2PYOD

Drosophila nucleosome core
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
95
structure length
95
Chain Sequence
RKRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (147-MER)
publication title Structure of the Drosophila nucleosome core particle highlights evolutionary constraints on the H2A-H2B histone dimer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 35
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2007-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2pyoD00
1F1EA 1P3PA 5GXQC 5F99A 3AZNC 3AZHA 4J8WD 5BO0A 3MGPA 3KUYB 4KGCB 5B32C 3W99D 1M18D 1ZLAD 3WAAB 3X1TA 3AZKB 4WU9D 4EO5C 5CPJC 5B2JD 1U35B 3AZJD 1P3GB 5B1MA 1BH8A 3W97D 4LD9B 4JJNC 1BH9A 5JA4B 3AZFC 5JRGD 3UTBB 4ZUXA 5E5AC 1EQZB 3AZIA 3AZGB 1KX3B 5CP6C 1KX5B 3TU4A 4QLCC 4AWLC 1P3AA 5AV9D 5CPKB 2YFVA 3LZ0C 3W98C 3MGSD 4JJNB 1TAFA 3KWQB 4J8WA 3A6NB 5E5AB 3VH6A 5AV6B 3NQJB 1P3KB 3W99A 4UUZB 1M18A 3AV1C 5B40C 3WTPD 1ZLAA 1TZYB 3B6GC 3LJAB 3B6FC 1P3BD 4YS3D 4WU9A 1P3MC 5B2JA 2NZDB 3AZMC 3AZJA 3MVDC 2BYKB 3W97A 3X1SB 3AYWC 2PYOD 5AV5D 5AVBD 5JRGA 3MNND 3B6FB 3REIB 3X1UC 5B31B 5B0ZD 1S32D 2CV5B 3B0BA 5AV9A 3KUYA 3RELB 4XUJD 1M1AB 3MGSA 5B2ID 1ULYA 3AZKA 2JSSA 4H9SC 3O62D 5BS7A 4E44A 3VH5W 2NQBC 3AZEC 1P3BA 4YS3A 1P3PC 1KX4D 1A7WA 1M19D 5DNMC 5F99C 1P3LB 5AVBA 3MNNA 3MGQB 4H9NA 1H3OB 3MGPC 4ZBJB 3KXBD 5B0ZA 3UTAB 5BT1C 1S32A 1P3PB 3NQJA 3LELD 4J8XC 5F99B 5B0YD 3AZHB 3LJAA 5BO0B 3C1BD 5B1MC 4G91B 5GT0D 3REKD 4M6BA 3O62A 1F66D 3B0CT 4ZUXC 3AFAB 3X1TB 1P3LD 3X1SA 3TU4C 4G92C 1P3AC 1KX4A 1BH8B 3UTAD 1M19A 3REHC 3AN2B 3WA9D 1BH9B 2AROD 2HIOB 3AZIB 4WNNA 4Z5TC 3KXBA 4WU8C 5DNND 4YM6D 1M18C 3X1VD 3W96C 2YFVB 3LELA 5B33D 1N1JA 1TAFB 5B0YA 4J8WB 3W97C 5AY8D 1M18B 3REKA 3W99B 1P34D 1ZLAB 5JRGC 1P3LA 4WU9B 3UT9D 5B2JB 3KUYC 3AZJB 4H9RA 2F8NH 4KGCC 3UTAA 3MGSC 3W97B 3WAAC 3WA9A 2AROA 5JRGB 3AZKC 1U35C 4KUDD 2RVQC 5CHLB 5DNNA 4YM6A 1P3GC 5AV9B 3X1VA 5B33A 4LD9C 3MGSB 5AV8D 3LZ1D 4J8UD 3AFAA 3UTBC 1HQ3D 3AV2D 1KX3C 3AZGC 1EQZC 1KX5C 3MGRD 5AY8A 5CPKC 1P34A 3WTPB 5AVCD 3AN2A 1P3BB 4R8PD 2HIOA 4YS3B 3KWQC 3A6NC 3UT9A 4H9QA 5AV6C 1S32C 4Z2MH 4Z66D 1P3KC 5GT3D 4DRBA 3C1CD 3REJD 5B24D 1TZYC 1P3ID 3LJAC 2PYOB 5AV5B 5AVBB 3MNNB 1P3FD 4H9NB 2NZDC 5BNXA 4J8VD 4KUDA 5B0ZB 1S32B 1WWIA 5B1LD 3O62C 4XUJB 2FJ7D 3X1SC 5AV8A 5B2IB 3LZ1A 4KHAB 4E45A 3AZLD 1HQ3A 4XZQD 3REIC 4CSRA 3B0DB 5B31C 2CV5C 3RELC 3O62B 5AVCA 1M1AC 1P3OD 3WTPE 3NQUA 1KX4B 3VH6W 5B32G 5C3IB 1AOID 5GT3A 1M19B 2HUEC 3VH6T 3C1CA 5GXQD 5B24A 3REJA 3AZND 1P3IA 1P3FA 4WNNB 5B32D 3KXBB 3REKC 5B1LA 3LELB 2HUEB 1P3LC 2FJ7A 1N1JB 3WTPA 3MGQC 5B0YB 5CPJD 3AZLA 3VH5T 3C1BB 5GT0B 4ZBJC 3UTAC 3REKB 1F66B 3AZFD 1P3OA 1JFIA 5BNVA 4WV4B 5CP6D 3AZHC 5AV5A 2PYOA 4QLCD 4G91C 3X1VC 4H9RB 3LZ0D 1AOIA 3W98D 5GXQA 3AZNA 3WA9B 3AFAC 4XUJA 2AROB 3X1TC 5B2IA 4KHAA 5KDMA 2F8NG 5B32A 5AY8C 5DNNB 4YM6B 3AV1D 5B40D 3X1VB 3B6GD 5B33B 3AN2C 2HIOC 1P3MD 5CPJA 2F8ND 3AZIC 3AZMD 3MVDD 4HGAB 5AY8B 1P34B 3AYWD 3V9RA 5CP6A 4J8WC 4QLCA 4KUDC 3UT9B 4H9QB 3KSYA 4NFTA 3LZ0A 3W99C 3W98A 1ZLAC 4WU9C 4Z2MG 5B2JC 5BNXB 4KUDB 3WKJD 3AZJC 3C1BA 3AV1A 5GT0A 4CAYA 2L5AA 4X23B 1HTAA 2NQBD 3B6GA 3AZED 5AV8B 3LZ1B 1F66A 4J8UB 1P3MA 2IO5B 1HQ3B 3AV2B 2F8NA 4CSRB 3AZMA 3MGRB 5GT3C 3MVDA 5AV9C 5DNMD 5B24C 5AVCB 3MGPD 4R8PB 3NQUB 5BT1D 4Z66B 5GSUD 5GT3B 4J8XD 5BS7C 3WTPC 3C1CB 5B24B 3REJB 4X23D 1P3IB 1P3FB 5CPID 1P3BC 4YS3C 5B1MD 3R45B 4J8VB 4H9SA 3WKJA 5B1LB 2NQBA 4ZUXD 2FJ7B 2PYOC 5AV5C 5AVBC 3MNNC 1P3AD 3AZLB 4XZQB 1ID3D 5G49B 5B0ZC 1AOIC 3REHD 5DNMA 4XUJC 4WZSB 1P3OB 1JFIB 5BNVB 5B2IC 1B67A 4Z5TD 1WWSA 4WU8D 3B0DC 3W96D 5GSUA 1AOIB 4J8XA 5GXQB 3AZNB 4X23A 5CPIA 4J8UA 5KDMB 2LY8A 3AV2A 5B32B 1KX4C 3MGRA 2BYMA 2F8NK 5C3IC 1M19C 4H9PA 4DRAA 4H9OA 4EO5B 5CPJB 2YFWA 4R8PA 3KUYD 1ID3A 4KGCD 3KXBC 5FUGA 3REHA 4Z66A 3WAAD 3LELC 3AZFB 3AZKD 3V9RB 5B0YC 5CP6B 1U35D 4Z5TA 4QLCB 4AWLB 4WU8A 2RVQD 3C1BC 1P3GD 5GT0C 3R45A 3W96A 3LZ0B 4J8VA 4LD9D 3W98B 1F66C 3UTBD 1EQZD 1KX3D 3AZGD 1KX5D 4NE5A 4XZQA 5CPKD 5G49A 3VH5A 3AV1B 5B40B 4CAYB 3B6GB 4JJND 3WA9C 2AROC 3KWQD 1P3MB 3A6ND 5E5AD 2F8NB 1BFMA 5AV6D 3AZMB 1P3KD 4KGCA 5DNNC 4YM6C 3MVDB 3WAAA 1TZYD 5B33C 3AYWB 3LJAD 3X1UB 1U35A 2NZDD 3WKJC 5B31G 1P3GA 4HGAC 4LD9A 1P34C 3X1SD 5JA4A 3UTBA 1EQZA 1KX3A 3REID 3AZGA 3B6FD 1KX5A 5B31D 3UT9C 2CV5D 3WKJB 4NE6A 5CPKA 3RELD 1M1AD 2NQBB 4JJNA 3AZEB 3KWQA 3AZFA 3A6NA 5E5AA 5AV6A 5GSUC 3X1UD 1P3KA 4UUZA 5DNMB 1B6WA 1TZYA 4X23C 5CPIC 5AV8C 3LZ1C 4J8UC 3MGPB 2IO5C 1HQ3C 3AV2C 2NZDA 3MGRC 3B0CW 5GSUB 2BYKA 4J8XB 5B40A 5AVCC 3MGQD 3B6FA 1Q9CA 1KU5A 3REIA 5CPIB 4R8PC 1ID3C 5B1MB 5B31A 1P3PD 2CV5A 4Z66C 2BYMB 3RELA 1R4VA 4H9PB 1M1AA 4ZUXB 3C1CC 3REJC 5F99D 1P3IC 3AYWA 3AZHD 4H9OB 4G92B 3TU4B 1P3AB 1P3FC 2YFWB 1ID3B 3X1UA 4J8VC 5FUGB 5B1LC 3REHB 3AFAD 3X1TD 2FJ7C 3AZLC 2CWEA 4Z5TB 4XZQC 4WU8B 3W96B 4NE3A 3AN2D 2HIOD 3MGQA 1P3OC 3AZEA 3AZID 1H3OA 3TU4D
chains in the Genus database with same CATH superfamily
1F1EA 1P3PA 5GXQC 5F99A 3AZNC 3AZHA 4J8WD 5BO0A 3MGPA 3KUYB 4KGCB 3F6TA 5B32C 3W99D 1M18D 1ZLAD 3WAAB 3X1TA 3AZKB 4WU9D 4EO5C 3P5JB 5CPJC 5B2JD 1U35B 3AZJD 1P3GB 5B1MA 1BH8A 1W2EA 3W97D 4LD9B 4JJNC 1BH9A 5JA4B 3AZFC 5JRGD 2DF4C 4ZUXA 5E5AC 3UTBB 1EQZB 3AZIA 3AZGB 1KX3B 5CP6C 1KX5B 3TU4A 4QLCC 4AWLC 1P3AA 5AV9D 5CPKB 2YFVA 3LZ0C 2Y2KA 3W98C 3MGSD 4JJNB 1TAFA 3KWQB 4J8WA 3A6NB 5E5AB 3VH6A 5AV6B 3NQJB 1P3KB 3W99A 4UUZB 1M18A 3AV1C 5B40C 3WTPD 1ZLAA 1TZYB 3B6GC 3LJAB 3B6FC 1P3BD 4YS3D 4WU9A 1P3MC 5B2JA 2NZDB 3AZMC 3AZJA 3MVDC 2BYKB 3W97A 3X1SB 3AYWC 2PYOD 5AV5D 5AVBD 5JRGA 3MNND 3B6FB 3REIB 3X1UC 5B31B 5B0ZD 1S32D 2CV5B 3B0BA 5AV9A 3KUYA 3RELB 4XUJD 1M1AB 3MGSA 5B2ID 1ULYA 1Z2CB 3AZKA 2J8PA 2JSSA 4H9SC 3O62D 5BS7A 4E44A 3VH5W 2NQBC 2FFFB 3AZEC 1P3BA 4YS3A 1P3PC 2UWXA 1A7WA 1KX4D 1M19D 3EPJA 5DNMC 5F99C 1P3LB 2Y2GA 5AVBA 3MNNA 3MGQB 4H9NA 1H3OB 3MGPC 4ZBJB 3KXBD 5B0ZA 3UTAB 5BT1C 1S32A 1P3PB 3NQJA 3LELD 4J8XC 5F99B 5B0YD 3AZHB 3LJAA 5BO0B 3C1BD 5B1MC 4G91B 5GT0D 3REKD 4M6BA 3O62A 1F66D 3B0CT 4ZUXC 2Y2IA 3AFAB 3X1TB 1P3LD 3X1SA 3TU4C 4G92C 1P3AC 1KX4A 1BH8B 3UTAD 1M19A 3REHC 3AN2B 3WA9D 1BH9B 2AROD 2HIOB 3AZIB 4WNNA 4Z5TC 3KXBA 4WU8C 5DNND 4YM6D 1M18C 3X1VD 3W96C 2YFVB 3LELA 5B33D 1N1JA 1TAFB 5B0YA 4J8WB 3EPHA 3W97C 5AY8D 1M18B 3REKA 3W99B 1P34D 1ZLAB 5JRGC 1P3LA 3EPKA 4WU9B 3UT9D 5B2JB 3KUYC 3AZJB 4H9RA 2F8NH 4KGCC 2ZY5A 3UTAA 3MGSC 3W97B 3WAAC 3WA9A 2AROA 5JRGB 3AZKC 1U35C 4KUDD 2RVQC 3FDDA 5CHLB 5DNNA 4YM6A 1P3GC 5AV9B 3X1VA 5B33A 4LD9C 3MGSB 5AV8D 3LZ1D 4J8UD 3AFAA 3UTBC 1HQ3D 3AV2D 1KX3C 3AZGC 3H0RC 1EQZC 1KX5C 3MGRD 2BG1A 5AY8A 5CPKC 1P34A 3WTPB 5AVCD 3AN2A 1P3BB 4R8PD 2HIOA 4YS3B 3KWQC 3A6NC 3UT9A 4H9QA 5AV6C 1S32C 4Z2MH 4Z66D 1P3KC 5GT3D 4DRBA 3C1CD 3REJD 5B24D 1TZYC 1P3ID 3LJAC 2PYOB 5AV5B 5AVBB 3MNNB 1P3FD 4H9NB 2NZDC 5BNXA 4J8VD 4KUDA 5B0ZB 1S32B 1WWIA 5B1LD 3O62C 4XUJB 2FJ7D 3X1SC 5AV8A 5B2IB 3LZ1A 4KHAB 4E45A 3AZLD 1HQ3A 4XZQD 3REIC 4CSRA 3B0DB 5B31C 3H0LC 4UPKA 2CV5C 2RIQA 3RELC 3O62B 5AVCA 1M1AC 1P3OD 3WTPE 3NQUA 1KX4B 3VH6W 5B32G 5C3IB 1AOID 2G5HC 5GT3A 2HUEC 3VH6T 1M19B 3H0MC 3C1CA 5GXQD 5B24A 3REJA 3AZND 1T3UA 1P3IA 1P3FA 4WNNB 3KFUG 5B32D 3KXBB 3REKC 5B1LA 3LELB 2HUEB 1P3LC 2FJ7A 1N1JB 3WTPA 3MGQC 5B0YB 5CPJD 3AZLA 2Y2MA 3VH5T 3C1BB 5GT0B 4ZBJC 3UTAC 3REKB 1F66B 3AZFD 1P3OA 1JFIA 5BNVA 4WV4B 5CP6D 3AZHC 5AV5A 2PYOA 4QLCD 4G91C 3X1VC 2ZY2A 4H9RB 3LZ0D 1AOIA 3W98D 5GXQA 3AZNA 3WA9B 3AFAC 4XUJA 2AROB 3X1TC 5B2IA 4KHAA 5KDMA 2F8NG 5B32A 2Y2JA 5AY8C 5DNNB 4YM6B 3AV1D 5B40D 3X1VB 3B6GD 5B33B 3AN2C 2HIOC 1P3MD 5CPJA 2F8ND 3AZIC 3AZMD 3MVDD 4HGAB 5AY8B 1P34B 3AYWD 2ZY4A 3V9RA 3EG5B 5CP6A 4J8WC 4QLCA 4KUDC 3UT9B 2XD5A 4H9QB 3KSYA 4NFTA 3LZ0A 3W99C 3W98A 1ZLAC 4WU9C 4Z2MG 5B2JC 5BNXB 4KUDB 3WKJD 3AZJC 3C1BA 3AV1A 5GT0A 4CAYA 2L5AA 4X23B 1HTAA 2NQBD 3B6GA 3AZED 5AV8B 3LZ1B 1F66A 4J8UB 1P3MA 2IO5B 1HQ3B 3AV2B 2F8NA 4CSRB 3AZMA 3MGRB 5GT3C 3MVDA 5AV9C 5DNMD 5B24C 5AVCB 3MGPD 4R8PB 3NQUB 2Y2OA 5BT1D 4Z66B 5GSUD 5GT3B 4J8XD 5BS7C 3WTPC 3C1CB 5B24B 3REJB 4X23D 1P3IB 1P3FB 5CPID 1P3BC 4YS3C 5B1MD 3R45B 4J8VB 4H9SA 3WKJA 5B1LB 2NQBA 4ZUXD 2FJ7B 2PYOC 5AV5C 5AVBC 3MNNC 1P3AD 3AZLB 4XZQB 1ID3D 5G49B 5B0ZC 1AOIC 3REHD 5DNMA 2JE5A 4XUJC 4WZSB 2ZY3A 1P3OB 1JFIB 5BNVB 3AL0C 5B2IC 1B67A 4Z5TD 1WWSA 4WU8D 3B0DC 3W96D 5GSUA 1AOIB 4J8XA 5GXQB 3AZNB 4X23A 5CPIA 4J8UA 5KDMB 2LY8A 3AV2A 5B32B 1KX4C 3MGRA 2BYMA 2F8NK 5C3IC 1M19C 4H9PA 4DRAA 4H9OA 4EO5B 5CPJB 2YFWA 4R8PA 3KUYD 1ID3A 4KGCD 3KXBC 5FUGA 3REHA 4Z66A 3WAAD 3LELC 3AZFB 3AZKD 3V9RB 2W8SA 5B0YC 5CP6B 1U35D 4Z5TA 4QLCB 4AWLB 4WU8A 2RVQD 3C1BC 1P3GD 5GT0C 2G5IC 3R45A 3W96A 3LZ0B 4J8VA 4LD9D 3W98B 1F66C 3UTBD 1EQZD 1KX3D 3AZGD 1KX5D 4NE5A 4XZQA 5CPKD 5G49A 3VH5A 3AV1B 5B40B 4CAYB 3B6GB 4JJND 3WA9C 2AROC 3KWQD 1P3MB 3A6ND 5E5AD 2F8NB 1BFMA 5AV6D 2XD1A 3AZMB 3EPLA 1P3KD 4KGCA 5DNNC 4YM6C 3MVDB 3WAAA 1TZYD 5B33C 3AYWB 3LJAD 3X1UB 1U35A 2NZDD 4WJ3C 2DQNC 3IP4C 5B31G 1P3GA 2Y2LA 3WKJC 4HGAC 4LD9A 1P34C 3X1SD 5JA4A 3UTBA 1EQZA 1KX3A 3REID 3AZGA 3B6FD 1KX5A 5B31D 3UT9C 2CV5D 3WKJB 4NE6A 5CPKA 3RELD 1M1AD 2NQBB 4JJNA 3AZEB 2Y2NA 3KWQA 3AZFA 3A6NA 5E5AA 5AV6A 5GSUC 3X1UD 1P3KA 4UUZA 5DNMB 1B6WA 1TZYA 4X23C 4DQYB 5CPIC 5AV8C 3LZ1C 4J8UC 3MGPB 2IO5C 1HQ3C 3AV2C 2NZDA 3MGRC 3B0CW 2Y2PA 5GSUB 2BYKA 4J8XB 5B40A 2Y2QA 5AVCC 3MGQD 3B6FA 1Q9CA 1KU5A 3REIA 5CPIB 4R8PC 1ID3C 5B1MB 5B31A 2ZM5A 1P3PD 3A1IA 2CV5A 4Z66C 2BYMB 3A1KA 3RELA 1R4VA 2VQRA 4H9PB 1M1AA 4ZUXB 3C1CC 3REJC 5F99D 1P3IC 3AYWA 3AZHD 4H9OB 4G92B 3TU4B 1P3AB 1P3FC 2YFWB 1ID3B 3X1UA 4J8VC 5FUGB 5B1LC 3REHB 3AFAD 3X1TD 2FJ7C 2JCHA 3AZLC 2CWEA 4Z5TB 4XZQC 4WU8B 3W96B 4NE3A 3AN2D 2Y2HA 2F2AC 2HIOD 3MGQA 1P3OC 3AZEA 3AZID 1H3OA 1PZRA 3TU4D
chains in the Genus database with same CATH topology
1F1EA 1P3PA 5GXQC 5F99A 3AZNC 3AZHA 4J8WD 5BO0A 3MGPA 3KUYB 4KGCB 3F6TA 5B32C 3W99D 1M18D 1ZLAD 3WAAB 3X1TA 3AZKB 4WU9D 4EO5C 3P5JB 5CPJC 5B2JD 1U35B 3AZJD 1P3GB 5B1MA 1BH8A 1W2EA 3W97D 4LD9B 4JJNC 1BH9A 5JA4B 3AZFC 5JRGD 2DF4C 4ZUXA 5E5AC 3UTBB 1EQZB 3AZIA 3AZGB 1KX3B 5CP6C 1KX5B 3TU4A 4QLCC 4AWLC 1P3AA 5AV9D 5CPKB 2YFVA 3LZ0C 2Y2KA 3W98C 3MGSD 4JJNB 1TAFA 3KWQB 4J8WA 3A6NB 5E5AB 3VH6A 5AV6B 3NQJB 1P3KB 3W99A 4UUZB 1M18A 3AV1C 5B40C 3WTPD 1ZLAA 1TZYB 3B6GC 3LJAB 3B6FC 1P3BD 4YS3D 4WU9A 1P3MC 5B2JA 2NZDB 3AZMC 3AZJA 3MVDC 2BYKB 3W97A 3X1SB 3AYWC 2PYOD 5AV5D 5AVBD 5JRGA 3MNND 3B6FB 3REIB 3X1UC 5B31B 5B0ZD 1S32D 2CV5B 3B0BA 5AV9A 3KUYA 3RELB 4XUJD 1M1AB 3MGSA 5B2ID 1ULYA 1Z2CB 3AZKA 2J8PA 2JSSA 4H9SC 3O62D 5BS7A 4E44A 3VH5W 2NQBC 2FFFB 3AZEC 1P3BA 4YS3A 1P3PC 2UWXA 1A7WA 1KX4D 1M19D 3EPJA 5DNMC 5F99C 1P3LB 2Y2GA 5AVBA 3MNNA 3MGQB 4H9NA 1H3OB 3MGPC 4ZBJB 3KXBD 5B0ZA 3UTAB 5BT1C 1S32A 1P3PB 3NQJA 3LELD 4J8XC 5F99B 5B0YD 3AZHB 3LJAA 5BO0B 3C1BD 5B1MC 4G91B 5GT0D 3REKD 4M6BA 3O62A 1F66D 3B0CT 4ZUXC 2Y2IA 3AFAB 3X1TB 1P3LD 3X1SA 3TU4C 4G92C 1P3AC 1KX4A 1BH8B 3UTAD 1M19A 3REHC 3AN2B 3WA9D 1BH9B 2AROD 2HIOB 3AZIB 4WNNA 4Z5TC 3KXBA 4WU8C 5DNND 4YM6D 1M18C 3X1VD 3W96C 2YFVB 3LELA 5B33D 1N1JA 1TAFB 5B0YA 4J8WB 3EPHA 3W97C 5AY8D 1M18B 3REKA 3W99B 1P34D 1ZLAB 5JRGC 1P3LA 3EPKA 4WU9B 3UT9D 5B2JB 3KUYC 3AZJB 4H9RA 2F8NH 4KGCC 2ZY5A 3UTAA 3MGSC 3W97B 3WAAC 3WA9A 2AROA 5JRGB 3AZKC 1U35C 4KUDD 2RVQC 3FDDA 5CHLB 5DNNA 4YM6A 1P3GC 5AV9B 3X1VA 5B33A 4LD9C 3MGSB 5AV8D 3LZ1D 4J8UD 3AFAA 3UTBC 1HQ3D 3AV2D 1KX3C 3AZGC 3H0RC 1EQZC 1KX5C 3MGRD 2BG1A 5AY8A 5CPKC 1P34A 3WTPB 5AVCD 3AN2A 1P3BB 4R8PD 2HIOA 4YS3B 3KWQC 3A6NC 3UT9A 4H9QA 5AV6C 1S32C 4Z2MH 4Z66D 1P3KC 5GT3D 4DRBA 3C1CD 3REJD 5B24D 1TZYC 1P3ID 3LJAC 2PYOB 5AV5B 5AVBB 3MNNB 1P3FD 4H9NB 2NZDC 5BNXA 4J8VD 4KUDA 5B0ZB 1S32B 1WWIA 5B1LD 3O62C 4XUJB 2FJ7D 3X1SC 5AV8A 5B2IB 3LZ1A 4KHAB 4E45A 3AZLD 1HQ3A 4XZQD 3REIC 4CSRA 3B0DB 5B31C 3H0LC 4UPKA 2CV5C 2RIQA 3RELC 3O62B 5AVCA 1M1AC 1P3OD 3WTPE 3NQUA 1KX4B 3VH6W 5B32G 5C3IB 1AOID 2G5HC 5GT3A 2HUEC 3VH6T 1M19B 3H0MC 3C1CA 5GXQD 5B24A 3REJA 3AZND 1T3UA 1P3IA 1P3FA 4WNNB 3KFUG 5B32D 3KXBB 3REKC 5B1LA 3LELB 2HUEB 1P3LC 2FJ7A 1N1JB 3WTPA 3MGQC 5B0YB 5CPJD 3AZLA 2Y2MA 3VH5T 3C1BB 5GT0B 4ZBJC 3UTAC 3REKB 1F66B 3AZFD 1P3OA 1JFIA 5BNVA 4WV4B 5CP6D 3AZHC 5AV5A 2PYOA 4QLCD 4G91C 3X1VC 2ZY2A 4H9RB 3LZ0D 1AOIA 3W98D 5GXQA 3AZNA 3WA9B 3AFAC 4XUJA 2AROB 3X1TC 5B2IA 4KHAA 5KDMA 2F8NG 5B32A 2Y2JA 5AY8C 5DNNB 4YM6B 3AV1D 5B40D 3X1VB 3B6GD 5B33B 3AN2C 2HIOC 1P3MD 5CPJA 2F8ND 3AZIC 3AZMD 3MVDD 4HGAB 5AY8B 1P34B 3AYWD 2ZY4A 3V9RA 3EG5B 5CP6A 4J8WC 4QLCA 4KUDC 3UT9B 2XD5A 4H9QB 3KSYA 4NFTA 3LZ0A 3W99C 3W98A 1ZLAC 4WU9C 4Z2MG 5B2JC 5BNXB 4KUDB 3WKJD 3AZJC 3C1BA 3AV1A 5GT0A 4CAYA 2L5AA 4X23B 1HTAA 2NQBD 3B6GA 3AZED 5AV8B 3LZ1B 1F66A 4J8UB 1P3MA 2IO5B 1HQ3B 3AV2B 2F8NA 4CSRB 3AZMA 3MGRB 5GT3C 3MVDA 5AV9C 5DNMD 5B24C 5AVCB 3MGPD 4R8PB 3NQUB 2Y2OA 5BT1D 4Z66B 5GSUD 5GT3B 4J8XD 5BS7C 3WTPC 3C1CB 5B24B 3REJB 4X23D 1P3IB 1P3FB 5CPID 1P3BC 4YS3C 5B1MD 3R45B 4J8VB 4H9SA 3WKJA 5B1LB 2NQBA 4ZUXD 2FJ7B 2PYOC 5AV5C 5AVBC 3MNNC 1P3AD 3AZLB 4XZQB 1ID3D 5G49B 5B0ZC 1AOIC 3REHD 5DNMA 2JE5A 4XUJC 4WZSB 2ZY3A 1P3OB 1JFIB 5BNVB 3AL0C 5B2IC 1B67A 4Z5TD 1WWSA 4WU8D 3B0DC 3W96D 5GSUA 1AOIB 4J8XA 5GXQB 3AZNB 4X23A 5CPIA 4J8UA 5KDMB 2LY8A 3AV2A 5B32B 1KX4C 3MGRA 2BYMA 2F8NK 5C3IC 1M19C 4H9PA 4DRAA 4H9OA 4EO5B 5CPJB 2YFWA 4R8PA 3KUYD 1ID3A 4KGCD 3KXBC 5FUGA 3REHA 4Z66A 3WAAD 3LELC 3AZFB 3AZKD 3V9RB 2W8SA 5B0YC 5CP6B 1U35D 4Z5TA 4QLCB 4AWLB 4WU8A 2RVQD 3C1BC 1P3GD 5GT0C 2G5IC 3R45A 3W96A 3LZ0B 4J8VA 4LD9D 3W98B 1F66C 3UTBD 1EQZD 1KX3D 3AZGD 1KX5D 4NE5A 4XZQA 5CPKD 5G49A 3VH5A 3AV1B 5B40B 4CAYB 3B6GB 4JJND 3WA9C 2AROC 3KWQD 1P3MB 3A6ND 5E5AD 2F8NB 1BFMA 5AV6D 2XD1A 3AZMB 3EPLA 1P3KD 4KGCA 5DNNC 4YM6C 3MVDB 3WAAA 1TZYD 5B33C 3AYWB 3LJAD 3X1UB 1U35A 2NZDD 4WJ3C 2DQNC 3IP4C 5B31G 1P3GA 2Y2LA 3WKJC 4HGAC 4LD9A 1P34C 3X1SD 5JA4A 3UTBA 1EQZA 1KX3A 3REID 3AZGA 3B6FD 1KX5A 5B31D 3UT9C 2CV5D 3WKJB 4NE6A 5CPKA 3RELD 1M1AD 2NQBB 4JJNA 3AZEB 2Y2NA 3KWQA 3AZFA 3A6NA 5E5AA 5AV6A 5GSUC 3X1UD 1P3KA 4UUZA 5DNMB 1B6WA 1TZYA 4X23C 4DQYB 5CPIC 5AV8C 3LZ1C 4J8UC 3MGPB 2IO5C 1HQ3C 3AV2C 2NZDA 3MGRC 3B0CW 2Y2PA 5GSUB 2BYKA 4J8XB 5B40A 2Y2QA 5AVCC 3MGQD 3B6FA 1Q9CA 1KU5A 3REIA 5CPIB 4R8PC 1ID3C 5B1MB 5B31A 2ZM5A 1P3PD 3A1IA 2CV5A 4Z66C 2BYMB 3A1KA 3RELA 1R4VA 2VQRA 4H9PB 1M1AA 4ZUXB 3C1CC 3REJC 5F99D 1P3IC 3AYWA 3AZHD 4H9OB 4G92B 3TU4B 1P3AB 1P3FC 2YFWB 1ID3B 3X1UA 4J8VC 5FUGB 5B1LC 3REHB 3AFAD 3X1TD 2FJ7C 2JCHA 3AZLC 2CWEA 4Z5TB 4XZQC 4WU8B 3W96B 4NE3A 3AN2D 2Y2HA 2F2AC 2HIOD 3MGQA 1P3OC 3AZEA 3AZID 1H3OA 1PZRA 3TU4D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F1E A;  1P3P A;  5GXQ C;  5F99 A;  3AZN C;  3AZH A;  4J8W D;  5BO0 A;  3MGP A;  3KUY B;  4KGC B;  5B32 C;  3W99 D;  1M18 D;  1ZLA D;  3WAA B;  3X1T A;  3AZK B;  4WU9 D;  4EO5 C;  5CPJ C;  5B2J D;  1U35 B;  3AZJ D;  1P3G B;  5B1M A;  1BH8 A;  3W97 D;  4LD9 B;  4JJN C;  1BH9 A;  5JA4 B;  3AZF C;  5JRG D;  3UTB B;  4ZUX A;  5E5A C;  1EQZ B;  3AZI A;  3AZG B;  1KX3 B;  5CP6 C;  1KX5 B;  3TU4 A;  4QLC C;  4AWL C;  1P3A A;  5AV9 D;  5CPK B;  2YFV A;  3LZ0 C;  3W98 C;  3MGS D;  4JJN B;  1TAF A;  3KWQ B;  4J8W A;  3A6N B;  5E5A B;  3VH6 A;  5AV6 B;  3NQJ B;  1P3K B;  3W99 A;  4UUZ B;  1M18 A;  3AV1 C;  5B40 C;  3WTP D;  1ZLA A;  1TZY B;  3B6G C;  3LJA B;  3B6F C;  1P3B D;  4YS3 D;  4WU9 A;  1P3M C;  5B2J A;  2NZD B;  3AZM C;  3AZJ A;  3MVD C;  2BYK B;  3W97 A;  3X1S B;  3AYW C;  2PYO D;  5AV5 D;  5AVB D;  5JRG A;  3MNN D;  3B6F B;  3REI B;  3X1U C;  5B31 B;  5B0Z D;  1S32 D;  2CV5 B;  3B0B A;  5AV9 A;  3KUY A;  3REL B;  4XUJ D;  1M1A B;  3MGS A;  5B2I D;  1ULY A;  3AZK A;  2JSS A;  4H9S C;  3O62 D;  5BS7 A;  4E44 A;  3VH5 W;  2NQB C;  3AZE C;  1P3B A;  4YS3 A;  1P3P C;  1KX4 D;  1A7W A;  1M19 D;  5DNM C;  5F99 C;  1P3L B;  5AVB A;  3MNN A;  3MGQ B;  4H9N A;  1H3O B;  3MGP C;  4ZBJ B;  3KXB D;  5B0Z A;  3UTA B;  5BT1 C;  1S32 A;  1P3P B;  3NQJ A;  3LEL D;  4J8X C;  5F99 B;  5B0Y D;  3AZH B;  3LJA A;  5BO0 B;  3C1B D;  5B1M C;  4G91 B;  5GT0 D;  3REK D;  4M6B A;  3O62 A;  1F66 D;  3B0C T;  4ZUX C;  3AFA B;  3X1T B;  1P3L D;  3X1S A;  3TU4 C;  4G92 C;  1P3A C;  1KX4 A;  1BH8 B;  3UTA D;  1M19 A;  3REH C;  3AN2 B;  3WA9 D;  1BH9 B;  2ARO D;  2HIO B;  3AZI B;  4WNN A;  4Z5T C;  3KXB A;  4WU8 C;  5DNN D;  4YM6 D;  1M18 C;  3X1V D;  3W96 C;  2YFV B;  3LEL A;  5B33 D;  1N1J A;  1TAF B;  5B0Y A;  4J8W B;  3W97 C;  5AY8 D;  1M18 B;  3REK A;  3W99 B;  1P34 D;  1ZLA B;  5JRG C;  1P3L A;  4WU9 B;  3UT9 D;  5B2J B;  3KUY C;  3AZJ B;  4H9R A;  2F8N H;  4KGC C;  3UTA A;  3MGS C;  3W97 B;  3WAA C;  3WA9 A;  2ARO A;  5JRG B;  3AZK C;  1U35 C;  4KUD D;  2RVQ C;  5CHL B;  5DNN A;  4YM6 A;  1P3G C;  5AV9 B;  3X1V A;  5B33 A;  4LD9 C;  3MGS B;  5AV8 D;  3LZ1 D;  4J8U D;  3AFA A;  3UTB C;  1HQ3 D;  3AV2 D;  1KX3 C;  3AZG C;  1EQZ C;  1KX5 C;  3MGR D;  5AY8 A;  5CPK C;  1P34 A;  3WTP B;  5AVC D;  3AN2 A;  1P3B B;  4R8P D;  2HIO A;  4YS3 B;  3KWQ C;  3A6N C;  3UT9 A;  4H9Q A;  5AV6 C;  1S32 C;  4Z2M H;  4Z66 D;  1P3K C;  5GT3 D;  4DRB A;  3C1C D;  3REJ D;  5B24 D;  1TZY C;  1P3I D;  3LJA C;  2PYO B;  5AV5 B;  5AVB B;  3MNN B;  1P3F D;  4H9N B;  2NZD C;  5BNX A;  4J8V D;  4KUD A;  5B0Z B;  1S32 B;  1WWI A;  5B1L D;  3O62 C;  4XUJ B;  2FJ7 D;  3X1S C;  5AV8 A;  5B2I B;  3LZ1 A;  4KHA B;  4E45 A;  3AZL D;  1HQ3 A;  4XZQ D;  3REI C;  4CSR A;  3B0D B;  5B31 C;  2CV5 C;  3REL C;  3O62 B;  5AVC A;  1M1A C;  1P3O D;  3WTP E;  3NQU A;  1KX4 B;  3VH6 W;  5B32 G;  5C3I B;  1AOI D;  5GT3 A;  1M19 B;  2HUE C;  3VH6 T;  3C1C A;  5GXQ D;  5B24 A;  3REJ A;  3AZN D;  1P3I A;  1P3F A;  4WNN B;  5B32 D;  3KXB B;  3REK C;  5B1L A;  3LEL B;  2HUE B;  1P3L C;  2FJ7 A;  1N1J B;  3WTP A;  3MGQ C;  5B0Y B;  5CPJ D;  3AZL A;  3VH5 T;  3C1B B;  5GT0 B;  4ZBJ C;  3UTA C;  3REK B;  1F66 B;  3AZF D;  1P3O A;  1JFI A;  5BNV A;  4WV4 B;  5CP6 D;  3AZH C;  5AV5 A;  2PYO A;  4QLC D;  4G91 C;  3X1V C;  4H9R B;  3LZ0 D;  1AOI A;  3W98 D;  5GXQ A;  3AZN A;  3WA9 B;  3AFA C;  4XUJ A;  2ARO B;  3X1T C;  5B2I A;  4KHA A;  5KDM A;  2F8N G;  5B32 A;  5AY8 C;  5DNN B;  4YM6 B;  3AV1 D;  5B40 D;  3X1V B;  3B6G D;  5B33 B;  3AN2 C;  2HIO C;  1P3M D;  5CPJ A;  2F8N D;  3AZI C;  3AZM D;  3MVD D;  4HGA B;  5AY8 B;  1P34 B;  3AYW D;  3V9R A;  5CP6 A;  4J8W C;  4QLC A;  4KUD C;  3UT9 B;  4H9Q B;  3KSY A;  4NFT A;  3LZ0 A;  3W99 C;  3W98 A;  1ZLA C;  4WU9 C;  4Z2M G;  5B2J C;  5BNX B;  4KUD B;  3WKJ D;  3AZJ C;  3C1B A;  3AV1 A;  5GT0 A;  4CAY A;  2L5A A;  4X23 B;  1HTA A;  2NQB D;  3B6G A;  3AZE D;  5AV8 B;  3LZ1 B;  1F66 A;  4J8U B;  1P3M A;  2IO5 B;  1HQ3 B;  3AV2 B;  2F8N A;  4CSR B;  3AZM A;  3MGR B;  5GT3 C;  3MVD A;  5AV9 C;  5DNM D;  5B24 C;  5AVC B;  3MGP D;  4R8P B;  3NQU B;  5BT1 D;  4Z66 B;  5GSU D;  5GT3 B;  4J8X D;  5BS7 C;  3WTP C;  3C1C B;  5B24 B;  3REJ B;  4X23 D;  1P3I B;  1P3F B;  5CPI D;  1P3B C;  4YS3 C;  5B1M D;  3R45 B;  4J8V B;  4H9S A;  3WKJ A;  5B1L B;  2NQB A;  4ZUX D;  2FJ7 B;  2PYO C;  5AV5 C;  5AVB C;  3MNN C;  1P3A D;  3AZL B;  4XZQ B;  1ID3 D;  5G49 B;  5B0Z C;  1AOI C;  3REH D;  5DNM A;  4XUJ C;  4WZS B;  1P3O B;  1JFI B;  5BNV B;  5B2I C;  1B67 A;  4Z5T D;  1WWS A;  4WU8 D;  3B0D C;  3W96 D;  5GSU A;  1AOI B;  4J8X A;  5GXQ B;  3AZN B;  4X23 A;  5CPI A;  4J8U A;  5KDM B;  2LY8 A;  3AV2 A;  5B32 B;  1KX4 C;  3MGR A;  2BYM A;  2F8N K;  5C3I C;  1M19 C;  4H9P A;  4DRA A;  4H9O A;  4EO5 B;  5CPJ B;  2YFW A;  4R8P A;  3KUY D;  1ID3 A;  4KGC D;  3KXB C;  5FUG A;  3REH A;  4Z66 A;  3WAA D;  3LEL C;  3AZF B;  3AZK D;  3V9R B;  5B0Y C;  5CP6 B;  1U35 D;  4Z5T A;  4QLC B;  4AWL B;  4WU8 A;  2RVQ D;  3C1B C;  1P3G D;  5GT0 C;  3R45 A;  3W96 A;  3LZ0 B;  4J8V A;  4LD9 D;  3W98 B;  1F66 C;  3UTB D;  1EQZ D;  1KX3 D;  3AZG D;  1KX5 D;  4NE5 A;  4XZQ A;  5CPK D;  5G49 A;  3VH5 A;  3AV1 B;  5B40 B;  4CAY B;  3B6G B;  4JJN D;  3WA9 C;  2ARO C;  3KWQ D;  1P3M B;  3A6N D;  5E5A D;  2F8N B;  1BFM A;  5AV6 D;  3AZM B;  1P3K D;  4KGC A;  5DNN C;  4YM6 C;  3MVD B;  3WAA A;  1TZY D;  5B33 C;  3AYW B;  3LJA D;  3X1U B;  1U35 A;  2NZD D;  3WKJ C;  5B31 G;  1P3G A;  4HGA C;  4LD9 A;  1P34 C;  3X1S D;  5JA4 A;  3UTB A;  1EQZ A;  1KX3 A;  3REI D;  3AZG A;  3B6F D;  1KX5 A;  5B31 D;  3UT9 C;  2CV5 D;  3WKJ B;  4NE6 A;  5CPK A;  3REL D;  1M1A D;  2NQB B;  4JJN A;  3AZE B;  3KWQ A;  3AZF A;  3A6N A;  5E5A A;  5AV6 A;  5GSU C;  3X1U D;  1P3K A;  4UUZ A;  5DNM B;  1B6W A;  1TZY A;  4X23 C;  5CPI C;  5AV8 C;  3LZ1 C;  4J8U C;  3MGP B;  2IO5 C;  1HQ3 C;  3AV2 C;  2NZD A;  3MGR C;  3B0C W;  5GSU B;  2BYK A;  4J8X B;  5B40 A;  5AVC C;  3MGQ D;  3B6F A;  1Q9C A;  1KU5 A;  3REI A;  5CPI B;  4R8P C;  1ID3 C;  5B1M B;  5B31 A;  1P3P D;  2CV5 A;  4Z66 C;  2BYM B;  3REL A;  1R4V A;  4H9P B;  1M1A A;  4ZUX B;  3C1C C;  3REJ C;  5F99 D;  1P3I C;  3AYW A;  3AZH D;  4H9O B;  4G92 B;  3TU4 B;  1P3A B;  1P3F C;  2YFW B;  1ID3 B;  3X1U A;  4J8V C;  5FUG B;  5B1L C;  3REH B;  3AFA D;  3X1T D;  2FJ7 C;  3AZL C;  2CWE A;  4Z5T B;  4XZQ C;  4WU8 B;  3W96 B;  4NE3 A;  3AN2 D;  2HIO D;  3MGQ A;  1P3O C;  3AZE A;  3AZI D;  1H3O A;  3TU4 D; 
#chains in the Genus database with same CATH topology
 1F1E A;  1P3P A;  5GXQ C;  5F99 A;  3AZN C;  3AZH A;  4J8W D;  5BO0 A;  3MGP A;  3KUY B;  4KGC B;  3F6T A;  5B32 C;  3W99 D;  1M18 D;  1ZLA D;  3WAA B;  3X1T A;  3AZK B;  4WU9 D;  4EO5 C;  3P5J B;  5CPJ C;  5B2J D;  1U35 B;  3AZJ D;  1P3G B;  5B1M A;  1BH8 A;  1W2E A;  3W97 D;  4LD9 B;  4JJN C;  1BH9 A;  5JA4 B;  3AZF C;  5JRG D;  2DF4 C;  4ZUX A;  5E5A C;  3UTB B;  1EQZ B;  3AZI A;  3AZG B;  1KX3 B;  5CP6 C;  1KX5 B;  3TU4 A;  4QLC C;  4AWL C;  1P3A A;  5AV9 D;  5CPK B;  2YFV A;  3LZ0 C;  2Y2K A;  3W98 C;  3MGS D;  4JJN B;  1TAF A;  3KWQ B;  4J8W A;  3A6N B;  5E5A B;  3VH6 A;  5AV6 B;  3NQJ B;  1P3K B;  3W99 A;  4UUZ B;  1M18 A;  3AV1 C;  5B40 C;  3WTP D;  1ZLA A;  1TZY B;  3B6G C;  3LJA B;  3B6F C;  1P3B D;  4YS3 D;  4WU9 A;  1P3M C;  5B2J A;  2NZD B;  3AZM C;  3AZJ A;  3MVD C;  2BYK B;  3W97 A;  3X1S B;  3AYW C;  2PYO D;  5AV5 D;  5AVB D;  5JRG A;  3MNN D;  3B6F B;  3REI B;  3X1U C;  5B31 B;  5B0Z D;  1S32 D;  2CV5 B;  3B0B A;  5AV9 A;  3KUY A;  3REL B;  4XUJ D;  1M1A B;  3MGS A;  5B2I D;  1ULY A;  1Z2C B;  3AZK A;  2J8P A;  2JSS A;  4H9S C;  3O62 D;  5BS7 A;  4E44 A;  3VH5 W;  2NQB C;  2FFF B;  3AZE C;  1P3B A;  4YS3 A;  1P3P C;  2UWX A;  1A7W A;  1KX4 D;  1M19 D;  3EPJ A;  5DNM C;  5F99 C;  1P3L B;  2Y2G A;  5AVB A;  3MNN A;  3MGQ B;  4H9N A;  1H3O B;  3MGP C;  4ZBJ B;  3KXB D;  5B0Z A;  3UTA B;  5BT1 C;  1S32 A;  1P3P B;  3NQJ A;  3LEL D;  4J8X C;  5F99 B;  5B0Y D;  3AZH B;  3LJA A;  5BO0 B;  3C1B D;  5B1M C;  4G91 B;  5GT0 D;  3REK D;  4M6B A;  3O62 A;  1F66 D;  3B0C T;  4ZUX C;  2Y2I A;  3AFA B;  3X1T B;  1P3L D;  3X1S A;  3TU4 C;  4G92 C;  1P3A C;  1KX4 A;  1BH8 B;  3UTA D;  1M19 A;  3REH C;  3AN2 B;  3WA9 D;  1BH9 B;  2ARO D;  2HIO B;  3AZI B;  4WNN A;  4Z5T C;  3KXB A;  4WU8 C;  5DNN D;  4YM6 D;  1M18 C;  3X1V D;  3W96 C;  2YFV B;  3LEL A;  5B33 D;  1N1J A;  1TAF B;  5B0Y A;  4J8W B;  3EPH A;  3W97 C;  5AY8 D;  1M18 B;  3REK A;  3W99 B;  1P34 D;  1ZLA B;  5JRG C;  1P3L A;  3EPK A;  4WU9 B;  3UT9 D;  5B2J B;  3KUY C;  3AZJ B;  4H9R A;  2F8N H;  4KGC C;  2ZY5 A;  3UTA A;  3MGS C;  3W97 B;  3WAA C;  3WA9 A;  2ARO A;  5JRG B;  3AZK C;  1U35 C;  4KUD D;  2RVQ C;  3FDD A;  5CHL B;  5DNN A;  4YM6 A;  1P3G C;  5AV9 B;  3X1V A;  5B33 A;  4LD9 C;  3MGS B;  5AV8 D;  3LZ1 D;  4J8U D;  3AFA A;  3UTB C;  1HQ3 D;  3AV2 D;  1KX3 C;  3AZG C;  3H0R C;  1EQZ C;  1KX5 C;  3MGR D;  2BG1 A;  5AY8 A;  5CPK C;  1P34 A;  3WTP B;  5AVC D;  3AN2 A;  1P3B B;  4R8P D;  2HIO A;  4YS3 B;  3KWQ C;  3A6N C;  3UT9 A;  4H9Q A;  5AV6 C;  1S32 C;  4Z2M H;  4Z66 D;  1P3K C;  5GT3 D;  4DRB A;  3C1C D;  3REJ D;  5B24 D;  1TZY C;  1P3I D;  3LJA C;  2PYO B;  5AV5 B;  5AVB B;  3MNN B;  1P3F D;  4H9N B;  2NZD C;  5BNX A;  4J8V D;  4KUD A;  5B0Z B;  1S32 B;  1WWI A;  5B1L D;  3O62 C;  4XUJ B;  2FJ7 D;  3X1S C;  5AV8 A;  5B2I B;  3LZ1 A;  4KHA B;  4E45 A;  3AZL D;  1HQ3 A;  4XZQ D;  3REI C;  4CSR A;  3B0D B;  5B31 C;  3H0L C;  4UPK A;  2CV5 C;  2RIQ A;  3REL C;  3O62 B;  5AVC A;  1M1A C;  1P3O D;  3WTP E;  3NQU A;  1KX4 B;  3VH6 W;  5B32 G;  5C3I B;  1AOI D;  2G5H C;  5GT3 A;  2HUE C;  3VH6 T;  1M19 B;  3H0M C;  3C1C A;  5GXQ D;  5B24 A;  3REJ A;  3AZN D;  1T3U A;  1P3I A;  1P3F A;  4WNN B;  3KFU G;  5B32 D;  3KXB B;  3REK C;  5B1L A;  3LEL B;  2HUE B;  1P3L C;  2FJ7 A;  1N1J B;  3WTP A;  3MGQ C;  5B0Y B;  5CPJ D;  3AZL A;  2Y2M A;  3VH5 T;  3C1B B;  5GT0 B;  4ZBJ C;  3UTA C;  3REK B;  1F66 B;  3AZF D;  1P3O A;  1JFI A;  5BNV A;  4WV4 B;  5CP6 D;  3AZH C;  5AV5 A;  2PYO A;  4QLC D;  4G91 C;  3X1V C;  2ZY2 A;  4H9R B;  3LZ0 D;  1AOI A;  3W98 D;  5GXQ A;  3AZN A;  3WA9 B;  3AFA C;  4XUJ A;  2ARO B;  3X1T C;  5B2I A;  4KHA A;  5KDM A;  2F8N G;  5B32 A;  2Y2J A;  5AY8 C;  5DNN B;  4YM6 B;  3AV1 D;  5B40 D;  3X1V B;  3B6G D;  5B33 B;  3AN2 C;  2HIO C;  1P3M D;  5CPJ A;  2F8N D;  3AZI C;  3AZM D;  3MVD D;  4HGA B;  5AY8 B;  1P34 B;  3AYW D;  2ZY4 A;  3V9R A;  3EG5 B;  5CP6 A;  4J8W C;  4QLC A;  4KUD C;  3UT9 B;  2XD5 A;  4H9Q B;  3KSY A;  4NFT A;  3LZ0 A;  3W99 C;  3W98 A;  1ZLA C;  4WU9 C;  4Z2M G;  5B2J C;  5BNX B;  4KUD B;  3WKJ D;  3AZJ C;  3C1B A;  3AV1 A;  5GT0 A;  4CAY A;  2L5A A;  4X23 B;  1HTA A;  2NQB D;  3B6G A;  3AZE D;  5AV8 B;  3LZ1 B;  1F66 A;  4J8U B;  1P3M A;  2IO5 B;  1HQ3 B;  3AV2 B;  2F8N A;  4CSR B;  3AZM A;  3MGR B;  5GT3 C;  3MVD A;  5AV9 C;  5DNM D;  5B24 C;  5AVC B;  3MGP D;  4R8P B;  3NQU B;  2Y2O A;  5BT1 D;  4Z66 B;  5GSU D;  5GT3 B;  4J8X D;  5BS7 C;  3WTP C;  3C1C B;  5B24 B;  3REJ B;  4X23 D;  1P3I B;  1P3F B;  5CPI D;  1P3B C;  4YS3 C;  5B1M D;  3R45 B;  4J8V B;  4H9S A;  3WKJ A;  5B1L B;  2NQB A;  4ZUX D;  2FJ7 B;  2PYO C;  5AV5 C;  5AVB C;  3MNN C;  1P3A D;  3AZL B;  4XZQ B;  1ID3 D;  5G49 B;  5B0Z C;  1AOI C;  3REH D;  5DNM A;  2JE5 A;  4XUJ C;  4WZS B;  2ZY3 A;  1P3O B;  1JFI B;  5BNV B;  3AL0 C;  5B2I C;  1B67 A;  4Z5T D;  1WWS A;  4WU8 D;  3B0D C;  3W96 D;  5GSU A;  1AOI B;  4J8X A;  5GXQ B;  3AZN B;  4X23 A;  5CPI A;  4J8U A;  5KDM B;  2LY8 A;  3AV2 A;  5B32 B;  1KX4 C;  3MGR A;  2BYM A;  2F8N K;  5C3I C;  1M19 C;  4H9P A;  4DRA A;  4H9O A;  4EO5 B;  5CPJ B;  2YFW A;  4R8P A;  3KUY D;  1ID3 A;  4KGC D;  3KXB C;  5FUG A;  3REH A;  4Z66 A;  3WAA D;  3LEL C;  3AZF B;  3AZK D;  3V9R B;  2W8S A;  5B0Y C;  5CP6 B;  1U35 D;  4Z5T A;  4QLC B;  4AWL B;  4WU8 A;  2RVQ D;  3C1B C;  1P3G D;  5GT0 C;  2G5I C;  3R45 A;  3W96 A;  3LZ0 B;  4J8V A;  4LD9 D;  3W98 B;  1F66 C;  3UTB D;  1EQZ D;  1KX3 D;  3AZG D;  1KX5 D;  4NE5 A;  4XZQ A;  5CPK D;  5G49 A;  3VH5 A;  3AV1 B;  5B40 B;  4CAY B;  3B6G B;  4JJN D;  3WA9 C;  2ARO C;  3KWQ D;  1P3M B;  3A6N D;  5E5A D;  2F8N B;  1BFM A;  5AV6 D;  2XD1 A;  3AZM B;  3EPL A;  1P3K D;  4KGC A;  5DNN C;  4YM6 C;  3MVD B;  3WAA A;  1TZY D;  5B33 C;  3AYW B;  3LJA D;  3X1U B;  1U35 A;  2NZD D;  4WJ3 C;  2DQN C;  3IP4 C;  5B31 G;  1P3G A;  2Y2L A;  3WKJ C;  4HGA C;  4LD9 A;  1P34 C;  3X1S D;  5JA4 A;  3UTB A;  1EQZ A;  1KX3 A;  3REI D;  3AZG A;  3B6F D;  1KX5 A;  5B31 D;  3UT9 C;  2CV5 D;  3WKJ B;  4NE6 A;  5CPK A;  3REL D;  1M1A D;  2NQB B;  4JJN A;  3AZE B;  2Y2N A;  3KWQ A;  3AZF A;  3A6N A;  5E5A A;  5AV6 A;  5GSU C;  3X1U D;  1P3K A;  4UUZ A;  5DNM B;  1B6W A;  1TZY A;  4X23 C;  4DQY B;  5CPI C;  5AV8 C;  3LZ1 C;  4J8U C;  3MGP B;  2IO5 C;  1HQ3 C;  3AV2 C;  2NZD A;  3MGR C;  3B0C W;  2Y2P A;  5GSU B;  2BYK A;  4J8X B;  5B40 A;  2Y2Q A;  5AVC C;  3MGQ D;  3B6F A;  1Q9C A;  1KU5 A;  3REI A;  5CPI B;  4R8P C;  1ID3 C;  5B1M B;  5B31 A;  2ZM5 A;  1P3P D;  3A1I A;  2CV5 A;  4Z66 C;  2BYM B;  3A1K A;  3REL A;  1R4V A;  2VQR A;  4H9P B;  1M1A A;  4ZUX B;  3C1C C;  3REJ C;  5F99 D;  1P3I C;  3AYW A;  3AZH D;  4H9O B;  4G92 B;  3TU4 B;  1P3A B;  1P3F C;  2YFW B;  1ID3 B;  3X1U A;  4J8V C;  5FUG B;  5B1L C;  3REH B;  3AFA D;  3X1T D;  2FJ7 C;  2JCH A;  3AZL C;  2CWE A;  4Z5T B;  4XZQ C;  4WU8 B;  3W96 B;  4NE3 A;  3AN2 D;  2Y2H A;  2F2A C;  2HIO D;  3MGQ A;  1P3O C;  3AZE A;  3AZI D;  1H3O A;  1PZR A;  3TU4 D; 
#chains in the Genus database with same CATH homology
 1F1E A;  1P3P A;  5GXQ C;  5F99 A;  3AZN C;  3AZH A;  4J8W D;  5BO0 A;  3MGP A;  3KUY B;  4KGC B;  3F6T A;  5B32 C;  3W99 D;  1M18 D;  1ZLA D;  3WAA B;  3X1T A;  3AZK B;  4WU9 D;  4EO5 C;  3P5J B;  5CPJ C;  5B2J D;  1U35 B;  3AZJ D;  1P3G B;  5B1M A;  1BH8 A;  1W2E A;  3W97 D;  4LD9 B;  4JJN C;  1BH9 A;  5JA4 B;  3AZF C;  5JRG D;  2DF4 C;  4ZUX A;  5E5A C;  3UTB B;  1EQZ B;  3AZI A;  3AZG B;  1KX3 B;  5CP6 C;  1KX5 B;  3TU4 A;  4QLC C;  4AWL C;  1P3A A;  5AV9 D;  5CPK B;  2YFV A;  3LZ0 C;  2Y2K A;  3W98 C;  3MGS D;  4JJN B;  1TAF A;  3KWQ B;  4J8W A;  3A6N B;  5E5A B;  3VH6 A;  5AV6 B;  3NQJ B;  1P3K B;  3W99 A;  4UUZ B;  1M18 A;  3AV1 C;  5B40 C;  3WTP D;  1ZLA A;  1TZY B;  3B6G C;  3LJA B;  3B6F C;  1P3B D;  4YS3 D;  4WU9 A;  1P3M C;  5B2J A;  2NZD B;  3AZM C;  3AZJ A;  3MVD C;  2BYK B;  3W97 A;  3X1S B;  3AYW C;  2PYO D;  5AV5 D;  5AVB D;  5JRG A;  3MNN D;  3B6F B;  3REI B;  3X1U C;  5B31 B;  5B0Z D;  1S32 D;  2CV5 B;  3B0B A;  5AV9 A;  3KUY A;  3REL B;  4XUJ D;  1M1A B;  3MGS A;  5B2I D;  1ULY A;  1Z2C B;  3AZK A;  2J8P A;  2JSS A;  4H9S C;  3O62 D;  5BS7 A;  4E44 A;  3VH5 W;  2NQB C;  2FFF B;  3AZE C;  1P3B A;  4YS3 A;  1P3P C;  2UWX A;  1A7W A;  1KX4 D;  1M19 D;  3EPJ A;  5DNM C;  5F99 C;  1P3L B;  2Y2G A;  5AVB A;  3MNN A;  3MGQ B;  4H9N A;  1H3O B;  3MGP C;  4ZBJ B;  3KXB D;  5B0Z A;  3UTA B;  5BT1 C;  1S32 A;  1P3P B;  3NQJ A;  3LEL D;  4J8X C;  5F99 B;  5B0Y D;  3AZH B;  3LJA A;  5BO0 B;  3C1B D;  5B1M C;  4G91 B;  5GT0 D;  3REK D;  4M6B A;  3O62 A;  1F66 D;  3B0C T;  4ZUX C;  2Y2I A;  3AFA B;  3X1T B;  1P3L D;  3X1S A;  3TU4 C;  4G92 C;  1P3A C;  1KX4 A;  1BH8 B;  3UTA D;  1M19 A;  3REH C;  3AN2 B;  3WA9 D;  1BH9 B;  2ARO D;  2HIO B;  3AZI B;  4WNN A;  4Z5T C;  3KXB A;  4WU8 C;  5DNN D;  4YM6 D;  1M18 C;  3X1V D;  3W96 C;  2YFV B;  3LEL A;  5B33 D;  1N1J A;  1TAF B;  5B0Y A;  4J8W B;  3EPH A;  3W97 C;  5AY8 D;  1M18 B;  3REK A;  3W99 B;  1P34 D;  1ZLA B;  5JRG C;  1P3L A;  3EPK A;  4WU9 B;  3UT9 D;  5B2J B;  3KUY C;  3AZJ B;  4H9R A;  2F8N H;  4KGC C;  2ZY5 A;  3UTA A;  3MGS C;  3W97 B;  3WAA C;  3WA9 A;  2ARO A;  5JRG B;  3AZK C;  1U35 C;  4KUD D;  2RVQ C;  3FDD A;  5CHL B;  5DNN A;  4YM6 A;  1P3G C;  5AV9 B;  3X1V A;  5B33 A;  4LD9 C;  3MGS B;  5AV8 D;  3LZ1 D;  4J8U D;  3AFA A;  3UTB C;  1HQ3 D;  3AV2 D;  1KX3 C;  3AZG C;  3H0R C;  1EQZ C;  1KX5 C;  3MGR D;  2BG1 A;  5AY8 A;  5CPK C;  1P34 A;  3WTP B;  5AVC D;  3AN2 A;  1P3B B;  4R8P D;  2HIO A;  4YS3 B;  3KWQ C;  3A6N C;  3UT9 A;  4H9Q A;  5AV6 C;  1S32 C;  4Z2M H;  4Z66 D;  1P3K C;  5GT3 D;  4DRB A;  3C1C D;  3REJ D;  5B24 D;  1TZY C;  1P3I D;  3LJA C;  2PYO B;  5AV5 B;  5AVB B;  3MNN B;  1P3F D;  4H9N B;  2NZD C;  5BNX A;  4J8V D;  4KUD A;  5B0Z B;  1S32 B;  1WWI A;  5B1L D;  3O62 C;  4XUJ B;  2FJ7 D;  3X1S C;  5AV8 A;  5B2I B;  3LZ1 A;  4KHA B;  4E45 A;  3AZL D;  1HQ3 A;  4XZQ D;  3REI C;  4CSR A;  3B0D B;  5B31 C;  3H0L C;  4UPK A;  2CV5 C;  2RIQ A;  3REL C;  3O62 B;  5AVC A;  1M1A C;  1P3O D;  3WTP E;  3NQU A;  1KX4 B;  3VH6 W;  5B32 G;  5C3I B;  1AOI D;  2G5H C;  5GT3 A;  2HUE C;  3VH6 T;  1M19 B;  3H0M C;  3C1C A;  5GXQ D;  5B24 A;  3REJ A;  3AZN D;  1T3U A;  1P3I A;  1P3F A;  4WNN B;  3KFU G;  5B32 D;  3KXB B;  3REK C;  5B1L A;  3LEL B;  2HUE B;  1P3L C;  2FJ7 A;  1N1J B;  3WTP A;  3MGQ C;  5B0Y B;  5CPJ D;  3AZL A;  2Y2M A;  3VH5 T;  3C1B B;  5GT0 B;  4ZBJ C;  3UTA C;  3REK B;  1F66 B;  3AZF D;  1P3O A;  1JFI A;  5BNV A;  4WV4 B;  5CP6 D;  3AZH C;  5AV5 A;  2PYO A;  4QLC D;  4G91 C;  3X1V C;  2ZY2 A;  4H9R B;  3LZ0 D;  1AOI A;  3W98 D;  5GXQ A;  3AZN A;  3WA9 B;  3AFA C;  4XUJ A;  2ARO B;  3X1T C;  5B2I A;  4KHA A;  5KDM A;  2F8N G;  5B32 A;  2Y2J A;  5AY8 C;  5DNN B;  4YM6 B;  3AV1 D;  5B40 D;  3X1V B;  3B6G D;  5B33 B;  3AN2 C;  2HIO C;  1P3M D;  5CPJ A;  2F8N D;  3AZI C;  3AZM D;  3MVD D;  4HGA B;  5AY8 B;  1P34 B;  3AYW D;  2ZY4 A;  3V9R A;  3EG5 B;  5CP6 A;  4J8W C;  4QLC A;  4KUD C;  3UT9 B;  2XD5 A;  4H9Q B;  3KSY A;  4NFT A;  3LZ0 A;  3W99 C;  3W98 A;  1ZLA C;  4WU9 C;  4Z2M G;  5B2J C;  5BNX B;  4KUD B;  3WKJ D;  3AZJ C;  3C1B A;  3AV1 A;  5GT0 A;  4CAY A;  2L5A A;  4X23 B;  1HTA A;  2NQB D;  3B6G A;  3AZE D;  5AV8 B;  3LZ1 B;  1F66 A;  4J8U B;  1P3M A;  2IO5 B;  1HQ3 B;  3AV2 B;  2F8N A;  4CSR B;  3AZM A;  3MGR B;  5GT3 C;  3MVD A;  5AV9 C;  5DNM D;  5B24 C;  5AVC B;  3MGP D;  4R8P B;  3NQU B;  2Y2O A;  5BT1 D;  4Z66 B;  5GSU D;  5GT3 B;  4J8X D;  5BS7 C;  3WTP C;  3C1C B;  5B24 B;  3REJ B;  4X23 D;  1P3I B;  1P3F B;  5CPI D;  1P3B C;  4YS3 C;  5B1M D;  3R45 B;  4J8V B;  4H9S A;  3WKJ A;  5B1L B;  2NQB A;  4ZUX D;  2FJ7 B;  2PYO C;  5AV5 C;  5AVB C;  3MNN C;  1P3A D;  3AZL B;  4XZQ B;  1ID3 D;  5G49 B;  5B0Z C;  1AOI C;  3REH D;  5DNM A;  2JE5 A;  4XUJ C;  4WZS B;  2ZY3 A;  1P3O B;  1JFI B;  5BNV B;  3AL0 C;  5B2I C;  1B67 A;  4Z5T D;  1WWS A;  4WU8 D;  3B0D C;  3W96 D;  5GSU A;  1AOI B;  4J8X A;  5GXQ B;  3AZN B;  4X23 A;  5CPI A;  4J8U A;  5KDM B;  2LY8 A;  3AV2 A;  5B32 B;  1KX4 C;  3MGR A;  2BYM A;  2F8N K;  5C3I C;  1M19 C;  4H9P A;  4DRA A;  4H9O A;  4EO5 B;  5CPJ B;  2YFW A;  4R8P A;  3KUY D;  1ID3 A;  4KGC D;  3KXB C;  5FUG A;  3REH A;  4Z66 A;  3WAA D;  3LEL C;  3AZF B;  3AZK D;  3V9R B;  2W8S A;  5B0Y C;  5CP6 B;  1U35 D;  4Z5T A;  4QLC B;  4AWL B;  4WU8 A;  2RVQ D;  3C1B C;  1P3G D;  5GT0 C;  2G5I C;  3R45 A;  3W96 A;  3LZ0 B;  4J8V A;  4LD9 D;  3W98 B;  1F66 C;  3UTB D;  1EQZ D;  1KX3 D;  3AZG D;  1KX5 D;  4NE5 A;  4XZQ A;  5CPK D;  5G49 A;  3VH5 A;  3AV1 B;  5B40 B;  4CAY B;  3B6G B;  4JJN D;  3WA9 C;  2ARO C;  3KWQ D;  1P3M B;  3A6N D;  5E5A D;  2F8N B;  1BFM A;  5AV6 D;  2XD1 A;  3AZM B;  3EPL A;  1P3K D;  4KGC A;  5DNN C;  4YM6 C;  3MVD B;  3WAA A;  1TZY D;  5B33 C;  3AYW B;  3LJA D;  3X1U B;  1U35 A;  2NZD D;  4WJ3 C;  2DQN C;  3IP4 C;  5B31 G;  1P3G A;  2Y2L A;  3WKJ C;  4HGA C;  4LD9 A;  1P34 C;  3X1S D;  5JA4 A;  3UTB A;  1EQZ A;  1KX3 A;  3REI D;  3AZG A;  3B6F D;  1KX5 A;  5B31 D;  3UT9 C;  2CV5 D;  3WKJ B;  4NE6 A;  5CPK A;  3REL D;  1M1A D;  2NQB B;  4JJN A;  3AZE B;  2Y2N A;  3KWQ A;  3AZF A;  3A6N A;  5E5A A;  5AV6 A;  5GSU C;  3X1U D;  1P3K A;  4UUZ A;  5DNM B;  1B6W A;  1TZY A;  4X23 C;  4DQY B;  5CPI C;  5AV8 C;  3LZ1 C;  4J8U C;  3MGP B;  2IO5 C;  1HQ3 C;  3AV2 C;  2NZD A;  3MGR C;  3B0C W;  2Y2P A;  5GSU B;  2BYK A;  4J8X B;  5B40 A;  2Y2Q A;  5AVC C;  3MGQ D;  3B6F A;  1Q9C A;  1KU5 A;  3REI A;  5CPI B;  4R8P C;  1ID3 C;  5B1M B;  5B31 A;  2ZM5 A;  1P3P D;  3A1I A;  2CV5 A;  4Z66 C;  2BYM B;  3A1K A;  3REL A;  1R4V A;  2VQR A;  4H9P B;  1M1A A;  4ZUX B;  3C1C C;  3REJ C;  5F99 D;  1P3I C;  3AYW A;  3AZH D;  4H9O B;  4G92 B;  3TU4 B;  1P3A B;  1P3F C;  2YFW B;  1ID3 B;  3X1U A;  4J8V C;  5FUG B;  5B1L C;  3REH B;  3AFA D;  3X1T D;  2FJ7 C;  2JCH A;  3AZL C;  2CWE A;  4Z5T B;  4XZQ C;  4WU8 B;  3W96 B;  4NE3 A;  3AN2 D;  2Y2H A;  2F2A C;  2HIO D;  3MGQ A;  1P3O C;  3AZE A;  3AZI D;  1H3O A;  1PZR A;  3TU4 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...