3PET A;  1OOC A;  4XLF A;  3BH7 B;  3PSZ A;  2EWE A;  2NTP A;  2V5I A;  1TSP A;  1OGM X;  4Z06 A;  4W8T A;  2QXZ A;  2X6W A;  4OM9 A;  1CLW A;  3SUC A;  3VSU A;  4XOR A;  4OJL A;  1TYU A;  3JX8 A;  1IA5 A;  4YEJ A;  3B4N A;  1XG2 A;  2IOU G;  2INV A;  2NT9 A;  4AVZ A;  1EA0 A;  2VFM A;  4YC5 A;  1JTA A;  2NTQ A;  2BM5 A;  4U4B A;  3GQ9 A;  4XN3 A;  3VST A;  1OFD A;  4XOT A;  1RU4 A;  3H09 A;  1QA3 A;  4YEL A;  1DBG A;  2VFN A;  3JUR A;  4YZQ A;  4KH3 A;  4C2L A;  5JLV C;  1OFM A;  2VJI A;  4URR A;  2INU A;  3KRG A;  2NZM A;  2ODL A;  4MXN A;  4JRA C;  1QJV A;  1KTW A;  4W8S A;  1QQ1 A;  4XLE A;  1KCC A;  3GQ7 A;  1PXZ A;  2O6W A;  3WWG A;  4XQF A;  3BH6 B;  4XR6 A;  3GQA A;  3N6Z A;  2O04 A;  4OJ6 A;  4OJP A;  1RMG A;  4PMH A;  3ZSC A;  1OFE A;  4XMY A;  1CZF A;  1BHE A;  3LYC A;  5DNS A;  4EW9 A;  2O17 A;  1KQ5 A;  2B0R A;  2NTB A;  3GRH A;  3ML3 A;  3LMW A; 
#chains in the Genus database with same CATH homology
 5C1C A;  1O8E A;  4Z05 A;  2PYH A;  4XLC A;  1RWR A;  2X6X A;  4XL9 A;  4YZX A;  1PLU A;  4XM3 A;  1BN8 A;  3B8Y A;  1O8D A;  2VBK A;  4OJ5 A;  1O8K A;  2X3H A;  2PYG A;  2X85 A;  2NSP A;  4NK8 A;  1O8H A;  4XKV A;  1IDK A;  1O8I A;  2QX3 A;  5C1E A;  4YZ0 A;  4NK6 A;  3B90 A;  3FY3 A;  2Z8G A;  2UVE A;  3VSV A;  4OJO A;  4XLH A;  2X6Y A;  2O1D A;  1KCD A;  3VMW A;  1X0C A;  1VBL A;  1K5C A;  1QCX A;  4XKW A;  1O8M A;  2O0V A;  3VMV A;  1O88 A;  1GQ8 A;  3GQ8 A;  1WMR A;  1DBO A;  2O0W A;  4XLA A;  1AIR A;  2QY1 A;  1JRG A;  1IDJ A;  4MR0 A;  2PEC A;  4Z03 A;  1IB4 A;  4U49 A;  2NT6 A;  1O8J A;  1H80 A;  3T9G A;  3EQO A;  4XNF A;  4XON A;  2NST A;  4YZA A;  1O8G A;  2BSP A;  3UW0 A;  1EE6 A;  1O8L A;  2VBM A;  1OFL A;  1PE9 A;  4XOP A;  4HWV A;  3ZPP A;  1HG8 A;  1OGO X;  4XN0 A;  1NHC A;  2VJJ A;  3EQN A;  2VBE A;  1O8F A;  4OZZ A;  4W8R A;  4OZY A;  2IQ7 A;  2UVF A;  4W8Q A;  1OOC A;  4XLF A;  2EWE A;  2NTP A;  1OGM X;  4Z06 A;  4W8T A;  2QXZ A;  2X6W A;  3SUC A;  3VSU A;  4XOR A;  4OJL A;  1IA5 A;  4YEJ A;  3B4N A;  1XG2 A;  2INV A;  2NT9 A;  4AVZ A;  1JTA A;  2NTQ A;  4U4B A;  4XN3 A;  3GQ9 A;  3VST A;  4XOT A;  1RU4 A;  4YEL A;  1DBG A;  3JUR A;  4YZQ A;  4C2L A;  1OFM A;  2VJI A;  4URR A;  2INU A;  3KRG A;  2NZM A;  2ODL A;  4MXN A;  1QJV A;  1KTW A;  4W8S A;  4XLE A;  1KCC A;  3GQ7 A;  1PXZ A;  4XQF A;  3WWG A;  4XR6 A;  3GQA A;  2O04 A;  4OJ6 A;  4OJP A;  1RMG A;  4PMH A;  3ZSC A;  4XMY A;  1CZF A;  1BHE A;  4EW9 A;  2O17 A;  2NTB A;  3GRH A;  5AMV A;  4I84 A;  3LMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...