2PYOB

Drosophila nucleosome core
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
80
structure length
80
Chain Sequence
RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Drosophila nucleosome core particle highlights evolutionary constraints on the H2A-H2B histone dimer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords DNA (147-MER)
total genus 26
structure length 80
sequence length 80
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2pyoB00
2F8NA 3C1CB 3AV2B 5CPJA 2PYOB 5CPIB 1B67A 2AROC 5AVCD 5CP6D 3MGQC 3MGRB 3LJAA 4YS3B 5AV8D 5B2IC 1P3LA 3MGRD 3LZ1D 3C1BA 3UT9B 2NQBC 4XUJA 3AZMD 4J8UC 3AV2D 1ID3A 3A6NB 5BNXB 4Z2MG 3AZLD 3C1CD 1U35C 3UTAB 4Z5TB 3WKJD 3MGQD 3W97B 3WTPC 3MGPC 5JA4B 5AY8B 3REKD 1P3AA 1P3AC 1BFMA 5BS7C 2FJ7B 3B6GB 1P3PD 5F99A 5GT3C 4AWLC 1F66A 3REKB 4J8VD 1N1JB 1U35A 3AFAC 3RELD 3WA9B 3MGQB 4J8UA 4WU8C 2AROA 3AZLB 4HGAB 1ZLAA 5BO0A 5B40A 3LELC 3AV2C 5B2IA 1P3LC 1P3ID 3V9RB 4XZQA 1P3PC 1KU5A 1P3PB 3X1UD 2YFVA 3W96C 5B40C 5AV9C 3VH5A 2IO5C 2BYMB 5AV6D 1BH9A 4J8XA 5GT3D 3LELD 4WU8A 1F1EA 3WA9C 1P3KC 5B33D 5B0YD 1TAFA 3V9RA 4XZQB 5GT3B 3KUYD 5JRGD 3WTPD 1KX4D 3X1TD 3LZ1C 3AZFD 5AY8C 4ZBJC 3AZMC 5B31B 1M19C 4KUDD 3W99B 1P3MD 4YS3D 4H9RA 3LJAC 3O62C 2YFWA 4KGCD 1H3OB 4E44A 3MVDA 4JJND 3C1BC 1KX3C 3WAAA 5CPJC 3AN2C 3LZ1A 3B0CW 3KWQC 5C3IB 1P3OD 3UTBB 3LZ0A 3X1UC 3REJB 3AZED 5CPIC 4NE5A 1P3GC 1P3KA 4YM6A 4WU9D 5B40D 3C1BB 3MGSD 5GT0A 5E5AC 3REID 5B1MB 3WAAB 5B2JB 3LJAB 3MNNA 3AZKC 4EO5C 3KWQD 1P3BB 1HQ3D 2YFWB 3B6FB 3TU4B 3AZMB 4ZBJB 3LZ0B 3AV1D 1AOID 3W99D 4Z2MH 3AZEC 3UT9D 1JFIB 4LD9C 3B0CT 3LZ1B 3LELA 5AV8B 1TAFB 3KSYA 1TZYA 3VH6A 4J8VC 4G92C 5GSUA 5DNMC 1AOIB 3AZKD 3AFAA 3TU4D 3AZNB 4X23A 5CP6B 1F66C 3AZLA 3REHC 4R8PC 4Z66B 3KXBA 5BT1D 5CPJD 3KXBB 2PYOD 3WTPE 3MGPA 5DNNB 4KUDA 4WNNB 5B0ZC 5B2JC 5CP6A 5F99B 4WNNA 5E5AB 3REJD 5GSUB 2LY8A 4J8WC 1ZLAD 1P3GB 1P3IB 1BH9B 3KUYA 5B1LA 3NQUA 1EQZB 1F66B 3AZID 3AYWB 3B6FA 3MGQA 4H9SA 1KX3B 1P3PA 1F66D 4H9NB 1EQZD 4YM6D 4J8VB 5JA4A 4G92B 1M18A 3REKA 5AV6A 5B1MA 4J8XD 2F8NH 4KGCA 4ZUXC 3X1TB 3AZJD 5JRGB 5B2ID 3TU4C 4XZQD 2CWEA 4WU8D 3X1SB 3AV1C 5GXQD 1P3OA 2F8ND 2FJ7A 4CAYB 4Z66D 2NZDA 1Q9CA 5AV5B 4XUJB 2CV5C 5JRGA 5AVBC 3AZJC 3X1UB 2IO5B 5AV9B 4J8WB 4XUJC 5CPKC 5AV5C 3AZFB 1P34D 4J8UD 4CAYA 3UT9A 5DNNC 2AROD 3LZ0D 3C1CA 3AV1B 3X1SC 4CSRB 1S32C 1P3LB 3VH6T 5AVBD 3WKJC 3REIB 4R8PB 1P3IA 4NE3A 4H9PA 3AZHD 4H9PB 3X1TC 3X1TA 1P3AD 4WU8B 3MGSA 3AZNC 3AN2D 4DRAA 4E45A 4JJNA 5B32C 2HIOC 4AWLB 1HQ3A 5DNNA 5AV8C 1P3MA 1M1AA 4QLCC 3AYWA 1P3AB 1M18D 1KX5D 3MNND 2BYKA 5BNVB 4JJNB 3X1VA 1P34C 4Z5TC 1P3KD 3UTAC 1AOIA 3AZKB 1KX4A 4WU9A 3A6NA 3A6NC 4ZUXD 4J8UB 3W98C 5B0ZB 4KHAB 5AVCB 3AZGB 5B32D 3TU4A 4Z66C 3UTBC 4UUZA 3NQJA 2F8NK 3KWQB 3W97D 3KXBD 5CPJB 2PYOA 1TZYD 3AZGA 2F8NB 5FUGB 3REKC 3AZFA 3AZND 3REJA 5B0YC 5B33C 5GXQA 1M19B 3R45B 4LD9B 5B0ZD 1P3OB 5B24C 5DNMD 3W97C 4YS3A 5GT0D 4ZUXB 5CPKA 1P3BC 3AZHA 3B0DC 2NQBD 4G91B 3MVDD 3MNNB 2JSSA 3AZHC 3VH5T 5GT0B 1WWIA 3RELB 3W99A 3AZJA 2NQBB 3NQUB 1EQZA 4KUDB 2L5AA 1M19D 2CV5A 3B6GD 3REJC 3W96D 3MGRC 3UTBA 4LD9D 2FJ7D 5C3IC 3X1VD 3W96B 3AN2B 3AZGC 3KUYB 2BYKB 4NE6A 5AVCC 4X23D 2PYOC 5GSUC 4H9NA 3W98B 3O62B 4Z66A 3LELB 4HGAC 3W99C 3MGPD 5AV6C 4J8WD 5B1LB 1P34B 5AV9D 3AFAB 2YFVB 3W98A 1KX5A 1P3BA 4QLCB 1P3FD 2HUEB 3B6GC 5AV8A 1P3MC 4H9OB 5DNMB 3AFAD 3RELC 1AOIC 4CSRA 5GT0C 2HIOA 5B1LD 4QLCD 1P3FB 5G49B 3MGPB 5B32G 2RVQC 1P3KB 4XUJD 3WTPB 3B0DB 1M1AC 3LZ0C 5B2JA 5KDMB 4X23B 5B32A 1S32B 5B24D 3UT9C 3WAAC 1WWSA 3AZFC 1H3OA 5CPKB 5AV5A 3MVDC 4R8PD 4H9QA 3VH5W 1ULYA 3X1SA 5B31A 3UTAD 2AROB 1M19A 3AZMA 5AVBB 5AVBA 4WU9C 1KX4C 1KX5C 3MVDB 5FUGA 1P3GD 3REHD 2NZDC 5B31G 1M1AD 2FJ7C 5CPKD 5E5AD 1M18B 5JRGC 5CPID 5B31C 4Z5TA 1P34A 1B6WA 3VH6W 1R4VA 5G49A 4JJNC 4KHAA 5AVCA 4YM6C 4H9QB 3AZNA 3MGSC 2NZDD 1TZYB 1HQ3C 3A6ND 3WKJA 2HIOB 4XZQC 5B2IB 5B32B 1S32A 4KGCC 3AN2A 1EQZC 5B1LC 1ZLAC 3NQJB 5BT1C 1P3IC 3O62A 1KX3D 3AZGD 4H9SC 3AZIB 3AYWD 1N1JA 4WV4B 3C1CC 1U35D 3RELA 3LJAD 5GT3A 5F99C 3B6GA 3KUYC 1P3BD 5GXQC 5B33A 5B0YA 1KX5B 3C1BD 4WU9B 4R8PA 3WA9D 2CV5D 2BYMA 3AZLC 3X1VB 1JFIA 1ZLAB 3AZJB 5CP6C 4KUDC 5BNXA 5DNND 1ID3C 2CV5B 5F99D 1TZYC 3AZHB 5AY8D 2NQBA 5AV9A 2RVQD 3W96A 4X23C 1P3LD 4YM6B 3MGRA 3B0BA 3B6FC 4ZUXA 1U35B 3AV2A 1ID3D 5B31D 3UTAA 5B1MC 3R45A 4LD9A 1M18C 1ID3B 2HUEC 4J8WA 4QLCA 3AYWC 3AZKA 1KX4B 4YS3C 3W97A 1S32D 3X1UA 4H9RB 5B24A 2F8NG 4DRBA 5KDMA 3W98D 5BS7A 5AV6B 3KWQA 5GXQB 5AV5D 3WAAD 1BH8B 1KX3A 5CPIA 3WTPA 1HTAA 3X1SD 3AZIC 3UTBD 1P3FA 5B0ZA 4M6BA 4H9OA 5CHLB 5DNMA 3KXBC 3REHA 4UUZB 3REHB 4WZSB 1M1AB 4KGCB 4J8XB 1HQ3B 4NFTA 4J8VA 3AZIA 5B2JD 1P3FC 3B6FD 3O62D 3MGSB 1P3MB 3MNNC 1BH8A 4G91C 5AY8A 5B1MD 4J8XC 3X1VC 3AZEA 3AZEB 5BNVA 5B24B 5BO0B 5B40B 3REIC 3AV1A 4Z5TD 1P3OC 2HIOD 3WKJB 1P3GA 5GSUD 5B33B 1A7WA 5B0YB 4EO5B 3WA9A 3REIA 2NZDB 5E5AA
chains in the Genus database with same CATH superfamily
2F8NA 3C1CB 3AV2B 5CPJA 2XD5A 2PYOB 5CPIB 1B67A 2FFFB 2AROC 5AVCD 5CP6D 3MGQC 3MGRB 3LJAA 4YS3B 5AV8D 5B2IC 1P3LA 2BG1A 3LZ1D 3MGRD 3C1BA 3UT9B 2NQBC 4XUJA 2JCHA 3AZMD 4J8UC 3AV2D 1ID3A 3A6NB 5BNXB 4Z2MG 2Y2IA 3AZLD 3C1CD 1U35C 3UTAB 4Z5TB 3WKJD 3MGQD 3W97B 3WTPC 3MGPC 5JA4B 5AY8B 3REKD 1P3AA 1P3AC 1BFMA 5BS7C 2FJ7B 3B6GB 1P3PD 5F99A 5GT3C 4AWLC 1F66A 3REKB 4J8VD 1N1JB 1U35A 3AFAC 3RELD 3WA9B 3MGQB 4J8UA 4WU8C 2AROA 3AZLB 4HGAB 1ZLAA 5BO0A 5B40A 3LELC 3AV2C 5B2IA 1P3LC 1P3ID 3V9RB 4XZQA 1P3PC 1KU5A 1P3PB 3X1UD 2YFVA 3W96C 5B40C 5AV9C 3VH5A 2IO5C 2BYMB 5AV6D 1BH9A 4J8XA 5GT3D 3LELD 4WU8A 1F1EA 3WA9C 1P3KC 5B33D 5B0YD 1TAFA 3A1IA 3V9RA 4XZQB 5GT3B 1T3UA 3KUYD 5JRGD 3WTPD 1KX4D 3X1TD 3LZ1C 3AZFD 5AY8C 4ZBJC 3AZMC 5B31B 1M19C 2G5IC 4KUDD 3F6TA 3W99B 1P3MD 4YS3D 4H9RA 3LJAC 3O62C 2YFWA 4KGCD 1H3OB 4E44A 3MVDA 4JJND 3C1BC 2Y2NA 1KX3C 3WAAA 5CPJC 3AN2C 3EPHA 3LZ1A 3B0CW 2Y2OA 3KWQC 5C3IB 1P3OD 3UTBB 2DQNC 3LZ0A 3X1UC 3REJB 3AZED 5CPIC 4NE5A 3IP4C 1P3GC 1P3KA 4YM6A 4WU9D 5B40D 3C1BB 3MGSD 5GT0A 5E5AC 3REID 5B1MB 3WAAB 5B2JB 3LJAB 3MNNA 3AZKC 4EO5C 3KWQD 1P3BB 1HQ3D 2YFWB 3B6FB 3TU4B 3AZMB 4ZBJB 3LZ0B 3AV1D 1AOID 3W99D 4Z2MH 3AZEC 2ZY4A 3UT9D 1JFIB 4LD9C 3B0CT 3LZ1B 2XD1A 2W8SA 3LELA 5AV8B 1TAFB 3KSYA 1TZYA 3VH6A 4J8VC 4G92C 5GSUA 5DNMC 1AOIB 3AZKD 3AFAA 2VQRA 3TU4D 3AZNB 4X23A 5CP6B 1F66C 3AZLA 3REHC 4R8PC 4Z66B 3KXBA 5BT1D 5CPJD 3KXBB 2PYOD 3WTPE 3MGPA 5DNNB 4KUDA 4WNNB 5B0ZC 5B2JC 5CP6A 5F99B 4WNNA 5E5AB 2Y2KA 3REJD 5GSUB 2LY8A 4J8WC 1ZLAD 1P3GB 1P3IB 2Y2JA 1BH9B 3KUYA 5B1LA 3NQUA 1EQZB 1F66B 3AZID 3AYWB 3B6FA 3MGQA 4H9SA 1KX3B 1P3PA 1F66D 2G5HC 4H9NB 4YM6D 4J8VB 5JA4A 4G92B 1M18A 1EQZD 3REKA 5AV6A 5B1MA 4J8XD 2F8NH 4KGCA 2ZY3A 3KFUG 4ZUXC 3X1TB 3AZJD 5JRGB 5B2ID 3TU4C 4XZQD 2CWEA 4WU8D 3X1SB 3AV1C 5GXQD 1P3OA 2F8ND 2FJ7A 4CAYB 4Z66D 2NZDA 1Q9CA 5AV5B 4XUJB 2CV5C 5JRGA 2JE5A 5AVBC 3AZJC 3X1UB 2IO5B 5AV9B 4J8WB 4XUJC 5CPKC 5AV5C 3AZFB 1P34D 4J8UD 4CAYA 3UT9A 5DNNC 2AROD 3LZ0D 3C1CA 3AV1B 3X1SC 4CSRB 1S32C 1P3LB 3VH6T 5AVBD 3WKJC 3REIB 4R8PB 1P3IA 2Y2GA 4H9PA 4NE3A 4H9PB 3AZHD 3X1TC 3X1TA 1P3AD 4WU8B 3MGSA 3AZNC 3AN2D 4DRAA 4E45A 4JJNA 5B32C 3EPLA 2HIOC 4AWLB 1HQ3A 5DNNA 5AV8C 1P3MA 1M1AA 4UPKA 4QLCC 3AYWA 1P3AB 2RIQA 1M18D 1KX5D 3MNND 2BYKA 5BNVB 4JJNB 3X1VA 1P34C 4Z5TC 1P3KD 3UTAC 1AOIA 3AZKB 1KX4A 4WU9A 3A6NA 3A6NC 4ZUXD 4J8UB 3W98C 5B0ZB 4KHAB 5AVCB 3AZGB 5B32D 3TU4A 4Z66C 3UTBC 4UUZA 3NQJA 2ZM5A 2F8NK 3KWQB 3W97D 3AL0C 3KXBD 5CPJB 2PYOA 1TZYD 3AZGA 2F8NB 5FUGB 3REKC 3AZFA 3AZND 3REJA 4DQYB 5B0YC 5B33C 5GXQA 1M19B 3R45B 4LD9B 5B0ZD 1P3OB 2DF4C 5B24C 5DNMD 3W97C 4YS3A 5GT0D 4ZUXB 5CPKA 1P3BC 3AZHA 3B0DC 2NQBD 4G91B 3MVDD 3MNNB 2JSSA 3AZHC 3VH5T 5GT0B 1WWIA 3RELB 3W99A 3AZJA 2NQBB 3NQUB 1EQZA 4KUDB 2L5AA 1M19D 2CV5A 3B6GD 3REJC 3W96D 3MGRC 3UTBA 4LD9D 2ZY2A 2FJ7D 5C3IC 3X1VD 3W96B 3AN2B 3AZGC 3KUYB 2F2AC 2BYKB 4NE6A 5AVCC 4X23D 2PYOC 2Y2LA 5GSUC 4H9NA 3W98B 3O62B 4WJ3C 4Z66A 3LELB 3H0LC 4HGAC 3W99C 3MGPD 5AV6C 4J8WD 5B1LB 1P34B 5AV9D 3AFAB 2YFVB 3W98A 1KX5A 1P3BA 4QLCB 1P3FD 2HUEB 3FDDA 3B6GC 5AV8A 1P3MC 4H9OB 5DNMB 3AFAD 3RELC 1AOIC 4CSRA 5GT0C 2HIOA 5B1LD 4QLCD 1P3FB 5G49B 3MGPB 5B32G 2RVQC 1P3KB 4XUJD 3WTPB 3B0DB 1M1AC 3LZ0C 3EG5B 5B2JA 5KDMB 4X23B 5B32A 1S32B 5B24D 3UT9C 2Y2PA 3WAAC 1WWSA 3AZFC 1H3OA 5CPKB 5AV5A 3MVDC 3EPJA 4R8PD 4H9QA 3VH5W 1ULYA 3X1SA 5B31A 3UTAD 2AROB 1M19A 3AZMA 5AVBB 5AVBA 4WU9C 1KX4C 1KX5C 3MVDB 5FUGA 1P3GD 3REHD 2UWXA 2NZDC 5B31G 1M1AD 2FJ7C 5CPKD 5E5AD 1M18B 2Y2HA 5JRGC 5CPID 5B31C 4Z5TA 1P34A 1B6WA 3VH6W 1R4VA 5G49A 4JJNC 4KHAA 5AVCA 4YM6C 4H9QB 2Y2QA 3AZNA 3MGSC 2NZDD 1TZYB 1HQ3C 3H0MC 3A6ND 3WKJA 2HIOB 4XZQC 5B2IB 5B32B 1S32A 4KGCC 3AN2A 1EQZC 5B1LC 1ZLAC 3NQJB 5BT1C 1P3IC 3O62A 1KX3D 3AZGD 4H9SC 3AZIB 3AYWD 1N1JA 4WV4B 3C1CC 1U35D 3RELA 3LJAD 5GT3A 5F99C 3B6GA 3KUYC 1P3BD 5GXQC 5B33A 5B0YA 1KX5B 3C1BD 4WU9B 1Z2CB 4R8PA 3WA9D 2CV5D 2BYMA 3AZLC 3X1VB 1JFIA 1ZLAB 3AZJB 5CP6C 4KUDC 5BNXA 5DNND 1ID3C 2CV5B 5F99D 1TZYC 3AZHB 5AY8D 2NQBA 5AV9A 2RVQD 3W96A 4X23C 1P3LD 4YM6B 3MGRA 1PZRA 3B0BA 3B6FC 4ZUXA 1W2EA 1U35B 3AV2A 1ID3D 5B31D 3UTAA 5B1MC 3EPKA 3R45A 4LD9A 1M18C 1ID3B 3H0RC 2HUEC 3P5JB 4QLCA 4J8WA 3AYWC 3AZKA 1KX4B 4YS3C 3W97A 1S32D 3X1UA 4H9RB 5B24A 2F8NG 4DRBA 5KDMA 3W98D 5BS7A 5AV6B 3KWQA 5GXQB 5AV5D 3WAAD 1BH8B 1KX3A 5CPIA 3WTPA 2ZY5A 1HTAA 3X1SD 3AZIC 3UTBD 1P3FA 5B0ZA 4M6BA 4H9OA 5CHLB 5DNMA 2J8PA 3KXBC 3REHA 4UUZB 3REHB 4WZSB 1M1AB 4KGCB 4J8XB 1HQ3B 4NFTA 4J8VA 3AZIA 5B2JD 1P3FC 3B6FD 3O62D 3MGSB 1P3MB 3MNNC 1BH8A 3A1KA 4G91C 5AY8A 5B1MD 4J8XC 2Y2MA 3X1VC 3AZEA 3AZEB 5BNVA 5B24B 5BO0B 5B40B 3REIC 3AV1A 4Z5TD 1P3OC 2HIOD 3WKJB 1P3GA 5GSUD 5B33B 1A7WA 5B0YB 4EO5B 3WA9A 3REIA 2NZDB 5E5AA
chains in the Genus database with same CATH topology
2F8NA 3C1CB 3AV2B 5CPJA 2XD5A 2PYOB 5CPIB 1B67A 2FFFB 2AROC 5AVCD 5CP6D 3MGQC 3MGRB 3LJAA 4YS3B 5AV8D 5B2IC 1P3LA 2BG1A 3LZ1D 3MGRD 3C1BA 3UT9B 2NQBC 4XUJA 2JCHA 3AZMD 4J8UC 3AV2D 1ID3A 3A6NB 5BNXB 4Z2MG 2Y2IA 3AZLD 3C1CD 1U35C 3UTAB 4Z5TB 3WKJD 3MGQD 3W97B 3WTPC 3MGPC 5JA4B 5AY8B 3REKD 1P3AA 1P3AC 1BFMA 5BS7C 2FJ7B 3B6GB 1P3PD 5F99A 5GT3C 4AWLC 1F66A 3REKB 4J8VD 1N1JB 1U35A 3AFAC 3RELD 3WA9B 3MGQB 4J8UA 4WU8C 2AROA 3AZLB 4HGAB 1ZLAA 5BO0A 5B40A 3LELC 3AV2C 5B2IA 1P3LC 1P3ID 3V9RB 4XZQA 1P3PC 1KU5A 1P3PB 3X1UD 2YFVA 3W96C 5B40C 5AV9C 3VH5A 2IO5C 2BYMB 5AV6D 1BH9A 4J8XA 5GT3D 3LELD 4WU8A 1F1EA 3WA9C 1P3KC 5B33D 5B0YD 1TAFA 3A1IA 3V9RA 4XZQB 5GT3B 1T3UA 3KUYD 5JRGD 3WTPD 1KX4D 3X1TD 3LZ1C 3AZFD 5AY8C 4ZBJC 3AZMC 5B31B 1M19C 2G5IC 4KUDD 3F6TA 3W99B 1P3MD 4YS3D 4H9RA 3LJAC 3O62C 2YFWA 4KGCD 1H3OB 4E44A 3MVDA 4JJND 3C1BC 2Y2NA 1KX3C 3WAAA 5CPJC 3AN2C 3EPHA 3LZ1A 3B0CW 2Y2OA 3KWQC 5C3IB 1P3OD 3UTBB 2DQNC 3LZ0A 3X1UC 3REJB 3AZED 5CPIC 4NE5A 3IP4C 1P3GC 1P3KA 4YM6A 4WU9D 5B40D 3C1BB 3MGSD 5GT0A 5E5AC 3REID 5B1MB 3WAAB 5B2JB 3LJAB 3MNNA 3AZKC 4EO5C 3KWQD 1P3BB 1HQ3D 2YFWB 3B6FB 3TU4B 3AZMB 4ZBJB 3LZ0B 3AV1D 1AOID 3W99D 4Z2MH 3AZEC 2ZY4A 3UT9D 1JFIB 4LD9C 3B0CT 3LZ1B 2XD1A 2W8SA 3LELA 5AV8B 1TAFB 3KSYA 1TZYA 3VH6A 4J8VC 4G92C 5GSUA 5DNMC 1AOIB 3AZKD 3AFAA 2VQRA 3TU4D 3AZNB 4X23A 5CP6B 1F66C 3AZLA 3REHC 4R8PC 4Z66B 3KXBA 5BT1D 5CPJD 3KXBB 2PYOD 3WTPE 3MGPA 5DNNB 4KUDA 4WNNB 5B0ZC 5B2JC 5CP6A 5F99B 4WNNA 5E5AB 2Y2KA 3REJD 5GSUB 2LY8A 4J8WC 1ZLAD 1P3GB 1P3IB 2Y2JA 1BH9B 3KUYA 5B1LA 3NQUA 1EQZB 1F66B 3AZID 3AYWB 3B6FA 3MGQA 4H9SA 1KX3B 1P3PA 1F66D 2G5HC 4H9NB 4YM6D 4J8VB 5JA4A 4G92B 1M18A 1EQZD 3REKA 5AV6A 5B1MA 4J8XD 2F8NH 4KGCA 2ZY3A 3KFUG 4ZUXC 3X1TB 3AZJD 5JRGB 5B2ID 3TU4C 4XZQD 2CWEA 4WU8D 3X1SB 3AV1C 5GXQD 1P3OA 2F8ND 2FJ7A 4CAYB 4Z66D 2NZDA 1Q9CA 5AV5B 4XUJB 2CV5C 5JRGA 2JE5A 5AVBC 3AZJC 3X1UB 2IO5B 5AV9B 4J8WB 4XUJC 5CPKC 5AV5C 3AZFB 1P34D 4J8UD 4CAYA 3UT9A 5DNNC 2AROD 3LZ0D 3C1CA 3AV1B 3X1SC 4CSRB 1S32C 1P3LB 3VH6T 5AVBD 3WKJC 3REIB 4R8PB 1P3IA 2Y2GA 4H9PA 4NE3A 4H9PB 3AZHD 3X1TC 3X1TA 1P3AD 4WU8B 3MGSA 3AZNC 3AN2D 4DRAA 4E45A 4JJNA 5B32C 3EPLA 2HIOC 4AWLB 1HQ3A 5DNNA 5AV8C 1P3MA 1M1AA 4UPKA 4QLCC 3AYWA 1P3AB 2RIQA 1M18D 1KX5D 3MNND 2BYKA 5BNVB 4JJNB 3X1VA 1P34C 4Z5TC 1P3KD 3UTAC 1AOIA 3AZKB 1KX4A 4WU9A 3A6NA 3A6NC 4ZUXD 4J8UB 3W98C 5B0ZB 4KHAB 5AVCB 3AZGB 5B32D 3TU4A 4Z66C 3UTBC 4UUZA 3NQJA 2ZM5A 2F8NK 3KWQB 3W97D 3AL0C 3KXBD 5CPJB 2PYOA 1TZYD 3AZGA 2F8NB 5FUGB 3REKC 3AZFA 3AZND 3REJA 4DQYB 5B0YC 5B33C 5GXQA 1M19B 3R45B 4LD9B 5B0ZD 1P3OB 2DF4C 5B24C 5DNMD 3W97C 4YS3A 5GT0D 4ZUXB 5CPKA 1P3BC 3AZHA 3B0DC 2NQBD 4G91B 3MVDD 3MNNB 2JSSA 3AZHC 3VH5T 5GT0B 1WWIA 3RELB 3W99A 3AZJA 2NQBB 3NQUB 1EQZA 4KUDB 2L5AA 1M19D 2CV5A 3B6GD 3REJC 3W96D 3MGRC 3UTBA 4LD9D 2ZY2A 2FJ7D 5C3IC 3X1VD 3W96B 3AN2B 3AZGC 3KUYB 2F2AC 2BYKB 4NE6A 5AVCC 4X23D 2PYOC 2Y2LA 5GSUC 4H9NA 3W98B 3O62B 4WJ3C 4Z66A 3LELB 3H0LC 4HGAC 3W99C 3MGPD 5AV6C 4J8WD 5B1LB 1P34B 5AV9D 3AFAB 2YFVB 3W98A 1KX5A 1P3BA 4QLCB 1P3FD 2HUEB 3FDDA 3B6GC 5AV8A 1P3MC 4H9OB 5DNMB 3AFAD 3RELC 1AOIC 4CSRA 5GT0C 2HIOA 5B1LD 4QLCD 1P3FB 5G49B 3MGPB 5B32G 2RVQC 1P3KB 4XUJD 3WTPB 3B0DB 1M1AC 3LZ0C 3EG5B 5B2JA 5KDMB 4X23B 5B32A 1S32B 5B24D 3UT9C 2Y2PA 3WAAC 1WWSA 3AZFC 1H3OA 5CPKB 5AV5A 3MVDC 3EPJA 4R8PD 4H9QA 3VH5W 1ULYA 3X1SA 5B31A 3UTAD 2AROB 1M19A 3AZMA 5AVBB 5AVBA 4WU9C 1KX4C 1KX5C 3MVDB 5FUGA 1P3GD 3REHD 2UWXA 2NZDC 5B31G 1M1AD 2FJ7C 5CPKD 5E5AD 1M18B 2Y2HA 5JRGC 5CPID 5B31C 4Z5TA 1P34A 1B6WA 3VH6W 1R4VA 5G49A 4JJNC 4KHAA 5AVCA 4YM6C 4H9QB 2Y2QA 3AZNA 3MGSC 2NZDD 1TZYB 1HQ3C 3H0MC 3A6ND 3WKJA 2HIOB 4XZQC 5B2IB 5B32B 1S32A 4KGCC 3AN2A 1EQZC 5B1LC 1ZLAC 3NQJB 5BT1C 1P3IC 3O62A 1KX3D 3AZGD 4H9SC 3AZIB 3AYWD 1N1JA 4WV4B 3C1CC 1U35D 3RELA 3LJAD 5GT3A 5F99C 3B6GA 3KUYC 1P3BD 5GXQC 5B33A 5B0YA 1KX5B 3C1BD 4WU9B 1Z2CB 4R8PA 3WA9D 2CV5D 2BYMA 3AZLC 3X1VB 1JFIA 1ZLAB 3AZJB 5CP6C 4KUDC 5BNXA 5DNND 1ID3C 2CV5B 5F99D 1TZYC 3AZHB 5AY8D 2NQBA 5AV9A 2RVQD 3W96A 4X23C 1P3LD 4YM6B 3MGRA 1PZRA 3B0BA 3B6FC 4ZUXA 1W2EA 1U35B 3AV2A 1ID3D 5B31D 3UTAA 5B1MC 3EPKA 3R45A 4LD9A 1M18C 1ID3B 3H0RC 2HUEC 3P5JB 4QLCA 4J8WA 3AYWC 3AZKA 1KX4B 4YS3C 3W97A 1S32D 3X1UA 4H9RB 5B24A 2F8NG 4DRBA 5KDMA 3W98D 5BS7A 5AV6B 3KWQA 5GXQB 5AV5D 3WAAD 1BH8B 1KX3A 5CPIA 3WTPA 2ZY5A 1HTAA 3X1SD 3AZIC 3UTBD 1P3FA 5B0ZA 4M6BA 4H9OA 5CHLB 5DNMA 2J8PA 3KXBC 3REHA 4UUZB 3REHB 4WZSB 1M1AB 4KGCB 4J8XB 1HQ3B 4NFTA 4J8VA 3AZIA 5B2JD 1P3FC 3B6FD 3O62D 3MGSB 1P3MB 3MNNC 1BH8A 3A1KA 4G91C 5AY8A 5B1MD 4J8XC 2Y2MA 3X1VC 3AZEA 3AZEB 5BNVA 5B24B 5BO0B 5B40B 3REIC 3AV1A 4Z5TD 1P3OC 2HIOD 3WKJB 1P3GA 5GSUD 5B33B 1A7WA 5B0YB 4EO5B 3WA9A 3REIA 2NZDB 5E5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F8N A;  3C1C B;  3AV2 B;  5CPJ A;  2PYO B;  5CPI B;  1B67 A;  2ARO C;  5AVC D;  5CP6 D;  3MGQ C;  3MGR B;  3LJA A;  4YS3 B;  5AV8 D;  5B2I C;  1P3L A;  3MGR D;  3LZ1 D;  3C1B A;  3UT9 B;  2NQB C;  4XUJ A;  3AZM D;  4J8U C;  3AV2 D;  1ID3 A;  3A6N B;  5BNX B;  4Z2M G;  3AZL D;  3C1C D;  1U35 C;  3UTA B;  4Z5T B;  3WKJ D;  3MGQ D;  3W97 B;  3WTP C;  3MGP C;  5JA4 B;  5AY8 B;  3REK D;  1P3A A;  1P3A C;  1BFM A;  5BS7 C;  2FJ7 B;  3B6G B;  1P3P D;  5F99 A;  5GT3 C;  4AWL C;  1F66 A;  3REK B;  4J8V D;  1N1J B;  1U35 A;  3AFA C;  3REL D;  3WA9 B;  3MGQ B;  4J8U A;  4WU8 C;  2ARO A;  3AZL B;  4HGA B;  1ZLA A;  5BO0 A;  5B40 A;  3LEL C;  3AV2 C;  5B2I A;  1P3L C;  1P3I D;  3V9R B;  4XZQ A;  1P3P C;  1KU5 A;  1P3P B;  3X1U D;  2YFV A;  3W96 C;  5B40 C;  5AV9 C;  3VH5 A;  2IO5 C;  2BYM B;  5AV6 D;  1BH9 A;  4J8X A;  5GT3 D;  3LEL D;  4WU8 A;  1F1E A;  3WA9 C;  1P3K C;  5B33 D;  5B0Y D;  1TAF A;  3V9R A;  4XZQ B;  5GT3 B;  3KUY D;  5JRG D;  3WTP D;  1KX4 D;  3X1T D;  3LZ1 C;  3AZF D;  5AY8 C;  4ZBJ C;  3AZM C;  5B31 B;  1M19 C;  4KUD D;  3W99 B;  1P3M D;  4YS3 D;  4H9R A;  3LJA C;  3O62 C;  2YFW A;  4KGC D;  1H3O B;  4E44 A;  3MVD A;  4JJN D;  3C1B C;  1KX3 C;  3WAA A;  5CPJ C;  3AN2 C;  3LZ1 A;  3B0C W;  3KWQ C;  5C3I B;  1P3O D;  3UTB B;  3LZ0 A;  3X1U C;  3REJ B;  3AZE D;  5CPI C;  4NE5 A;  1P3G C;  1P3K A;  4YM6 A;  4WU9 D;  5B40 D;  3C1B B;  3MGS D;  5GT0 A;  5E5A C;  3REI D;  5B1M B;  3WAA B;  5B2J B;  3LJA B;  3MNN A;  3AZK C;  4EO5 C;  3KWQ D;  1P3B B;  1HQ3 D;  2YFW B;  3B6F B;  3TU4 B;  3AZM B;  4ZBJ B;  3LZ0 B;  3AV1 D;  1AOI D;  3W99 D;  4Z2M H;  3AZE C;  3UT9 D;  1JFI B;  4LD9 C;  3B0C T;  3LZ1 B;  3LEL A;  5AV8 B;  1TAF B;  3KSY A;  1TZY A;  3VH6 A;  4J8V C;  4G92 C;  5GSU A;  5DNM C;  1AOI B;  3AZK D;  3AFA A;  3TU4 D;  3AZN B;  4X23 A;  5CP6 B;  1F66 C;  3AZL A;  3REH C;  4R8P C;  4Z66 B;  3KXB A;  5BT1 D;  5CPJ D;  3KXB B;  2PYO D;  3WTP E;  3MGP A;  5DNN B;  4KUD A;  4WNN B;  5B0Z C;  5B2J C;  5CP6 A;  5F99 B;  4WNN A;  5E5A B;  3REJ D;  5GSU B;  2LY8 A;  4J8W C;  1ZLA D;  1P3G B;  1P3I B;  1BH9 B;  3KUY A;  5B1L A;  3NQU A;  1EQZ B;  1F66 B;  3AZI D;  3AYW B;  3B6F A;  3MGQ A;  4H9S A;  1KX3 B;  1P3P A;  1F66 D;  4H9N B;  1EQZ D;  4YM6 D;  4J8V B;  5JA4 A;  4G92 B;  1M18 A;  3REK A;  5AV6 A;  5B1M A;  4J8X D;  2F8N H;  4KGC A;  4ZUX C;  3X1T B;  3AZJ D;  5JRG B;  5B2I D;  3TU4 C;  4XZQ D;  2CWE A;  4WU8 D;  3X1S B;  3AV1 C;  5GXQ D;  1P3O A;  2F8N D;  2FJ7 A;  4CAY B;  4Z66 D;  2NZD A;  1Q9C A;  5AV5 B;  4XUJ B;  2CV5 C;  5JRG A;  5AVB C;  3AZJ C;  3X1U B;  2IO5 B;  5AV9 B;  4J8W B;  4XUJ C;  5CPK C;  5AV5 C;  3AZF B;  1P34 D;  4J8U D;  4CAY A;  3UT9 A;  5DNN C;  2ARO D;  3LZ0 D;  3C1C A;  3AV1 B;  3X1S C;  4CSR B;  1S32 C;  1P3L B;  3VH6 T;  5AVB D;  3WKJ C;  3REI B;  4R8P B;  1P3I A;  4NE3 A;  4H9P A;  3AZH D;  4H9P B;  3X1T C;  3X1T A;  1P3A D;  4WU8 B;  3MGS A;  3AZN C;  3AN2 D;  4DRA A;  4E45 A;  4JJN A;  5B32 C;  2HIO C;  4AWL B;  1HQ3 A;  5DNN A;  5AV8 C;  1P3M A;  1M1A A;  4QLC C;  3AYW A;  1P3A B;  1M18 D;  1KX5 D;  3MNN D;  2BYK A;  5BNV B;  4JJN B;  3X1V A;  1P34 C;  4Z5T C;  1P3K D;  3UTA C;  1AOI A;  3AZK B;  1KX4 A;  4WU9 A;  3A6N A;  3A6N C;  4ZUX D;  4J8U B;  3W98 C;  5B0Z B;  4KHA B;  5AVC B;  3AZG B;  5B32 D;  3TU4 A;  4Z66 C;  3UTB C;  4UUZ A;  3NQJ A;  2F8N K;  3KWQ B;  3W97 D;  3KXB D;  5CPJ B;  2PYO A;  1TZY D;  3AZG A;  2F8N B;  5FUG B;  3REK C;  3AZF A;  3AZN D;  3REJ A;  5B0Y C;  5B33 C;  5GXQ A;  1M19 B;  3R45 B;  4LD9 B;  5B0Z D;  1P3O B;  5B24 C;  5DNM D;  3W97 C;  4YS3 A;  5GT0 D;  4ZUX B;  5CPK A;  1P3B C;  3AZH A;  3B0D C;  2NQB D;  4G91 B;  3MVD D;  3MNN B;  2JSS A;  3AZH C;  3VH5 T;  5GT0 B;  1WWI A;  3REL B;  3W99 A;  3AZJ A;  2NQB B;  3NQU B;  1EQZ A;  4KUD B;  2L5A A;  1M19 D;  2CV5 A;  3B6G D;  3REJ C;  3W96 D;  3MGR C;  3UTB A;  4LD9 D;  2FJ7 D;  5C3I C;  3X1V D;  3W96 B;  3AN2 B;  3AZG C;  3KUY B;  2BYK B;  4NE6 A;  5AVC C;  4X23 D;  2PYO C;  5GSU C;  4H9N A;  3W98 B;  3O62 B;  4Z66 A;  3LEL B;  4HGA C;  3W99 C;  3MGP D;  5AV6 C;  4J8W D;  5B1L B;  1P34 B;  5AV9 D;  3AFA B;  2YFV B;  3W98 A;  1KX5 A;  1P3B A;  4QLC B;  1P3F D;  2HUE B;  3B6G C;  5AV8 A;  1P3M C;  4H9O B;  5DNM B;  3AFA D;  3REL C;  1AOI C;  4CSR A;  5GT0 C;  2HIO A;  5B1L D;  4QLC D;  1P3F B;  5G49 B;  3MGP B;  5B32 G;  2RVQ C;  1P3K B;  4XUJ D;  3WTP B;  3B0D B;  1M1A C;  3LZ0 C;  5B2J A;  5KDM B;  4X23 B;  5B32 A;  1S32 B;  5B24 D;  3UT9 C;  3WAA C;  1WWS A;  3AZF C;  1H3O A;  5CPK B;  5AV5 A;  3MVD C;  4R8P D;  4H9Q A;  3VH5 W;  1ULY A;  3X1S A;  5B31 A;  3UTA D;  2ARO B;  1M19 A;  3AZM A;  5AVB B;  5AVB A;  4WU9 C;  1KX4 C;  1KX5 C;  3MVD B;  5FUG A;  1P3G D;  3REH D;  2NZD C;  5B31 G;  1M1A D;  2FJ7 C;  5CPK D;  5E5A D;  1M18 B;  5JRG C;  5CPI D;  5B31 C;  4Z5T A;  1P34 A;  1B6W A;  3VH6 W;  1R4V A;  5G49 A;  4JJN C;  4KHA A;  5AVC A;  4YM6 C;  4H9Q B;  3AZN A;  3MGS C;  2NZD D;  1TZY B;  1HQ3 C;  3A6N D;  3WKJ A;  2HIO B;  4XZQ C;  5B2I B;  5B32 B;  1S32 A;  4KGC C;  3AN2 A;  1EQZ C;  5B1L C;  1ZLA C;  3NQJ B;  5BT1 C;  1P3I C;  3O62 A;  1KX3 D;  3AZG D;  4H9S C;  3AZI B;  3AYW D;  1N1J A;  4WV4 B;  3C1C C;  1U35 D;  3REL A;  3LJA D;  5GT3 A;  5F99 C;  3B6G A;  3KUY C;  1P3B D;  5GXQ C;  5B33 A;  5B0Y A;  1KX5 B;  3C1B D;  4WU9 B;  4R8P A;  3WA9 D;  2CV5 D;  2BYM A;  3AZL C;  3X1V B;  1JFI A;  1ZLA B;  3AZJ B;  5CP6 C;  4KUD C;  5BNX A;  5DNN D;  1ID3 C;  2CV5 B;  5F99 D;  1TZY C;  3AZH B;  5AY8 D;  2NQB A;  5AV9 A;  2RVQ D;  3W96 A;  4X23 C;  1P3L D;  4YM6 B;  3MGR A;  3B0B A;  3B6F C;  4ZUX A;  1U35 B;  3AV2 A;  1ID3 D;  5B31 D;  3UTA A;  5B1M C;  3R45 A;  4LD9 A;  1M18 C;  1ID3 B;  2HUE C;  4J8W A;  4QLC A;  3AYW C;  3AZK A;  1KX4 B;  4YS3 C;  3W97 A;  1S32 D;  3X1U A;  4H9R B;  5B24 A;  2F8N G;  4DRB A;  5KDM A;  3W98 D;  5BS7 A;  5AV6 B;  3KWQ A;  5GXQ B;  5AV5 D;  3WAA D;  1BH8 B;  1KX3 A;  5CPI A;  3WTP A;  1HTA A;  3X1S D;  3AZI C;  3UTB D;  1P3F A;  5B0Z A;  4M6B A;  4H9O A;  5CHL B;  5DNM A;  3KXB C;  3REH A;  4UUZ B;  3REH B;  4WZS B;  1M1A B;  4KGC B;  4J8X B;  1HQ3 B;  4NFT A;  4J8V A;  3AZI A;  5B2J D;  1P3F C;  3B6F D;  3O62 D;  3MGS B;  1P3M B;  3MNN C;  1BH8 A;  4G91 C;  5AY8 A;  5B1M D;  4J8X C;  3X1V C;  3AZE A;  3AZE B;  5BNV A;  5B24 B;  5BO0 B;  5B40 B;  3REI C;  3AV1 A;  4Z5T D;  1P3O C;  2HIO D;  3WKJ B;  1P3G A;  5GSU D;  5B33 B;  1A7W A;  5B0Y B;  4EO5 B;  3WA9 A;  3REI A;  2NZD B;  5E5A A; 
#chains in the Genus database with same CATH topology
 2F8N A;  3C1C B;  3AV2 B;  5CPJ A;  2XD5 A;  2PYO B;  5CPI B;  1B67 A;  2FFF B;  2ARO C;  5AVC D;  5CP6 D;  3MGQ C;  3MGR B;  3LJA A;  4YS3 B;  5AV8 D;  5B2I C;  1P3L A;  2BG1 A;  3LZ1 D;  3MGR D;  3C1B A;  3UT9 B;  2NQB C;  4XUJ A;  2JCH A;  3AZM D;  4J8U C;  3AV2 D;  1ID3 A;  3A6N B;  5BNX B;  4Z2M G;  2Y2I A;  3AZL D;  3C1C D;  1U35 C;  3UTA B;  4Z5T B;  3WKJ D;  3MGQ D;  3W97 B;  3WTP C;  3MGP C;  5JA4 B;  5AY8 B;  3REK D;  1P3A A;  1P3A C;  1BFM A;  5BS7 C;  2FJ7 B;  3B6G B;  1P3P D;  5F99 A;  5GT3 C;  4AWL C;  1F66 A;  3REK B;  4J8V D;  1N1J B;  1U35 A;  3AFA C;  3REL D;  3WA9 B;  3MGQ B;  4J8U A;  4WU8 C;  2ARO A;  3AZL B;  4HGA B;  1ZLA A;  5BO0 A;  5B40 A;  3LEL C;  3AV2 C;  5B2I A;  1P3L C;  1P3I D;  3V9R B;  4XZQ A;  1P3P C;  1KU5 A;  1P3P B;  3X1U D;  2YFV A;  3W96 C;  5B40 C;  5AV9 C;  3VH5 A;  2IO5 C;  2BYM B;  5AV6 D;  1BH9 A;  4J8X A;  5GT3 D;  3LEL D;  4WU8 A;  1F1E A;  3WA9 C;  1P3K C;  5B33 D;  5B0Y D;  1TAF A;  3A1I A;  3V9R A;  4XZQ B;  5GT3 B;  1T3U A;  3KUY D;  5JRG D;  3WTP D;  1KX4 D;  3X1T D;  3LZ1 C;  3AZF D;  5AY8 C;  4ZBJ C;  3AZM C;  5B31 B;  1M19 C;  2G5I C;  4KUD D;  3F6T A;  3W99 B;  1P3M D;  4YS3 D;  4H9R A;  3LJA C;  3O62 C;  2YFW A;  4KGC D;  1H3O B;  4E44 A;  3MVD A;  4JJN D;  3C1B C;  2Y2N A;  1KX3 C;  3WAA A;  5CPJ C;  3AN2 C;  3EPH A;  3LZ1 A;  3B0C W;  2Y2O A;  3KWQ C;  5C3I B;  1P3O D;  3UTB B;  2DQN C;  3LZ0 A;  3X1U C;  3REJ B;  3AZE D;  5CPI C;  4NE5 A;  3IP4 C;  1P3G C;  1P3K A;  4YM6 A;  4WU9 D;  5B40 D;  3C1B B;  3MGS D;  5GT0 A;  5E5A C;  3REI D;  5B1M B;  3WAA B;  5B2J B;  3LJA B;  3MNN A;  3AZK C;  4EO5 C;  3KWQ D;  1P3B B;  1HQ3 D;  2YFW B;  3B6F B;  3TU4 B;  3AZM B;  4ZBJ B;  3LZ0 B;  3AV1 D;  1AOI D;  3W99 D;  4Z2M H;  3AZE C;  2ZY4 A;  3UT9 D;  1JFI B;  4LD9 C;  3B0C T;  3LZ1 B;  2XD1 A;  2W8S A;  3LEL A;  5AV8 B;  1TAF B;  3KSY A;  1TZY A;  3VH6 A;  4J8V C;  4G92 C;  5GSU A;  5DNM C;  1AOI B;  3AZK D;  3AFA A;  2VQR A;  3TU4 D;  3AZN B;  4X23 A;  5CP6 B;  1F66 C;  3AZL A;  3REH C;  4R8P C;  4Z66 B;  3KXB A;  5BT1 D;  5CPJ D;  3KXB B;  2PYO D;  3WTP E;  3MGP A;  5DNN B;  4KUD A;  4WNN B;  5B0Z C;  5B2J C;  5CP6 A;  5F99 B;  4WNN A;  5E5A B;  2Y2K A;  3REJ D;  5GSU B;  2LY8 A;  4J8W C;  1ZLA D;  1P3G B;  1P3I B;  2Y2J A;  1BH9 B;  3KUY A;  5B1L A;  3NQU A;  1EQZ B;  1F66 B;  3AZI D;  3AYW B;  3B6F A;  3MGQ A;  4H9S A;  1KX3 B;  1P3P A;  1F66 D;  2G5H C;  4H9N B;  4YM6 D;  4J8V B;  5JA4 A;  4G92 B;  1M18 A;  1EQZ D;  3REK A;  5AV6 A;  5B1M A;  4J8X D;  2F8N H;  4KGC A;  2ZY3 A;  3KFU G;  4ZUX C;  3X1T B;  3AZJ D;  5JRG B;  5B2I D;  3TU4 C;  4XZQ D;  2CWE A;  4WU8 D;  3X1S B;  3AV1 C;  5GXQ D;  1P3O A;  2F8N D;  2FJ7 A;  4CAY B;  4Z66 D;  2NZD A;  1Q9C A;  5AV5 B;  4XUJ B;  2CV5 C;  5JRG A;  2JE5 A;  5AVB C;  3AZJ C;  3X1U B;  2IO5 B;  5AV9 B;  4J8W B;  4XUJ C;  5CPK C;  5AV5 C;  3AZF B;  1P34 D;  4J8U D;  4CAY A;  3UT9 A;  5DNN C;  2ARO D;  3LZ0 D;  3C1C A;  3AV1 B;  3X1S C;  4CSR B;  1S32 C;  1P3L B;  3VH6 T;  5AVB D;  3WKJ C;  3REI B;  4R8P B;  1P3I A;  2Y2G A;  4H9P A;  4NE3 A;  4H9P B;  3AZH D;  3X1T C;  3X1T A;  1P3A D;  4WU8 B;  3MGS A;  3AZN C;  3AN2 D;  4DRA A;  4E45 A;  4JJN A;  5B32 C;  3EPL A;  2HIO C;  4AWL B;  1HQ3 A;  5DNN A;  5AV8 C;  1P3M A;  1M1A A;  4UPK A;  4QLC C;  3AYW A;  1P3A B;  2RIQ A;  1M18 D;  1KX5 D;  3MNN D;  2BYK A;  5BNV B;  4JJN B;  3X1V A;  1P34 C;  4Z5T C;  1P3K D;  3UTA C;  1AOI A;  3AZK B;  1KX4 A;  4WU9 A;  3A6N A;  3A6N C;  4ZUX D;  4J8U B;  3W98 C;  5B0Z B;  4KHA B;  5AVC B;  3AZG B;  5B32 D;  3TU4 A;  4Z66 C;  3UTB C;  4UUZ A;  3NQJ A;  2ZM5 A;  2F8N K;  3KWQ B;  3W97 D;  3AL0 C;  3KXB D;  5CPJ B;  2PYO A;  1TZY D;  3AZG A;  2F8N B;  5FUG B;  3REK C;  3AZF A;  3AZN D;  3REJ A;  4DQY B;  5B0Y C;  5B33 C;  5GXQ A;  1M19 B;  3R45 B;  4LD9 B;  5B0Z D;  1P3O B;  2DF4 C;  5B24 C;  5DNM D;  3W97 C;  4YS3 A;  5GT0 D;  4ZUX B;  5CPK A;  1P3B C;  3AZH A;  3B0D C;  2NQB D;  4G91 B;  3MVD D;  3MNN B;  2JSS A;  3AZH C;  3VH5 T;  5GT0 B;  1WWI A;  3REL B;  3W99 A;  3AZJ A;  2NQB B;  3NQU B;  1EQZ A;  4KUD B;  2L5A A;  1M19 D;  2CV5 A;  3B6G D;  3REJ C;  3W96 D;  3MGR C;  3UTB A;  4LD9 D;  2ZY2 A;  2FJ7 D;  5C3I C;  3X1V D;  3W96 B;  3AN2 B;  3AZG C;  3KUY B;  2F2A C;  2BYK B;  4NE6 A;  5AVC C;  4X23 D;  2PYO C;  2Y2L A;  5GSU C;  4H9N A;  3W98 B;  3O62 B;  4WJ3 C;  4Z66 A;  3LEL B;  3H0L C;  4HGA C;  3W99 C;  3MGP D;  5AV6 C;  4J8W D;  5B1L B;  1P34 B;  5AV9 D;  3AFA B;  2YFV B;  3W98 A;  1KX5 A;  1P3B A;  4QLC B;  1P3F D;  2HUE B;  3FDD A;  3B6G C;  5AV8 A;  1P3M C;  4H9O B;  5DNM B;  3AFA D;  3REL C;  1AOI C;  4CSR A;  5GT0 C;  2HIO A;  5B1L D;  4QLC D;  1P3F B;  5G49 B;  3MGP B;  5B32 G;  2RVQ C;  1P3K B;  4XUJ D;  3WTP B;  3B0D B;  1M1A C;  3LZ0 C;  3EG5 B;  5B2J A;  5KDM B;  4X23 B;  5B32 A;  1S32 B;  5B24 D;  3UT9 C;  2Y2P A;  3WAA C;  1WWS A;  3AZF C;  1H3O A;  5CPK B;  5AV5 A;  3MVD C;  3EPJ A;  4R8P D;  4H9Q A;  3VH5 W;  1ULY A;  3X1S A;  5B31 A;  3UTA D;  2ARO B;  1M19 A;  3AZM A;  5AVB B;  5AVB A;  4WU9 C;  1KX4 C;  1KX5 C;  3MVD B;  5FUG A;  1P3G D;  3REH D;  2UWX A;  2NZD C;  5B31 G;  1M1A D;  2FJ7 C;  5CPK D;  5E5A D;  1M18 B;  2Y2H A;  5JRG C;  5CPI D;  5B31 C;  4Z5T A;  1P34 A;  1B6W A;  3VH6 W;  1R4V A;  5G49 A;  4JJN C;  4KHA A;  5AVC A;  4YM6 C;  4H9Q B;  2Y2Q A;  3AZN A;  3MGS C;  2NZD D;  1TZY B;  1HQ3 C;  3H0M C;  3A6N D;  3WKJ A;  2HIO B;  4XZQ C;  5B2I B;  5B32 B;  1S32 A;  4KGC C;  3AN2 A;  1EQZ C;  5B1L C;  1ZLA C;  3NQJ B;  5BT1 C;  1P3I C;  3O62 A;  1KX3 D;  3AZG D;  4H9S C;  3AZI B;  3AYW D;  1N1J A;  4WV4 B;  3C1C C;  1U35 D;  3REL A;  3LJA D;  5GT3 A;  5F99 C;  3B6G A;  3KUY C;  1P3B D;  5GXQ C;  5B33 A;  5B0Y A;  1KX5 B;  3C1B D;  4WU9 B;  1Z2C B;  4R8P A;  3WA9 D;  2CV5 D;  2BYM A;  3AZL C;  3X1V B;  1JFI A;  1ZLA B;  3AZJ B;  5CP6 C;  4KUD C;  5BNX A;  5DNN D;  1ID3 C;  2CV5 B;  5F99 D;  1TZY C;  3AZH B;  5AY8 D;  2NQB A;  5AV9 A;  2RVQ D;  3W96 A;  4X23 C;  1P3L D;  4YM6 B;  3MGR A;  1PZR A;  3B0B A;  3B6F C;  4ZUX A;  1W2E A;  1U35 B;  3AV2 A;  1ID3 D;  5B31 D;  3UTA A;  5B1M C;  3EPK A;  3R45 A;  4LD9 A;  1M18 C;  1ID3 B;  3H0R C;  2HUE C;  3P5J B;  4QLC A;  4J8W A;  3AYW C;  3AZK A;  1KX4 B;  4YS3 C;  3W97 A;  1S32 D;  3X1U A;  4H9R B;  5B24 A;  2F8N G;  4DRB A;  5KDM A;  3W98 D;  5BS7 A;  5AV6 B;  3KWQ A;  5GXQ B;  5AV5 D;  3WAA D;  1BH8 B;  1KX3 A;  5CPI A;  3WTP A;  2ZY5 A;  1HTA A;  3X1S D;  3AZI C;  3UTB D;  1P3F A;  5B0Z A;  4M6B A;  4H9O A;  5CHL B;  5DNM A;  2J8P A;  3KXB C;  3REH A;  4UUZ B;  3REH B;  4WZS B;  1M1A B;  4KGC B;  4J8X B;  1HQ3 B;  4NFT A;  4J8V A;  3AZI A;  5B2J D;  1P3F C;  3B6F D;  3O62 D;  3MGS B;  1P3M B;  3MNN C;  1BH8 A;  3A1K A;  4G91 C;  5AY8 A;  5B1M D;  4J8X C;  2Y2M A;  3X1V C;  3AZE A;  3AZE B;  5BNV A;  5B24 B;  5BO0 B;  5B40 B;  3REI C;  3AV1 A;  4Z5T D;  1P3O C;  2HIO D;  3WKJ B;  1P3G A;  5GSU D;  5B33 B;  1A7W A;  5B0Y B;  4EO5 B;  3WA9 A;  3REI A;  2NZD B;  5E5A A; 
#chains in the Genus database with same CATH homology
 2F8N A;  3C1C B;  3AV2 B;  5CPJ A;  2XD5 A;  2PYO B;  5CPI B;  1B67 A;  2FFF B;  2ARO C;  5AVC D;  5CP6 D;  3MGQ C;  3MGR B;  3LJA A;  4YS3 B;  5AV8 D;  5B2I C;  1P3L A;  2BG1 A;  3LZ1 D;  3MGR D;  3C1B A;  3UT9 B;  2NQB C;  4XUJ A;  2JCH A;  3AZM D;  4J8U C;  3AV2 D;  1ID3 A;  3A6N B;  5BNX B;  4Z2M G;  2Y2I A;  3AZL D;  3C1C D;  1U35 C;  3UTA B;  4Z5T B;  3WKJ D;  3MGQ D;  3W97 B;  3WTP C;  3MGP C;  5JA4 B;  5AY8 B;  3REK D;  1P3A A;  1P3A C;  1BFM A;  5BS7 C;  2FJ7 B;  3B6G B;  1P3P D;  5F99 A;  5GT3 C;  4AWL C;  1F66 A;  3REK B;  4J8V D;  1N1J B;  1U35 A;  3AFA C;  3REL D;  3WA9 B;  3MGQ B;  4J8U A;  4WU8 C;  2ARO A;  3AZL B;  4HGA B;  1ZLA A;  5BO0 A;  5B40 A;  3LEL C;  3AV2 C;  5B2I A;  1P3L C;  1P3I D;  3V9R B;  4XZQ A;  1P3P C;  1KU5 A;  1P3P B;  3X1U D;  2YFV A;  3W96 C;  5B40 C;  5AV9 C;  3VH5 A;  2IO5 C;  2BYM B;  5AV6 D;  1BH9 A;  4J8X A;  5GT3 D;  3LEL D;  4WU8 A;  1F1E A;  3WA9 C;  1P3K C;  5B33 D;  5B0Y D;  1TAF A;  3A1I A;  3V9R A;  4XZQ B;  5GT3 B;  1T3U A;  3KUY D;  5JRG D;  3WTP D;  1KX4 D;  3X1T D;  3LZ1 C;  3AZF D;  5AY8 C;  4ZBJ C;  3AZM C;  5B31 B;  1M19 C;  2G5I C;  4KUD D;  3F6T A;  3W99 B;  1P3M D;  4YS3 D;  4H9R A;  3LJA C;  3O62 C;  2YFW A;  4KGC D;  1H3O B;  4E44 A;  3MVD A;  4JJN D;  3C1B C;  2Y2N A;  1KX3 C;  3WAA A;  5CPJ C;  3AN2 C;  3EPH A;  3LZ1 A;  3B0C W;  2Y2O A;  3KWQ C;  5C3I B;  1P3O D;  3UTB B;  2DQN C;  3LZ0 A;  3X1U C;  3REJ B;  3AZE D;  5CPI C;  4NE5 A;  3IP4 C;  1P3G C;  1P3K A;  4YM6 A;  4WU9 D;  5B40 D;  3C1B B;  3MGS D;  5GT0 A;  5E5A C;  3REI D;  5B1M B;  3WAA B;  5B2J B;  3LJA B;  3MNN A;  3AZK C;  4EO5 C;  3KWQ D;  1P3B B;  1HQ3 D;  2YFW B;  3B6F B;  3TU4 B;  3AZM B;  4ZBJ B;  3LZ0 B;  3AV1 D;  1AOI D;  3W99 D;  4Z2M H;  3AZE C;  2ZY4 A;  3UT9 D;  1JFI B;  4LD9 C;  3B0C T;  3LZ1 B;  2XD1 A;  2W8S A;  3LEL A;  5AV8 B;  1TAF B;  3KSY A;  1TZY A;  3VH6 A;  4J8V C;  4G92 C;  5GSU A;  5DNM C;  1AOI B;  3AZK D;  3AFA A;  2VQR A;  3TU4 D;  3AZN B;  4X23 A;  5CP6 B;  1F66 C;  3AZL A;  3REH C;  4R8P C;  4Z66 B;  3KXB A;  5BT1 D;  5CPJ D;  3KXB B;  2PYO D;  3WTP E;  3MGP A;  5DNN B;  4KUD A;  4WNN B;  5B0Z C;  5B2J C;  5CP6 A;  5F99 B;  4WNN A;  5E5A B;  2Y2K A;  3REJ D;  5GSU B;  2LY8 A;  4J8W C;  1ZLA D;  1P3G B;  1P3I B;  2Y2J A;  1BH9 B;  3KUY A;  5B1L A;  3NQU A;  1EQZ B;  1F66 B;  3AZI D;  3AYW B;  3B6F A;  3MGQ A;  4H9S A;  1KX3 B;  1P3P A;  1F66 D;  2G5H C;  4H9N B;  4YM6 D;  4J8V B;  5JA4 A;  4G92 B;  1M18 A;  1EQZ D;  3REK A;  5AV6 A;  5B1M A;  4J8X D;  2F8N H;  4KGC A;  2ZY3 A;  3KFU G;  4ZUX C;  3X1T B;  3AZJ D;  5JRG B;  5B2I D;  3TU4 C;  4XZQ D;  2CWE A;  4WU8 D;  3X1S B;  3AV1 C;  5GXQ D;  1P3O A;  2F8N D;  2FJ7 A;  4CAY B;  4Z66 D;  2NZD A;  1Q9C A;  5AV5 B;  4XUJ B;  2CV5 C;  5JRG A;  2JE5 A;  5AVB C;  3AZJ C;  3X1U B;  2IO5 B;  5AV9 B;  4J8W B;  4XUJ C;  5CPK C;  5AV5 C;  3AZF B;  1P34 D;  4J8U D;  4CAY A;  3UT9 A;  5DNN C;  2ARO D;  3LZ0 D;  3C1C A;  3AV1 B;  3X1S C;  4CSR B;  1S32 C;  1P3L B;  3VH6 T;  5AVB D;  3WKJ C;  3REI B;  4R8P B;  1P3I A;  2Y2G A;  4H9P A;  4NE3 A;  4H9P B;  3AZH D;  3X1T C;  3X1T A;  1P3A D;  4WU8 B;  3MGS A;  3AZN C;  3AN2 D;  4DRA A;  4E45 A;  4JJN A;  5B32 C;  3EPL A;  2HIO C;  4AWL B;  1HQ3 A;  5DNN A;  5AV8 C;  1P3M A;  1M1A A;  4UPK A;  4QLC C;  3AYW A;  1P3A B;  2RIQ A;  1M18 D;  1KX5 D;  3MNN D;  2BYK A;  5BNV B;  4JJN B;  3X1V A;  1P34 C;  4Z5T C;  1P3K D;  3UTA C;  1AOI A;  3AZK B;  1KX4 A;  4WU9 A;  3A6N A;  3A6N C;  4ZUX D;  4J8U B;  3W98 C;  5B0Z B;  4KHA B;  5AVC B;  3AZG B;  5B32 D;  3TU4 A;  4Z66 C;  3UTB C;  4UUZ A;  3NQJ A;  2ZM5 A;  2F8N K;  3KWQ B;  3W97 D;  3AL0 C;  3KXB D;  5CPJ B;  2PYO A;  1TZY D;  3AZG A;  2F8N B;  5FUG B;  3REK C;  3AZF A;  3AZN D;  3REJ A;  4DQY B;  5B0Y C;  5B33 C;  5GXQ A;  1M19 B;  3R45 B;  4LD9 B;  5B0Z D;  1P3O B;  2DF4 C;  5B24 C;  5DNM D;  3W97 C;  4YS3 A;  5GT0 D;  4ZUX B;  5CPK A;  1P3B C;  3AZH A;  3B0D C;  2NQB D;  4G91 B;  3MVD D;  3MNN B;  2JSS A;  3AZH C;  3VH5 T;  5GT0 B;  1WWI A;  3REL B;  3W99 A;  3AZJ A;  2NQB B;  3NQU B;  1EQZ A;  4KUD B;  2L5A A;  1M19 D;  2CV5 A;  3B6G D;  3REJ C;  3W96 D;  3MGR C;  3UTB A;  4LD9 D;  2ZY2 A;  2FJ7 D;  5C3I C;  3X1V D;  3W96 B;  3AN2 B;  3AZG C;  3KUY B;  2F2A C;  2BYK B;  4NE6 A;  5AVC C;  4X23 D;  2PYO C;  2Y2L A;  5GSU C;  4H9N A;  3W98 B;  3O62 B;  4WJ3 C;  4Z66 A;  3LEL B;  3H0L C;  4HGA C;  3W99 C;  3MGP D;  5AV6 C;  4J8W D;  5B1L B;  1P34 B;  5AV9 D;  3AFA B;  2YFV B;  3W98 A;  1KX5 A;  1P3B A;  4QLC B;  1P3F D;  2HUE B;  3FDD A;  3B6G C;  5AV8 A;  1P3M C;  4H9O B;  5DNM B;  3AFA D;  3REL C;  1AOI C;  4CSR A;  5GT0 C;  2HIO A;  5B1L D;  4QLC D;  1P3F B;  5G49 B;  3MGP B;  5B32 G;  2RVQ C;  1P3K B;  4XUJ D;  3WTP B;  3B0D B;  1M1A C;  3LZ0 C;  3EG5 B;  5B2J A;  5KDM B;  4X23 B;  5B32 A;  1S32 B;  5B24 D;  3UT9 C;  2Y2P A;  3WAA C;  1WWS A;  3AZF C;  1H3O A;  5CPK B;  5AV5 A;  3MVD C;  3EPJ A;  4R8P D;  4H9Q A;  3VH5 W;  1ULY A;  3X1S A;  5B31 A;  3UTA D;  2ARO B;  1M19 A;  3AZM A;  5AVB B;  5AVB A;  4WU9 C;  1KX4 C;  1KX5 C;  3MVD B;  5FUG A;  1P3G D;  3REH D;  2UWX A;  2NZD C;  5B31 G;  1M1A D;  2FJ7 C;  5CPK D;  5E5A D;  1M18 B;  2Y2H A;  5JRG C;  5CPI D;  5B31 C;  4Z5T A;  1P34 A;  1B6W A;  3VH6 W;  1R4V A;  5G49 A;  4JJN C;  4KHA A;  5AVC A;  4YM6 C;  4H9Q B;  2Y2Q A;  3AZN A;  3MGS C;  2NZD D;  1TZY B;  1HQ3 C;  3H0M C;  3A6N D;  3WKJ A;  2HIO B;  4XZQ C;  5B2I B;  5B32 B;  1S32 A;  4KGC C;  3AN2 A;  1EQZ C;  5B1L C;  1ZLA C;  3NQJ B;  5BT1 C;  1P3I C;  3O62 A;  1KX3 D;  3AZG D;  4H9S C;  3AZI B;  3AYW D;  1N1J A;  4WV4 B;  3C1C C;  1U35 D;  3REL A;  3LJA D;  5GT3 A;  5F99 C;  3B6G A;  3KUY C;  1P3B D;  5GXQ C;  5B33 A;  5B0Y A;  1KX5 B;  3C1B D;  4WU9 B;  1Z2C B;  4R8P A;  3WA9 D;  2CV5 D;  2BYM A;  3AZL C;  3X1V B;  1JFI A;  1ZLA B;  3AZJ B;  5CP6 C;  4KUD C;  5BNX A;  5DNN D;  1ID3 C;  2CV5 B;  5F99 D;  1TZY C;  3AZH B;  5AY8 D;  2NQB A;  5AV9 A;  2RVQ D;  3W96 A;  4X23 C;  1P3L D;  4YM6 B;  3MGR A;  1PZR A;  3B0B A;  3B6F C;  4ZUX A;  1W2E A;  1U35 B;  3AV2 A;  1ID3 D;  5B31 D;  3UTA A;  5B1M C;  3EPK A;  3R45 A;  4LD9 A;  1M18 C;  1ID3 B;  3H0R C;  2HUE C;  3P5J B;  4QLC A;  4J8W A;  3AYW C;  3AZK A;  1KX4 B;  4YS3 C;  3W97 A;  1S32 D;  3X1U A;  4H9R B;  5B24 A;  2F8N G;  4DRB A;  5KDM A;  3W98 D;  5BS7 A;  5AV6 B;  3KWQ A;  5GXQ B;  5AV5 D;  3WAA D;  1BH8 B;  1KX3 A;  5CPI A;  3WTP A;  2ZY5 A;  1HTA A;  3X1S D;  3AZI C;  3UTB D;  1P3F A;  5B0Z A;  4M6B A;  4H9O A;  5CHL B;  5DNM A;  2J8P A;  3KXB C;  3REH A;  4UUZ B;  3REH B;  4WZS B;  1M1A B;  4KGC B;  4J8X B;  1HQ3 B;  4NFT A;  4J8V A;  3AZI A;  5B2J D;  1P3F C;  3B6F D;  3O62 D;  3MGS B;  1P3M B;  3MNN C;  1BH8 A;  3A1K A;  4G91 C;  5AY8 A;  5B1M D;  4J8X C;  2Y2M A;  3X1V C;  3AZE A;  3AZE B;  5BNV A;  5B24 B;  5BO0 B;  5B40 B;  3REI C;  3AV1 A;  4Z5T D;  1P3O C;  2HIO D;  3WKJ B;  1P3G A;  5GSU D;  5B33 B;  1A7W A;  5B0Y B;  4EO5 B;  3WA9 A;  3REI A;  2NZD B;  5E5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...