2PYPA

Photoactive yellow protein, photostationary state, 50% ground state, 50% bleached
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Structure of a protein photocycle intermediate by millisecond time-resolved crystallography.
pubmed doi rcsb
molecule tags Photoreceptor
total genus 35
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1997-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2pypA00
4HP4A 3LIAA 4L9EA 5DKLA 1TS7A 1T1BA 5A8BA 1XFNA 3NOPC 1N9NA 3MQQA 5AVEA 4H6JB 4EQ1A 3LI9A 5G4YA 4LRXC 1F98A 1OJ5A 4NXBA 4WN5A 1JNUA 5J7EA 2JN7A 1OT6A 5HSQA 4LLOB 4R70A 2PR5A 3ICYA 4GHIB 1V9YA 2KDKA 4HY8A 4NXFA 4E04A 3IS2A 3LUQA 5I5LA 5HDDA 1XJ2A 2OWJA 2GJ3A 3D72A 1D7EA 4B9OA 4YWZA 3CWFA 2QHKA 5TBMB 2PHYA 1UWNX 4DJ3A 4K08A 2D01A 3K3DA 4NXGA 3A0RA 1GSXA 1P97A 2PYPA 3ZQ5A 1MZUA 5HWWA 2INWA 2A24B 1TS6A 4H6JA 1GSVA 4HIAA 2J80A 2V9AA 4EEUA 4HHDA 5J3WA 2OOLA 4I39A 3UMDA 1OTIA 4R6LA 4RQ9A 1XJ4A 3UB8A 3OLOA 5KIZA 1T18A 4GHIA 1EW0A 3EEHA 3UE6A 1D06A 2WKPA 1VB6A 3VOLA 4JGOA 4MN5A 1OJGA 2PYRA 1S4SA 3FC7A 2D02A 3MR0A 5TBMA 3B33A 4F3LB 4DJ2A 1F9IA 4KUOA 4HJ3A 4HJ4A 4HOIA 1DP8A 2H28A 4HJ6A 4LPZA 3CLOA 3HJIA 2A24A 4KQDA 2JHEA 3K3CA 4R38A 1ODVA 4WUJA 5IS1A 4EEPA 2VV8A 3A0VA 2YKFA 3LIBA 4WLAA 3GDIA 2Z6CA 5AVFA 1OTEA 4HNBA 2QKPA 1OT9A 2EA9A 3E4OA 2Z6DA 3HJKA 2R78A 3LYXA 3F1OB 3A0SA 2V0UA 3G6OA 4WL9A 4HP9A 3T50A 5F5YA 4PKYG 3F1PB 3P7NA 4HI4A 2V1AA 4JGQA 4XT2B 2M1CA 3H7WA 5HDSA 5DJUA 1LT0A 1TS0A 4F3LA 3FG8A 3SW1A 3ULFA 3EWKA 1N9OA 3NOTC 2K7SA 4PKYA 1OTDA 1N9LA 2HV1A 2L1MA 4BBVA 5F68A 2W0NA 5F69A 4EW7A 1OTAA 3UB9A 3LIFA 1NWZA 2QJ7A 3PHYA 1DP6A 3BWLA 3CAXA 1OTBA 3IBRA 2OWHA 4R3AA 4EETB 3F1NB 1P0ZA 5G4ZA 4I3JA 1G28A 3F1OA 4L9FA 4I38A 3NHQA 2PDRA 2VLGA 1LSVA 5IU1A 3F1PA 1DP9A 3H7WB 5HWVA 4XT2A 1GSWA 2YKHA 4NXEA 2ZOHA 3GECA 1T1AA 1LSWA 2V0WA 2QJ5A 4GCZA 4EERA 3H82B 2B02A 1KOUA 2QWSA 5HD3A 3VE4A 5F6AA 4WF0A 3UB6A 5HD5A 1S67L 4EESA 1T1CA 4BBTA 4KUKA 1LSXA 2WKRA 2BASA 5DKKA 2KX6A 2P7JA 2PR6A 3RH8B 3C2WA 3F1NA 1S1YA 4GW9A 3LI8A 3MQOA 4BBUA 3NOUC 5HDCA 5DJTA 2W27A 4GS9B 1V9ZA 4M4XA 1S4RA 1WA9A 5HWTA 4MN6A 1Y28A 2V1BA 2L0WA 2VEAA 3LIDA 3PYPA 1S66L 4LRZE 3MXQA 3BY9A 3H82A 1LL8A 3LICA 4HH2A 2ZOIA 3MJQA 2ZBBA 2WKQA 4JGPA 1UWPX 2VV7A 2CMNA 1XJ3A 3RTYA 3VE3A 3H9WA 4HH3A 4I5SA 1DRMA 3BY8A 2L4RA 2I9VA 3UB7A 5J4EA 1S1ZA 1BYWA 3IS2B 3KX0X 4GS9A 4I3IA 2PD7A 3E4QA 3NJAA 5HZHA 4L9GA 3E4PA 3UMEA 4HQAA 3MFXA 4EXOA 1XFQA 1T19A 3LIEA 5EFWA 1TS8A 4JGRA 4I3AA 1X0OA 1UGUA 3C8CA 4LRYC 2PD8A 1XJ6A 2VV6A
chains in the Genus database with same CATH superfamily
2PU2A 5EUAA 1ALQA 1KE3A 4CLCD 1TS7A 5FATA 3BQAA 4RVAA 3NOPC 3T4TA 5J8XA 3HVFA 3OPPA 2ZC6B 2Y2QA 4OLDA 2V8FA 4D2OA 3MXSA 5CEBA 5TJJA 3IWOA 4CLCA 1YQSA 1HZOA 5FQKA 1TF1A 2C5WB 3T4SA 4HESA 1JNUA 3FYZA 5FI7A 4RA7A 4LCLA 4Q0JA 3MMHA 2Y2PA 2PR5A 4Y0OA 3ICYA 4GHIB 2KDKA 1KGEA 1VETB 2XA7M 3IS2A 2DNSA 3UDIA 5I5LA 2O9CA 1XJ2A 5L2FA 2OWJA 2W3FA 5FL3A 4R4RA 5M19A 3G32A 2VGLS 3VP3A 3DW0A 4UQIS 1PWGA 2XD5A 4LFUA 3QP4A 2ZLYA 2Y2IA 3IWIA 4NXGA 4HBUA 1GSXA 1MZUA 3EGDC 2Z2MB 3SS4A 4OVDA 5HWWA 2INWA 3IXBA 2A24B 1TS6A 4HIAA 4ZJ1A 4KZ8A 2XEPA 3A3IA 2FFFB 4I39A 3UMDA 3BEBA 1W79A 5KIZA 1W63M 3IQAA 5EV0A 4PM6A 4X68A 4GZBA 3BFFA 4WBGA 4JXGA 4BJPA 3IWQA 4Q0HA 4EUVA 1D06A 1ES5A 3Q81A 4G3VA 4S2KA 3BM6A 2WGWB 4MN5A 2Y4AA 2P04A 4JF4A 3S7PA 3B33A 4F3LB 4S2MA 5TR7A 2P9VB 3IF6C 4EQIA 4KG5A 4DJ2A 4HJ4A 3UDFA 2PRFA 4HOIA 4Q0IA 4JXSA 2Y2KA 3VMAA 3K3CA 1TDLA 4PAUA 1IYSA 1ODVA 4WUJA 3V3SA 2VV8A 3A0VA 5EVIA 4LENA 1ZKJA 3A3JA 4E3LA 3JVVA 2Z6CA 4GLQA 4S2IA 5CERA 3G2YA 4FUWA 3S7OA 4MCWA 3E4OA 1AWIA 5TGFA 3EQVA 2XSSA 2Y8HA 3NULA 1C3BA 2B95A 3LYXA 4JKTA 3VP2A 2V0UA 1LI9A 3O5YA 3Q7VB 3NI9A 3T50A 3F1PB 2J9OA 3VP1A 3P7NA 4HI4A 4JGQA 4WMCD 2M1CA 5HDSA 1Y4OA 2WK0A 5HPIA 3EOIA 1KGGA 3EWKA 1ACFA 3MS6A 1N9LA 4WMCA 5CTMA 4R4SA 3D9YA 1ESIA 1I5QA 5FASA 4GB7A 1N4OA 3EGXC 5EVIB 4S2NC 2J9PA 1NZUA 4UA6A 4EW7A 2J3WA 1PNEA 4NK3A 5FA7A 4GKUA 1YLJA 2ZM0A 4YOFA 1G68A 2QJ7A 1DP6A 5DF8A 3BWLA 5CRFA 3IXGA 3VFHA 2WGVA 4R3AA 3R7WA 2Y2NA 1L0EA 2V8CA 5L8MA 4FH4A 3HUMA 4IHQA 5G4ZA 5EM1A 1K38A 5CHJA 1G28A 5GL9A 4BLMA 5EPHA 4I38A 2QYBA 2PDRA 3KSHA 3V39A 1YSPA 1LSVA 4CLCE 3OZHA 2MJ6A 4KZ3A 1DP9A 2J3TD 3KSFA 4GJ4A 2NUTC 1A0KA 1WYCA 3B42A 3BJNA 4ZDXA 3PBRA 1OPXA 3GECA 2A49A 1CF0A 1NJ4A 4A5RA 5KMWA 4IUHA 1PWCA 2AVXA 4EERA 4O8GA 1PIOA 2B02A 2LB5A 3CMZA 4U0TA 3UPNA 4DN0A 5JYOA 1MWTA 5F6AA 3GR2A 1XGJA 1WE4A 3Q82A 5HD5A 4X1LA 2QPNA 2XQZA 4EESA 4WEJA 1K6RA 4Y17A 4EU0A 3RXXA 3SH9A 4X56A 5U47A 1YLPA 4FOFA 1SKFA 4MBFA 5DKKA 2H5SA 2KX6A 2P7JA 4XUZA 3MZDA 3OCNA 3C2WA 5A93A 1S1YA 4KZ9A 1E4DA 2DCFA 4P6ZS 4WELA 1GHIA 1TD5A 3G31A 4MN6A 3T4OA 2L0WA 4HEFA 2FH5A 3GSGA 2WUQA 2IWDA 3OCLA 1S66L 1MBLA 3DBAA 1CEFA 5FEFA 1KVLA 3ISGA 4LRZE 1STZA 3MXQA 3CG5A 4KZ4A 3WWXA 3NIAA 3BFCA 3H82A 4WYYA 4ZRRA 2ZQAA 4G3KA 1O07A 1MKIA 3RFBA 4BWIA 3BLMA 4HH2A 4ARZA 2O9AA 4C6YA 1PW1A 3V3RA 1BSGA 3DWZA 2XGNA 2E8IA 1K57C 4B4XA 1M40A 5EVEA 2CMNA 3DTIA 3K2NA 1SKOA 3NDGA 2M7VA 3GTCA 5EOEA 3BY8A 3MKEA 4ZTKA 3AGFA 3G4PA 4WZ5A 1H8MA 4DE2A 3G2ZA 4DF6A 1EROA 1SCWA 3IF6A 3KYEA 4ETZA 1BYWA 4DRTA 4O7DA 2WZXA 1BTLA 2PD7A 3VOYA 5HAIA 3PTEA 3FV7A 4CJNA 4L9GA 2W1TA 5C5KA 3ZG0A 2E8JA 1XFQA 3IH9A 4GNUA 1TS8A 4E3IA 4KENB 1IYPA 4LRYC 4I3AA 3C8CA 3HUOA 2VV6A 2Y2LA 4KG2A 4L9EA 3SZTA 3PAEA 1YMXA 1N9NA 3ZVTA 1M6KA 3E2KA 3N8LA 5HPFA 3LY3A 3TRCA 4Y3IA 1MC0A 5CXWA 1SDEA 1F98A 3S7NA 4Y13A 4MMNA 2JN7A 1OT6A 4WM9A 3T1XA 5HSQA 3SH7A 2OAP1 4R3JA 2KLIA 4LLOB 3LR0A 3UN7A 1V9YA 4JLFA 3DTEA 2W1TB 3FKVA 2JKTI 2GJ3A 4JBFA 3N7WA 1Q2PA 1MXOA 3IXDA 3D72A 1XGIA 4S2NA 4YWZA 1K4FA 4ZJ2A 3A3EA 2QHKA 3PXPA 5TBMB 1K55A 4DJ3A 1P9RA 4ID4A 1PYYA 3U2AA 2D01A 3QHYA 1BLSA 4K91A 4E6WA 1FCNA 1NXYA 3ZG7B 5I94A 5GLDA 2HPBA 3A0RA 2P08A 3LEQA 2BLSA 3T4KA 4FSFA 4GD6A 5CECA 3VOZA 5FDSA 2H0YA 4EEUA 1NRJA 5E2FA 5FAOA 2Q9NA 3ZVWA 4HHDA 4FH2A 1H3QA 2UV0E 2ZC7A 4FCFA 5GHYA 5DTKA 1JTDA 2WZZA 2Q9MA 4GHIA 1VETA 1CJFA 1KGFA 1K0KA 2XF3A 2WKPA 3GVBA 3ZYTA 4X69A 4K0WA 4Y15A 1ONGA 3N8RA 4D60A 3G34A 2JKTM 4MNRA 3BFGA 2XH9A 2D02A 4UA7A 3IX4A 3N4IA 1KVMA 3V5MA 5EECA 3HREA 3S22A 3UPOA 3QP2A 3TOIA 1L3LA 1YPRA 4X6TA 2Y2HA 4QJGA 4Y0UA 1XKZA 4QY6A 4KUOA 4IVKA 1DP8A 3TG9A 3JVUA 2H28A 1PZPA 3E2LA 3LY4A 3Q1FA 4LPZA 4LV3A 2A24A 4KQDA 5EVLA 4DMZA 3WS2A 2YKFA 3LIBA 2ZMVA 3OPRA 4MDZA 4BENA 2EA9A 2J7VA 3N6IA 3OOVA 1ZC2A 4OKPA 2R9WA 2ZMFA 3C7UA 2EX6A 4KZ6A 1RGZA 3A0SA 3OBFA 2Y91A 3G6OA 3VP0A 4WL9A 4HP9A 2ZD8A 2HF6A 2WGWA 3BQ8A 4PKYG 2VGKA 3CUEA 1N9BA 2Q0OA 1K57A 3CITA 1DJBA 4F3LA 3FG8A 2P9VA 3SOIA 4BQMA 4CPKA 2RL3A 3NOTC 4E3NA 2K7SA 1OTDA 2HV1A 4IJGA 2B18A 2WKIA 1IOUA 3P09A 3L7HA 5HAQA 3QP6A 3GMWA 1E3UD 2WAFA 3UE3A 1BULA 1OTAA 1S0WA 1BLPA 2VK3A 4Z9QA 2IWCA 1BT5A 2OWHA 1E3UA 1PRQA 4U0XA 4BD0A 3R4KA 3JYIA 1P0ZA 4I3JA 3NHQA 3PAGA 3Q7VA 2EFXA 3UNWA 1G6AA 1RCJA 3N8SA 3QP1A 5K5BA 5IU1A 3F1PA 5HWVA 1W8YA 4NXEA 3C4PA 2ZMAA 3WRTA 1DJCA 1U60A 1GA0A 1T1AA 5EVID 1LSWA 2QJ5A 1K25A 2XK1A 4GDNA 5GLCA 1KOUA 2Y2OA 2IWBA 3CJMA 2ZM8A 4QU3A 2QWSA 4Y7PA 5HD3A 1IYQA 1EWZA 1NLZA 1FQGA 2W1RA 4WF0A 3UB6A 5HX9A 5GHXA 3B47A 1JWVA 3WS0A 3BFEA 1T1CA 1LSXA 4DKIA 3B3XA 4R1GA 3KO6A 2PR6A 1YM1A 4GDBA 4X55A 5M1AA 4R3BA 4ZJ3A 2FZ0A 4GS9B 3T1RA 1TEMA 1CI9A 4L0LA 4KZBA 3VV4A 3PYPA 2CC1A 2KOIA 2EX9A 4U3TA 5L07A 4QWOA 4MEZA 4OH0A 3QNBA 4PMAA 1YLTA 1LL8A 5AQBA 4E3KA 2ZBBA 4IEDA 1I2WA 4WZ4A 1UWPX 3W4OA 2VV7A 2V20A 4XXRA 3T4JA 1XJ3A 5JYPA 3VE3A 4HH3A 5D3OA 4I5SA 4H8RA 5GLAA 4JF6A 1L0DA 1YLYA 4HBTA 2L4RA 3MXRA 3BFDA 3UB7A 4E6XA 3T12B 1PW8A 3ZG5A 3V67A 3NJAA 4FD8A 1HTZA 3E4PA 4QD4A 5HFOA 4E3MA 5DTSA 2GX5A 2M7UA 4GD8A 5KSCA 3NECA 1X0OA 1UGUA 1FCOA 3DAVA 2PD8A 3I7JA 4NG2A 4HP4A 3LIAA 3BLSA 2XD1A 4E3OA 5A8BA 1XFNA 4AFIA 2J8YA 3LR4A 2O0YA 3O86A 2VGLM 3TJZC 4H6JB 4EQ1A 3LO7A 4NETA 3LI9A 3PR6A 4UQIM 1CQAA 3HLCA 5G4YA 3UDXA 2ZQ8A 4BD1A 2OLVA 1JWPA 4WN5A 3MBZA 5J7EA 5FI2A 1DY6A 4RYEA 1VEUB 4OQIA 2HDSA 4ESPA 1DJAA 3BW6A 2A3UA 3G30A 3O87A 3LUQA 3ZG9B 1CI8A 5HDDA 4F94A 3L9KA 4CLCC 2ZL1A 3WRZA 1D7EA 3UY6A 1AXBA 5AJGA 2Y59A 1UWNX 4Y5FA 2ZM2A 4CQHA 3K3DA 3MF0A 4P85A 2ZQ9A 3BYDA 1P97A 2PYPA 5A91A 3MZEA 2HJEA 1GSVA 2J80A 2ZJ9A 4YNRA 2XA7S 1E25A 1NYMA 2XLNA 5J3WA 2JBFA 2OOLA 3W8KA 2BG1A 1OTIA 4R6LA 4B4ZA 3LEZA 1L0FA 3UB8A 2XROA 5E2GA 1LLBA 1MWSA 1SZVA 1ZG4A 1FSYA 3PBTA 3HLBA 2HP6A 2XRNA 5F83A 3UE6A 1F5MA 1YLZA 2H0TA 4OPYA 5L09A 2ZL1B 3SS3A 5F1GA 3VOLA 1P9WA 3WS4A 1EI5A 4N9KA 4JGOA 2FFYA 1OJGA 2PYRA 3HLFA 3E0YA 3MKFA 4N1HA 1S4SA 3FC7A 3TSGA 3MR0A 3IF5A 5TBMA 3S7QA 1XP4A 3GRJA 4X1MA 2HGVA 3P98A 5M18A 3IX8A 5HARA 3CZDA 2C6WB 1F2KA 4Q8IA 1GHMA 4X25A 3HJIA 1YAXA 2H10A 4R38A 2ZC4B 3IHBA 1HD8A 4FTXA 4EEPA 3NBLA 4WLAA 4MBKA 2HDRA 4PM8A 5AQ9A 1FSWA 5AVFA 1OTEA 4HNBA 3C5AA 1NYYA 2HP5A 3IBJA 3PBOA 3WS1A 2QZ6A 4KG6A 3S1YA 2R78A 4LCMA 3ZNYA 4IUKA 3F1OB 1VM1A 2V1AA 4XT2B 1YMSA 3KSIA 2UWXA 3H7WA 5AQ7A 3JPUA 5DJUA 4EBNA 1MY8A 1TS0A 3BRMA 3ULFA 1N9OA 5MC7A 2NUPC 5AQAA 5A92A 2JKGA 4S2PA 3HUNA 4Y0TA 4KQOA 1ERMA 4OQGA 2W0NA 1O7EA 3MZFA 5F69A 3DTMA 3C30A 3UB9A 2EFUA 5CGSA 1NWZA 3PHYA 1L2SA 4PHTA 3CAXA 1G6OA 2OAQ1 2EX2A 2DMWA 4PM9A 3F1NB 4ETXA 3ITAA 3SS5A 3FPVA 4YINA 3ZDJA 3FPWA 4BMWA 2ZQ7A 1RP5A 1RGYA 3H7WB 3T4LA 3LR5A 4KQRA 2ZC5B 2ZOHA 4LV2A 3E98A 3FWLA 5EM0A 4K0XA 1KDSA 2W3GA 4DE3A 4P6ZM 3ZCZA 2ZC3B 5TFQA 5FQQA 2EX8A 4P6BA 4DXCA 3VE4A 1IKIA 2QMIA 4C75A 5CEDA 5FSRA 5G18A 2K2NA 1S67L 1K54C 1K4EA 5E2EA 4EBPA 4BBTA 2HJ9C 2WKRA 5L10A 5HL1A 4UA9A 2J3TC 4NEED 3NDEA 3RH8B 1BUEA 4GW9A 3MQOA 4MN7A 1BZAA 4BBUA 4JXWA 4P0MA 4O01A 3M2JA 1Z09A 1MWRA 2W27A 3WS5A 1V9ZA 5LBRA 4M4XA 4OLGA 1WA9A 2VA0A 2PAVP 5E2HA 1Y28A 2V1BA 2VEAA 2JKRM 1BLCA 5EE8A 4EBLA 4OONA 1ESUA 4IBRA 2W3HA 1NLYA 1VHMA 2R9XA 3LICA 2ZOIA 4S2OA 1TDGA 2G2UA 4PM7A 1HLUP 1W5DA 4JXVA 4X53A 2WKQA 3IX3A 3ZNTA 3MQ0A 2HP9A 2LB9A 4CLCB 2XFTA 3TE8A 3LCEA 4ZBEA 1VQQA 2A2LA 4EWFA 1IEMA 4DXBA 3M2KA 4B93A 2X01A 4RX3A 1H8ZA 3PBQA 4OP8A 3ZFZA 3UB5P 3W2ZA 5J4EA 5F82A 1Q2QA 3KYQA 1S1ZA 1NZOA 3IS2B 3KX0X 4GS9A 3MSHA 4II7A 3RJUA 4JPMA 2V1ZA 4UHUA 5HZHA 1ERQA 3HLGA 3UMEA 3FKWA 4EUZA 5FQIA 3MFXA 2BTFP 4EXOA 1PWDA 5EFWA 5FEGA 2ACGA 4WZ5C 3QNCA 2WGIA 3AGEA 2W3EA 5DKLA 1T1BA 4QY5A 4EV4A 2ZQDA 3O88A 5FQMA 4IBXA 5FQJA 4KQQA 3MQQA 5AVEA 3UO9A 4LRXC 4UEYA 3HL9A 1OJ5A 3HLDA 4NXBA 5DF7A 3IXHA 3PBSA 3NCKA 4OPZA 3T1QB 4R70A 1WYBA 1XA7A 4R0QA 4HY8A 1KE0A 4NXFA 4E04A 2G2WA 2GNXA 2P74A 4OP5A 3LFVA 1FOFA 3EQUA 4R23A 1XXMA 2VJWA 2W3DA 4MBHA 4B9OA 2VZWA 3CWFA 4WEKA 3GQZA 1ZTUA 3P01A 5CTNA 1ONHA 2PHYA 1LL5A 4K08A 2WKHA 2G7UA 2HDQA 2PBYA 1YLWA 4DDSA 3DTKA 5GHZA 3ZQ5A 2PU4A 4H6JA 2B5RA 2V9AA 1D1JA 2JE5A 1S6RA 3HLWA 3O3VA 1ES4A 1ZHHB 4RX2A 5F1FA 1K55C 4RQ9A 1XJ4A 3G35A 3OLOA 1T18A 1VEUA 5DVAA 1K56D 1J3WA 3D3OA 4DE1A 4OOMA 4IVIA 1EW0A 3EEHA 3OPLA 1L0GA 4NKPA 1VB6A 3DWKA 5GLBA 1K56A 2OLUA 1LL9A 5A90A 3CPTA 4LV1A 1K54A 3EEAA 2O9BA 5CGXA 1F9IA 4OOYA 1IKGA 4JF5A 4HJ3A 3KYZA 2JC7A 4LGWA 4HJ6A 3CLOA 2Y2GA 2JCHA 2JHEA 1G5UA 5IS1A 1QMFA 5DF9A 1W63Q 3GDIA 4C3QA 1LI0A 1SHVA 3NY4A 2ZQCA 1PI5A 2V2FF 1CEGA 3R7WB 2QKPA 1OT9A 3UPPA 4OPQA 4N9LA 1PZOA 1W8QA 4YFMA 3IH8A 2Z6DA 5IHVA 3M6BA 3HJKA 4ME4A 1FIKA 3LR3A 3Q07A 1OMEA 2JKFA 2Y2JA 3OC2A 3PBNA 5F5YA 3CPTB 1CK3A 3MFDA 2X71A 3VFFA 3TW8A 1W7FA 2I72A 3ZGAB 1LT0A 3A3FA 1LHYA 3SW1A 4BL2A 1JWZA 2K31A 1FILA 1FR1A 4BL3A 4PKYA 1BLHA 1H8YA 1GCEA 3AGDA 4O0PA 2GZAA 3IT9A 2L1MA 4BBVA 1FCMA 2WAEA 2PT7A 2EWVA 5F68A 1H5XA 4Z1WA 5KZHA 4QPRA 5E43A 1MKMA 2EWWA 3VSLA 2EXBA 1ES3A 2Y55A 3LIFA 3CUEC 5HL6A 1IFQA 1FR6A 1TVFA 4PPRA 3V50A 3ZHHA 1OTBA 3Q7ZA 1YSQA 3IBRA 1XPBA 4DE0A 4EETB 2WYXA 1H0MA 1ES2A 4LV0A 3W4PA 3A3DA 1XX2A 2RCXA 3CI6A 3F1OA 4L9FA 1YKDA 4KZ7A 2VLGA 4QHCA 4Y2FA 3SH8A 1IYOA 3S4XA 3FZCA 5FI6A 2HDUA 1Y54A 4XT2A 1GSWA 4PM5A 2YKHA 1JVJA 1IELA 2WADA 1PFLA 3HBRA 3BECA 1JTGA 2V0WA 4QB8A 1Z6FA 4GCZA 5DTTA 4KZAA 3H82B 4S2LA 3M6HA 1GA9A 5CGWA 3UE0A 2O99A 2Y2MA 3T4QA 3C7VA 4ARZB 2GDNA 3UE1A 5HAPA 2Z2LB 1SDNA 1SKOB 3U4LP 5EOOA 4KUKA 3QP8A 2BASA 3VP4A 4KZ5A 4M3KA 5CHUA 4ZAMA 1KE4A 3C38A 5KSHA 4UAAA 1NY0A 4B88A 3F1NA 5BOHA 3LI8A 3C4OA 2IA2A 1GHPA 3NOUC 5EVIC 3NC8A 5HDCA 3IF6B 3HLEA 2X02A 4N92A 5DJTA 4OOLA 4E3JA 1S4RA 5DFXA 5HWTA 3VSKA 2DRWA 3LIDA 1YT4A 2WKEA 4S2JA 1PI4A 3BY9A 5CHMA 4OQ0A 1NRFA 1K6SA 4XUXA 4N1XA 3QP5A 5CX7A 3KSGA 4MLLA 5IT5A 1I2SA 4GN2A 2VKSA 3HCYA 3GV9A 3MJQA 3ZG8B 1MPLA 4JGPA 1KDWA 2VX8A 4OPRA 3CHWP 2OV5A 1J9MA 1ZG6A 2XR0A 5FAPA 2HZ5A 3RTYA 3H9WA 4G3WA 5FDHA 1DRMA 2OSUA 4GOGA 2VGJA 3D4FA 2EXAA 2I9VA 3RXWA 5HW3A 2JKRI 5FQ9A 5DFYA 1HVBA 4I3IA 3ITBA 3E4QA 3IHAA 2XFSA 4P87A 4HQAA 3LGOA 3OPHA 2XDMA 1T19A 1XA1A 3LIEA 4OQHA 1QMEA 1MWUA 4JGRA 2Y79A 4DDYA 2PBDP 5FAQA 1XJ6A 3T1SA 3W4QA
chains in the Genus database with same CATH topology
2W3EA 4HP4A 3LIAA 4L9EA 4CLCD 5DKLA 1TS7A 1T1BA 5A8BA 1XFNA 3BQAA 4AFIA 3NOPC 3LR4A 3T4TA 2O0YA 1N9NA 2VGLM 5HPFA 3MQQA 5AVEA 3TJZC 4H6JB 3TRCA 4EQ1A 4UQIM 3LI9A 3PR6A 4Y3IA 5TJJA 5G4YA 4CLCA 1MC0A 4LRXC 4UEYA 1F98A 1OJ5A 4NXBA 1TF1A 3S7NA 4WN5A 3T4SA 1JNUA 5J7EA 3PBSA 4MMNA 2JN7A 1OT6A 5HSQA 4Q0JA 3MMHA 2OAP1 2KLIA 4LLOB 4R70A 3LR0A 2PR5A 3ICYA 4GHIB 1V9YA 2KDKA 4HY8A 3BW6A 4NXFA 4E04A 2GNXA 2XA7M 3IS2A 3LUQA 5I5LA 2W1TB 5HDDA 2O9CA 1XJ2A 2JKTI 2OWJA 2GJ3A 2W3FA 3LFVA 5FL3A 4CLCC 3EQUA 2VGLS 2VJWA 2W3DA 3D72A 1D7EA 4B9OA 4YWZA 2VZWA 3CWFA 4WEKA 1ZTUA 4UQIS 2QHKA 3P01A 3PXPA 5TBMB 2PHYA 5AJGA 1UWNX 4Y5FA 4DJ3A 1P9RA 4K08A 3U2AA 2D01A 4CQHA 3K3DA 3MF0A 2G7UA 4NXGA 3A0RA 2P08A 1GSXA 1P97A 2PYPA 3ZQ5A 1MZUA 3EGDC 3T4KA 4FSFA 5HWWA 2INWA 2A24B 1TS6A 4H6JA 2HJEA 1GSVA 4HIAA 2J80A 4YNRA 2XA7S 2V9AA 4EEUA 1NRJA 4HHDA 5J3WA 1H3QA 2OOLA 4I39A 3UMDA 1ZHHB 1OTIA 4R6LA 4RQ9A 1XJ4A 3UB8A 3OLOA 2XROA 5KIZA 1W63M 1T18A 3PBTA 3D3OA 4GHIA 4BJPA 2XRNA 4OOMA 1EW0A 3EEHA 4Q0HA 3UE6A 4EUVA 1D06A 1F5MA 2WKPA 4G3VA 4NKPA 1VB6A 3VOLA 3ZYTA 1P9WA 4JGOA 4MN5A 1OJGA 2PYRA 3E0YA 2P04A 2JKTM 1S4SA 3S7PA 3FC7A 2D02A 3MR0A 5TBMA 3B33A 3EEAA 4F3LB 3S7QA 2O9BA 2HGVA 4DJ2A 1F9IA 4KUOA 4HJ3A 4HJ4A 4Q0IA 4HOIA 1DP8A 3KYZA 3JVUA 2H28A 4HJ6A 4LPZA 3CLOA 3HJIA 2A24A 1YAXA 4KQDA 2JHEA 3K3CA 4R38A 4DMZA 4PAUA 1ODVA 4WUJA 5IS1A 4EEPA 2VV8A 3A0VA 2YKFA 3LIBA 5DF9A 4WLAA 1W63Q 2ZMVA 3GDIA 3JVVA 2Z6CA 4MDZA 5AVFA 1OTEA 4HNBA 4GLQA 3R7WB 2QKPA 3S7OA 1OT9A 2EA9A 4MCWA 3E4OA 3OOVA 3IBJA 3PBOA 3EQVA 2XSSA 2Z6DA 2ZMFA 3HJKA 2Y8HA 2R78A 4ME4A 3LYXA 4IUKA 3F1OB 3A0SA 2V0UA 3LR3A 3OBFA 3G6OA 3O5YA 4WL9A 3OC2A 3PBNA 4HP9A 3T50A 2HF6A 5F5YA 3BQ8A 3F1PB 4PKYG 3P7NA 4HI4A 3TW8A 2V1AA 3CUEA 4JGQA 4XT2B 3KSIA 2M1CA 3H7WA 3CITA 5DJUA 5HDSA 1LT0A 5HPIA 1TS0A 3EOIA 3FG8A 4F3LA 3SW1A 3ULFA 3EWKA 1N9OA 5MC7A 2K31A 3NOTC 2NUPC 2K7SA 1OTDA 4PKYA 1N9LA 2HV1A 4O0PA 2GZAA 4IJGA 2B18A 2L1MA 4BBVA 2PT7A 2EWVA 1IOUA 5F68A 4Z1WA 4KQOA 3EGXC 2W0NA 4QPRA 5F69A 1MKMA 4EW7A 2J3WA 3UE3A 2EWWA 3C30A 1OTAA 3UB9A 3LIFA 3CUEC 5HL6A 4YOFA 1IFQA 1NWZA 2QJ7A 3PHYA 1DP6A 4PHTA 3BWLA 3CAXA 1G6OA 1OTBA 1YSQA 2OAQ1 3IBRA 2OWHA 2DMWA 4R3AA 3R7WA 4EETB 5L8MA 3F1NB 3R4KA 4IHQA 1P0ZA 5G4ZA 4ETXA 4I3JA 1G28A 3CI6A 3F1OA 4L9FA 4I38A 3FPVA 3NHQA 1YKDA 2QYBA 2PDRA 2VLGA 3KSHA 4Y2FA 1YSPA 3FPWA 4BMWA 5K5BA 1LSVA 4CLCE 5IU1A 2MJ6A 3F1PA 1DP9A 3H7WB 2J3TD 3KSFA 3LR5A 4GJ4A 3T4LA 5HWVA 2NUTC 4XT2A 1GSWA 3BJNA 3B42A 2YKHA 3PBRA 4NXEA 1OPXA 2ZOHA 3E98A 3GECA 1T1AA 1LSWA 2W3GA 2V0WA 2QJ5A 4GCZA 4P6ZM 4IUHA 4EERA 3H82B 4O8GA 2O99A 3T4QA 2B02A 1KOUA 2LB5A 4DN0A 2QWSA 4ARZB 5HD3A 3VE4A 5F6AA 1NLZA 2W1RA 4WF0A 3UB6A 5HD5A 2K2NA 1S67L 4EESA 4WEJA 3B47A 1T1CA 4BBTA 4EU0A 2HJ9C 4KUKA 1LSXA 2WKRA 4FOFA 2BASA 5DKKA 2KX6A 3C38A 2P7JA 3KO6A 5KSHA 2J3TC 2PR6A 3OCNA 4NEED 3RH8B 3C2WA 3F1NA 1S1YA 4GW9A 3LI8A 3MQOA 2IA2A 4MN7A 4BBUA 3NOUC 4P6ZS 4O01A 4WELA 5HDCA 1TD5A 2FZ0A 5DJTA 2W27A 4GS9B 1V9ZA 4OOLA 5LBRA 4M4XA 1S4RA 1WA9A 2VA0A 5DFXA 5HWTA 4MN6A 1Y28A 2V1BA 3T4OA 2L0WA 2FH5A 2VEAA 3LIDA 2JKRM 4L0LA 3OCLA 3VV4A 3PYPA 1S66L 3DBAA 2KOIA 4LRZE 1STZA 3MXQA 3BY9A 3H82A 4ZRRA 2W3HA 4G3KA 1LL8A 1NLYA 1VHMA 5CX7A 3RFBA 3LICA 3KSGA 4HH2A 4ARZA 4BWIA 2O9AA 5IT5A 2ZOIA 2VKSA 3HCYA 3MJQA 2ZBBA 2WKQA 4JGPA 2VX8A 3MQ0A 1UWPX 2VV7A 2CMNA 2LB9A 3K2NA 4CLCB 2M7VA 3T4JA 1XJ3A 3RTYA 3VE3A 3H9WA 4G3WA 3TE8A 4HH3A 4I5SA 1DRMA 3BY8A 2A2LA 2L4RA 2I9VA 4B93A 1H8MA 3PBQA 3UB7A 2JKRI 3W2ZA 5J4EA 5DFYA 4ETZA 3KYQA 1S1ZA 1BYWA 3IS2B 3KX0X 4GS9A 4I3IA 3V67A 4II7A 2PD7A 3E4QA 3NJAA 5HZHA 4L9GA 2W1TA 5C5KA 3E4PA 3UMEA 4HQAA 3MFXA 4EXOA 1XFQA 1T19A 3LIEA 2GX5A 5EFWA 2M7UA 1TS8A 4JGRA 2Y79A 4I3AA 1X0OA 1UGUA 3C8CA 4LRYC 2PD8A 1XJ6A 2VV6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HP4 A;  3LIA A;  4L9E A;  5DKL A;  1TS7 A;  1T1B A;  5A8B A;  1XFN A;  3NOP C;  1N9N A;  3MQQ A;  5AVE A;  4H6J B;  4EQ1 A;  3LI9 A;  5G4Y A;  4LRX C;  1F98 A;  1OJ5 A;  4NXB A;  4WN5 A;  1JNU A;  5J7E A;  2JN7 A;  1OT6 A;  5HSQ A;  4LLO B;  4R70 A;  2PR5 A;  3ICY A;  4GHI B;  1V9Y A;  2KDK A;  4HY8 A;  4NXF A;  4E04 A;  3IS2 A;  3LUQ A;  5I5L A;  5HDD A;  1XJ2 A;  2OWJ A;  2GJ3 A;  3D72 A;  1D7E A;  4B9O A;  4YWZ A;  3CWF A;  2QHK A;  5TBM B;  2PHY A;  1UWN X;  4DJ3 A;  4K08 A;  2D01 A;  3K3D A;  4NXG A;  3A0R A;  1GSX A;  1P97 A;  2PYP A;  3ZQ5 A;  1MZU A;  5HWW A;  2INW A;  2A24 B;  1TS6 A;  4H6J A;  1GSV A;  4HIA A;  2J80 A;  2V9A A;  4EEU A;  4HHD A;  5J3W A;  2OOL A;  4I39 A;  3UMD A;  1OTI A;  4R6L A;  4RQ9 A;  1XJ4 A;  3UB8 A;  3OLO A;  5KIZ A;  1T18 A;  4GHI A;  1EW0 A;  3EEH A;  3UE6 A;  1D06 A;  2WKP A;  1VB6 A;  3VOL A;  4JGO A;  4MN5 A;  1OJG A;  2PYR A;  1S4S A;  3FC7 A;  2D02 A;  3MR0 A;  5TBM A;  3B33 A;  4F3L B;  4DJ2 A;  1F9I A;  4KUO A;  4HJ3 A;  4HJ4 A;  4HOI A;  1DP8 A;  2H28 A;  4HJ6 A;  4LPZ A;  3CLO A;  3HJI A;  2A24 A;  4KQD A;  2JHE A;  3K3C A;  4R38 A;  1ODV A;  4WUJ A;  5IS1 A;  4EEP A;  2VV8 A;  3A0V A;  2YKF A;  3LIB A;  4WLA A;  3GDI A;  2Z6C A;  5AVF A;  1OTE A;  4HNB A;  2QKP A;  1OT9 A;  2EA9 A;  3E4O A;  2Z6D A;  3HJK A;  2R78 A;  3LYX A;  3F1O B;  3A0S A;  2V0U A;  3G6O A;  4WL9 A;  4HP9 A;  3T50 A;  5F5Y A;  4PKY G;  3F1P B;  3P7N A;  4HI4 A;  2V1A A;  4JGQ A;  4XT2 B;  2M1C A;  3H7W A;  5HDS A;  5DJU A;  1LT0 A;  1TS0 A;  4F3L A;  3FG8 A;  3SW1 A;  3ULF A;  3EWK A;  1N9O A;  3NOT C;  2K7S A;  4PKY A;  1OTD A;  1N9L A;  2HV1 A;  2L1M A;  4BBV A;  5F68 A;  2W0N A;  5F69 A;  4EW7 A;  1OTA A;  3UB9 A;  3LIF A;  1NWZ A;  2QJ7 A;  3PHY A;  1DP6 A;  3BWL A;  3CAX A;  1OTB A;  3IBR A;  2OWH A;  4R3A A;  4EET B;  3F1N B;  1P0Z A;  5G4Z A;  4I3J A;  1G28 A;  3F1O A;  4L9F A;  4I38 A;  3NHQ A;  2PDR A;  2VLG A;  1LSV A;  5IU1 A;  3F1P A;  1DP9 A;  3H7W B;  5HWV A;  4XT2 A;  1GSW A;  2YKH A;  4NXE A;  2ZOH A;  3GEC A;  1T1A A;  1LSW A;  2V0W A;  2QJ5 A;  4GCZ A;  4EER A;  3H82 B;  2B02 A;  1KOU A;  2QWS A;  5HD3 A;  3VE4 A;  5F6A A;  4WF0 A;  3UB6 A;  5HD5 A;  1S67 L;  4EES A;  1T1C A;  4BBT A;  4KUK A;  1LSX A;  2WKR A;  2BAS A;  5DKK A;  2KX6 A;  2P7J A;  2PR6 A;  3RH8 B;  3C2W A;  3F1N A;  1S1Y A;  4GW9 A;  3LI8 A;  3MQO A;  4BBU A;  3NOU C;  5HDC A;  5DJT A;  2W27 A;  4GS9 B;  1V9Z A;  4M4X A;  1S4R A;  1WA9 A;  5HWT A;  4MN6 A;  1Y28 A;  2V1B A;  2L0W A;  2VEA A;  3LID A;  3PYP A;  1S66 L;  4LRZ E;  3MXQ A;  3BY9 A;  3H82 A;  1LL8 A;  3LIC A;  4HH2 A;  2ZOI A;  3MJQ A;  2ZBB A;  2WKQ A;  4JGP A;  1UWP X;  2VV7 A;  2CMN A;  1XJ3 A;  3RTY A;  3VE3 A;  3H9W A;  4HH3 A;  4I5S A;  1DRM A;  3BY8 A;  2L4R A;  2I9V A;  3UB7 A;  5J4E A;  1S1Z A;  1BYW A;  3IS2 B;  3KX0 X;  4GS9 A;  4I3I A;  2PD7 A;  3E4Q A;  3NJA A;  5HZH A;  4L9G A;  3E4P A;  3UME A;  4HQA A;  3MFX A;  4EXO A;  1XFQ A;  1T19 A;  3LIE A;  5EFW A;  1TS8 A;  4JGR A;  4I3A A;  1X0O A;  1UGU A;  3C8C A;  4LRY C;  2PD8 A;  1XJ6 A;  2VV6 A; 
#chains in the Genus database with same CATH topology
 2PU2 A;  5EUA A;  1ALQ A;  1KE3 A;  4CLC D;  1TS7 A;  5FAT A;  3BQA A;  4RVA A;  3NOP C;  3T4T A;  5J8X A;  3HVF A;  3OPP A;  2ZC6 B;  2Y2Q A;  4OLD A;  2V8F A;  4D2O A;  3MXS A;  5CEB A;  5TJJ A;  3IWO A;  4CLC A;  1YQS A;  1HZO A;  5FQK A;  1TF1 A;  2C5W B;  3T4S A;  4HES A;  1JNU A;  3FYZ A;  5FI7 A;  4RA7 A;  4LCL A;  4Q0J A;  3MMH A;  2Y2P A;  2PR5 A;  4Y0O A;  3ICY A;  4GHI B;  2KDK A;  1KGE A;  1VET B;  2XA7 M;  3IS2 A;  2DNS A;  3UDI A;  5I5L A;  2O9C A;  1XJ2 A;  5L2F A;  2OWJ A;  2W3F A;  5FL3 A;  4R4R A;  5M19 A;  3G32 A;  2VGL S;  3VP3 A;  3DW0 A;  4UQI S;  1PWG A;  2XD5 A;  4LFU A;  3QP4 A;  2ZLY A;  2Y2I A;  3IWI A;  4NXG A;  4HBU A;  1GSX A;  1MZU A;  3EGD C;  2Z2M B;  3SS4 A;  4OVD A;  5HWW A;  2INW A;  3IXB A;  2A24 B;  1TS6 A;  4HIA A;  4ZJ1 A;  4KZ8 A;  2XEP A;  3A3I A;  2FFF B;  4I39 A;  3UMD A;  3BEB A;  1W79 A;  5KIZ A;  1W63 M;  3IQA A;  5EV0 A;  4PM6 A;  4X68 A;  4GZB A;  3BFF A;  4WBG A;  4JXG A;  4BJP A;  3IWQ A;  4Q0H A;  4EUV A;  1D06 A;  1ES5 A;  3Q81 A;  4G3V A;  4S2K A;  3BM6 A;  2WGW B;  4MN5 A;  2Y4A A;  2P04 A;  4JF4 A;  3S7P A;  3B33 A;  4F3L B;  4S2M A;  5TR7 A;  2P9V B;  3IF6 C;  4EQI A;  4KG5 A;  4DJ2 A;  4HJ4 A;  3UDF A;  2PRF A;  4HOI A;  4Q0I A;  4JXS A;  2Y2K A;  3VMA A;  3K3C A;  1TDL A;  4PAU A;  1IYS A;  1ODV A;  4WUJ A;  3V3S A;  2VV8 A;  3A0V A;  5EVI A;  4LEN A;  1ZKJ A;  3A3J A;  4E3L A;  3JVV A;  2Z6C A;  4GLQ A;  4S2I A;  5CER A;  3G2Y A;  4FUW A;  3S7O A;  4MCW A;  3E4O A;  1AWI A;  5TGF A;  3EQV A;  2XSS A;  2Y8H A;  3NUL A;  1C3B A;  2B95 A;  3LYX A;  4JKT A;  3VP2 A;  2V0U A;  1LI9 A;  3O5Y A;  3Q7V B;  3NI9 A;  3T50 A;  3F1P B;  2J9O A;  3VP1 A;  3P7N A;  4HI4 A;  4JGQ A;  4WMC D;  2M1C A;  5HDS A;  1Y4O A;  2WK0 A;  5HPI A;  3EOI A;  1KGG A;  3EWK A;  1ACF A;  3MS6 A;  1N9L A;  4WMC A;  5CTM A;  4R4S A;  3D9Y A;  1ESI A;  1I5Q A;  5FAS A;  4GB7 A;  1N4O A;  3EGX C;  5EVI B;  4S2N C;  2J9P A;  1NZU A;  4UA6 A;  4EW7 A;  2J3W A;  1PNE A;  4NK3 A;  5FA7 A;  4GKU A;  1YLJ A;  2ZM0 A;  4YOF A;  1G68 A;  2QJ7 A;  1DP6 A;  5DF8 A;  3BWL A;  5CRF A;  3IXG A;  3VFH A;  2WGV A;  4R3A A;  3R7W A;  2Y2N A;  1L0E A;  2V8C A;  5L8M A;  4FH4 A;  3HUM A;  4IHQ A;  5G4Z A;  5EM1 A;  1K38 A;  5CHJ A;  1G28 A;  5GL9 A;  4BLM A;  5EPH A;  4I38 A;  2QYB A;  2PDR A;  3KSH A;  3V39 A;  1YSP A;  1LSV A;  4CLC E;  3OZH A;  2MJ6 A;  4KZ3 A;  1DP9 A;  2J3T D;  3KSF A;  4GJ4 A;  2NUT C;  1A0K A;  1WYC A;  3B42 A;  3BJN A;  4ZDX A;  3PBR A;  1OPX A;  3GEC A;  2A49 A;  1CF0 A;  1NJ4 A;  4A5R A;  5KMW A;  4IUH A;  1PWC A;  2AVX A;  4EER A;  4O8G A;  1PIO A;  2B02 A;  2LB5 A;  3CMZ A;  4U0T A;  3UPN A;  4DN0 A;  5JYO A;  1MWT A;  5F6A A;  3GR2 A;  1XGJ A;  1WE4 A;  3Q82 A;  5HD5 A;  4X1L A;  2QPN A;  2XQZ A;  4EES A;  4WEJ A;  1K6R A;  4Y17 A;  4EU0 A;  3RXX A;  3SH9 A;  4X56 A;  5U47 A;  1YLP A;  4FOF A;  1SKF A;  4MBF A;  5DKK A;  2H5S A;  2KX6 A;  2P7J A;  4XUZ A;  3MZD A;  3OCN A;  3C2W A;  5A93 A;  1S1Y A;  4KZ9 A;  1E4D A;  2DCF A;  4P6Z S;  4WEL A;  1GHI A;  1TD5 A;  3G31 A;  4MN6 A;  3T4O A;  2L0W A;  4HEF A;  2FH5 A;  3GSG A;  2WUQ A;  2IWD A;  3OCL A;  1S66 L;  1MBL A;  3DBA A;  1CEF A;  5FEF A;  1KVL A;  3ISG A;  4LRZ E;  1STZ A;  3MXQ A;  3CG5 A;  4KZ4 A;  3WWX A;  3NIA A;  3BFC A;  3H82 A;  4WYY A;  4ZRR A;  2ZQA A;  4G3K A;  1O07 A;  1MKI A;  3RFB A;  4BWI A;  3BLM A;  4HH2 A;  4ARZ A;  2O9A A;  4C6Y A;  1PW1 A;  3V3R A;  1BSG A;  3DWZ A;  2XGN A;  2E8I A;  1K57 C;  4B4X A;  1M40 A;  5EVE A;  2CMN A;  3DTI A;  3K2N A;  1SKO A;  3NDG A;  2M7V A;  3GTC A;  5EOE A;  3BY8 A;  3MKE A;  4ZTK A;  3AGF A;  3G4P A;  4WZ5 A;  1H8M A;  4DE2 A;  3G2Z A;  4DF6 A;  1ERO A;  1SCW A;  3IF6 A;  3KYE A;  4ETZ A;  1BYW A;  4DRT A;  4O7D A;  2WZX A;  1BTL A;  2PD7 A;  3VOY A;  5HAI A;  3PTE A;  3FV7 A;  4CJN A;  4L9G A;  2W1T A;  5C5K A;  3ZG0 A;  2E8J A;  1XFQ A;  3IH9 A;  4GNU A;  1TS8 A;  4E3I A;  4KEN B;  1IYP A;  4LRY C;  4I3A A;  3C8C A;  3HUO A;  2VV6 A;  2Y2L A;  4KG2 A;  4L9E A;  3SZT A;  3PAE A;  1YMX A;  1N9N A;  3ZVT A;  1M6K A;  3E2K A;  3N8L A;  5HPF A;  3LY3 A;  3TRC A;  4Y3I A;  1MC0 A;  5CXW A;  1SDE A;  1F98 A;  3S7N A;  4Y13 A;  4MMN A;  2JN7 A;  1OT6 A;  4WM9 A;  3T1X A;  5HSQ A;  3SH7 A;  2OAP 1;  4R3J A;  2KLI A;  4LLO B;  3LR0 A;  3UN7 A;  1V9Y A;  4JLF A;  3DTE A;  2W1T B;  3FKV A;  2JKT I;  2GJ3 A;  4JBF A;  3N7W A;  1Q2P A;  1MXO A;  3IXD A;  3D72 A;  1XGI A;  4S2N A;  4YWZ A;  1K4F A;  4ZJ2 A;  3A3E A;  2QHK A;  3PXP A;  5TBM B;  1K55 A;  4DJ3 A;  1P9R A;  4ID4 A;  1PYY A;  3U2A A;  2D01 A;  3QHY A;  1BLS A;  4K91 A;  4E6W A;  1FCN A;  1NXY A;  3ZG7 B;  5I94 A;  5GLD A;  2HPB A;  3A0R A;  2P08 A;  3LEQ A;  2BLS A;  3T4K A;  4FSF A;  4GD6 A;  5CEC A;  3VOZ A;  5FDS A;  2H0Y A;  4EEU A;  1NRJ A;  5E2F A;  5FAO A;  2Q9N A;  3ZVW A;  4HHD A;  4FH2 A;  1H3Q A;  2UV0 E;  2ZC7 A;  4FCF A;  5GHY A;  5DTK A;  1JTD A;  2WZZ A;  2Q9M A;  4GHI A;  1VET A;  1CJF A;  1KGF A;  1K0K A;  2XF3 A;  2WKP A;  3GVB A;  3ZYT A;  4X69 A;  4K0W A;  4Y15 A;  1ONG A;  3N8R A;  4D60 A;  3G34 A;  2JKT M;  4MNR A;  3BFG A;  2XH9 A;  2D02 A;  4UA7 A;  3IX4 A;  3N4I A;  1KVM A;  3V5M A;  5EEC A;  3HRE A;  3S22 A;  3UPO A;  3QP2 A;  3TOI A;  1L3L A;  1YPR A;  4X6T A;  2Y2H A;  4QJG A;  4Y0U A;  1XKZ A;  4QY6 A;  4KUO A;  4IVK A;  1DP8 A;  3TG9 A;  3JVU A;  2H28 A;  1PZP A;  3E2L A;  3LY4 A;  3Q1F A;  4LPZ A;  4LV3 A;  2A24 A;  4KQD A;  5EVL A;  4DMZ A;  3WS2 A;  2YKF A;  3LIB A;  2ZMV A;  3OPR A;  4MDZ A;  4BEN A;  2EA9 A;  2J7V A;  3N6I A;  3OOV A;  1ZC2 A;  4OKP A;  2R9W A;  2ZMF A;  3C7U A;  2EX6 A;  4KZ6 A;  1RGZ A;  3A0S A;  3OBF A;  2Y91 A;  3G6O A;  3VP0 A;  4WL9 A;  4HP9 A;  2ZD8 A;  2HF6 A;  2WGW A;  3BQ8 A;  4PKY G;  2VGK A;  3CUE A;  1N9B A;  2Q0O A;  1K57 A;  3CIT A;  1DJB A;  4F3L A;  3FG8 A;  2P9V A;  3SOI A;  4BQM A;  4CPK A;  2RL3 A;  3NOT C;  4E3N A;  2K7S A;  1OTD A;  2HV1 A;  4IJG A;  2B18 A;  2WKI A;  1IOU A;  3P09 A;  3L7H A;  5HAQ A;  3QP6 A;  3GMW A;  1E3U D;  2WAF A;  3UE3 A;  1BUL A;  1OTA A;  1S0W A;  1BLP A;  2VK3 A;  4Z9Q A;  2IWC A;  1BT5 A;  2OWH A;  1E3U A;  1PRQ A;  4U0X A;  4BD0 A;  3R4K A;  3JYI A;  1P0Z A;  4I3J A;  3NHQ A;  3PAG A;  3Q7V A;  2EFX A;  3UNW A;  1G6A A;  1RCJ A;  3N8S A;  3QP1 A;  5K5B A;  5IU1 A;  3F1P A;  5HWV A;  1W8Y A;  4NXE A;  3C4P A;  2ZMA A;  3WRT A;  1DJC A;  1U60 A;  1GA0 A;  1T1A A;  5EVI D;  1LSW A;  2QJ5 A;  1K25 A;  2XK1 A;  4GDN A;  5GLC A;  1KOU A;  2Y2O A;  2IWB A;  3CJM A;  2ZM8 A;  4QU3 A;  2QWS A;  4Y7P A;  5HD3 A;  1IYQ A;  1EWZ A;  1NLZ A;  1FQG A;  2W1R A;  4WF0 A;  3UB6 A;  5HX9 A;  5GHX A;  3B47 A;  1JWV A;  3WS0 A;  3BFE A;  1T1C A;  1LSX A;  4DKI A;  3B3X A;  4R1G A;  3KO6 A;  2PR6 A;  1YM1 A;  4GDB A;  4X55 A;  5M1A A;  4R3B A;  4ZJ3 A;  2FZ0 A;  4GS9 B;  3T1R A;  1TEM A;  1CI9 A;  4L0L A;  4KZB A;  3VV4 A;  3PYP A;  2CC1 A;  2KOI A;  2EX9 A;  4U3T A;  5L07 A;  4QWO A;  4MEZ A;  4OH0 A;  3QNB A;  4PMA A;  1YLT A;  1LL8 A;  5AQB A;  4E3K A;  2ZBB A;  4IED A;  1I2W A;  4WZ4 A;  1UWP X;  3W4O A;  2VV7 A;  2V20 A;  4XXR A;  3T4J A;  1XJ3 A;  5JYP A;  3VE3 A;  4HH3 A;  5D3O A;  4I5S A;  4H8R A;  5GLA A;  4JF6 A;  1L0D A;  1YLY A;  4HBT A;  2L4R A;  3MXR A;  3BFD A;  3UB7 A;  4E6X A;  3T12 B;  1PW8 A;  3ZG5 A;  3V67 A;  3NJA A;  4FD8 A;  1HTZ A;  3E4P A;  4QD4 A;  5HFO A;  4E3M A;  5DTS A;  2GX5 A;  2M7U A;  4GD8 A;  5KSC A;  3NEC A;  1X0O A;  1UGU A;  1FCO A;  3DAV A;  2PD8 A;  3I7J A;  4NG2 A;  4HP4 A;  3LIA A;  3BLS A;  2XD1 A;  4E3O A;  5A8B A;  1XFN A;  4AFI A;  2J8Y A;  3LR4 A;  2O0Y A;  3O86 A;  2VGL M;  3TJZ C;  4H6J B;  4EQ1 A;  3LO7 A;  4NET A;  3LI9 A;  3PR6 A;  4UQI M;  1CQA A;  3HLC A;  5G4Y A;  3UDX A;  2ZQ8 A;  4BD1 A;  2OLV A;  1JWP A;  4WN5 A;  3MBZ A;  5J7E A;  5FI2 A;  1DY6 A;  4RYE A;  1VEU B;  4OQI A;  2HDS A;  4ESP A;  1DJA A;  3BW6 A;  2A3U A;  3G30 A;  3O87 A;  3LUQ A;  3ZG9 B;  1CI8 A;  5HDD A;  4F94 A;  3L9K A;  4CLC C;  2ZL1 A;  3WRZ A;  1D7E A;  3UY6 A;  1AXB A;  5AJG A;  2Y59 A;  1UWN X;  4Y5F A;  2ZM2 A;  4CQH A;  3K3D A;  3MF0 A;  4P85 A;  2ZQ9 A;  3BYD A;  1P97 A;  2PYP A;  5A91 A;  3MZE A;  2HJE A;  1GSV A;  2J80 A;  2ZJ9 A;  4YNR A;  2XA7 S;  1E25 A;  1NYM A;  2XLN A;  5J3W A;  2JBF A;  2OOL A;  3W8K A;  2BG1 A;  1OTI A;  4R6L A;  4B4Z A;  3LEZ A;  1L0F A;  3UB8 A;  2XRO A;  5E2G A;  1LLB A;  1MWS A;  1SZV A;  1ZG4 A;  1FSY A;  3PBT A;  3HLB A;  2HP6 A;  2XRN A;  5F83 A;  3UE6 A;  1F5M A;  1YLZ A;  2H0T A;  4OPY A;  5L09 A;  2ZL1 B;  3SS3 A;  5F1G A;  3VOL A;  1P9W A;  3WS4 A;  1EI5 A;  4N9K A;  4JGO A;  2FFY A;  1OJG A;  2PYR A;  3HLF A;  3E0Y A;  3MKF A;  4N1H A;  1S4S A;  3FC7 A;  3TSG A;  3MR0 A;  3IF5 A;  5TBM A;  3S7Q A;  1XP4 A;  3GRJ A;  4X1M A;  2HGV A;  3P98 A;  5M18 A;  3IX8 A;  5HAR A;  3CZD A;  2C6W B;  1F2K A;  4Q8I A;  1GHM A;  4X25 A;  3HJI A;  1YAX A;  2H10 A;  4R38 A;  2ZC4 B;  3IHB A;  1HD8 A;  4FTX A;  4EEP A;  3NBL A;  4WLA A;  4MBK A;  2HDR A;  4PM8 A;  5AQ9 A;  1FSW A;  5AVF A;  1OTE A;  4HNB A;  3C5A A;  1NYY A;  2HP5 A;  3IBJ A;  3PBO A;  3WS1 A;  2QZ6 A;  4KG6 A;  3S1Y A;  2R78 A;  4LCM A;  3ZNY A;  4IUK A;  3F1O B;  1VM1 A;  2V1A A;  4XT2 B;  1YMS A;  3KSI A;  2UWX A;  3H7W A;  5AQ7 A;  3JPU A;  5DJU A;  4EBN A;  1MY8 A;  1TS0 A;  3BRM A;  3ULF A;  1N9O A;  5MC7 A;  2NUP C;  5AQA A;  5A92 A;  2JKG A;  4S2P A;  3HUN A;  4Y0T A;  4KQO A;  1ERM A;  4OQG A;  2W0N A;  1O7E A;  3MZF A;  5F69 A;  3DTM A;  3C30 A;  3UB9 A;  2EFU A;  5CGS A;  1NWZ A;  3PHY A;  1L2S A;  4PHT A;  3CAX A;  1G6O A;  2OAQ 1;  2EX2 A;  2DMW A;  4PM9 A;  3F1N B;  4ETX A;  3ITA A;  3SS5 A;  3FPV A;  4YIN A;  3ZDJ A;  3FPW A;  4BMW A;  2ZQ7 A;  1RP5 A;  1RGY A;  3H7W B;  3T4L A;  3LR5 A;  4KQR A;  2ZC5 B;  2ZOH A;  4LV2 A;  3E98 A;  3FWL A;  5EM0 A;  4K0X A;  1KDS A;  2W3G A;  4DE3 A;  4P6Z M;  3ZCZ A;  2ZC3 B;  5TFQ A;  5FQQ A;  2EX8 A;  4P6B A;  4DXC A;  3VE4 A;  1IKI A;  2QMI A;  4C75 A;  5CED A;  5FSR A;  5G18 A;  2K2N A;  1S67 L;  1K54 C;  1K4E A;  5E2E A;  4EBP A;  4BBT A;  2HJ9 C;  2WKR A;  5L10 A;  5HL1 A;  4UA9 A;  2J3T C;  4NEE D;  3NDE A;  3RH8 B;  1BUE A;  4GW9 A;  3MQO A;  4MN7 A;  1BZA A;  4BBU A;  4JXW A;  4P0M A;  4O01 A;  3M2J A;  1Z09 A;  1MWR A;  2W27 A;  3WS5 A;  1V9Z A;  5LBR A;  4M4X A;  4OLG A;  1WA9 A;  2VA0 A;  2PAV P;  5E2H A;  1Y28 A;  2V1B A;  2VEA A;  2JKR M;  1BLC A;  5EE8 A;  4EBL A;  4OON A;  1ESU A;  4IBR A;  2W3H A;  1NLY A;  1VHM A;  2R9X A;  3LIC A;  2ZOI A;  4S2O A;  1TDG A;  2G2U A;  4PM7 A;  1HLU P;  1W5D A;  4JXV A;  4X53 A;  2WKQ A;  3IX3 A;  3ZNT A;  3MQ0 A;  2HP9 A;  2LB9 A;  4CLC B;  2XFT A;  3TE8 A;  3LCE A;  4ZBE A;  1VQQ A;  2A2L A;  4EWF A;  1IEM A;  4DXB A;  3M2K A;  4B93 A;  2X01 A;  4RX3 A;  1H8Z A;  3PBQ A;  4OP8 A;  3ZFZ A;  3UB5 P;  3W2Z A;  5J4E A;  5F82 A;  1Q2Q A;  3KYQ A;  1S1Z A;  1NZO A;  3IS2 B;  3KX0 X;  4GS9 A;  3MSH A;  4II7 A;  3RJU A;  4JPM A;  2V1Z A;  4UHU A;  5HZH A;  1ERQ A;  3HLG A;  3UME A;  3FKW A;  4EUZ A;  5FQI A;  3MFX A;  2BTF P;  4EXO A;  1PWD A;  5EFW A;  5FEG A;  2ACG A;  4WZ5 C;  3QNC A;  2WGI A;  3AGE A;  2W3E A;  5DKL A;  1T1B A;  4QY5 A;  4EV4 A;  2ZQD A;  3O88 A;  5FQM A;  4IBX A;  5FQJ A;  4KQQ A;  3MQQ A;  5AVE A;  3UO9 A;  4LRX C;  4UEY A;  3HL9 A;  1OJ5 A;  3HLD A;  4NXB A;  5DF7 A;  3IXH A;  3PBS A;  3NCK A;  4OPZ A;  3T1Q B;  4R70 A;  1WYB A;  1XA7 A;  4R0Q A;  4HY8 A;  1KE0 A;  4NXF A;  4E04 A;  2G2W A;  2GNX A;  2P74 A;  4OP5 A;  3LFV A;  1FOF A;  3EQU A;  4R23 A;  1XXM A;  2VJW A;  2W3D A;  4MBH A;  4B9O A;  2VZW A;  3CWF A;  4WEK A;  3GQZ A;  1ZTU A;  3P01 A;  5CTN A;  1ONH A;  2PHY A;  1LL5 A;  4K08 A;  2WKH A;  2G7U A;  2HDQ A;  2PBY A;  1YLW A;  4DDS A;  3DTK A;  5GHZ A;  3ZQ5 A;  2PU4 A;  4H6J A;  2B5R A;  2V9A A;  1D1J A;  2JE5 A;  1S6R A;  3HLW A;  3O3V A;  1ES4 A;  1ZHH B;  4RX2 A;  5F1F A;  1K55 C;  4RQ9 A;  1XJ4 A;  3G35 A;  3OLO A;  1T18 A;  1VEU A;  5DVA A;  1K56 D;  1J3W A;  3D3O A;  4DE1 A;  4OOM A;  4IVI A;  1EW0 A;  3EEH A;  3OPL A;  1L0G A;  4NKP A;  1VB6 A;  3DWK A;  5GLB A;  1K56 A;  2OLU A;  1LL9 A;  5A90 A;  3CPT A;  4LV1 A;  1K54 A;  3EEA A;  2O9B A;  5CGX A;  1F9I A;  4OOY A;  1IKG A;  4JF5 A;  4HJ3 A;  3KYZ A;  2JC7 A;  4LGW A;  4HJ6 A;  3CLO A;  2Y2G A;  2JCH A;  2JHE A;  1G5U A;  5IS1 A;  1QMF A;  5DF9 A;  1W63 Q;  3GDI A;  4C3Q A;  1LI0 A;  1SHV A;  3NY4 A;  2ZQC A;  1PI5 A;  2V2F F;  1CEG A;  3R7W B;  2QKP A;  1OT9 A;  3UPP A;  4OPQ A;  4N9L A;  1PZO A;  1W8Q A;  4YFM A;  3IH8 A;  2Z6D A;  5IHV A;  3M6B A;  3HJK A;  4ME4 A;  1FIK A;  3LR3 A;  3Q07 A;  1OME A;  2JKF A;  2Y2J A;  3OC2 A;  3PBN A;  5F5Y A;  3CPT B;  1CK3 A;  3MFD A;  2X71 A;  3VFF A;  3TW8 A;  1W7F A;  2I72 A;  3ZGA B;  1LT0 A;  3A3F A;  1LHY A;  3SW1 A;  4BL2 A;  1JWZ A;  2K31 A;  1FIL A;  1FR1 A;  4BL3 A;  4PKY A;  1BLH A;  1H8Y A;  1GCE A;  3AGD A;  4O0P A;  2GZA A;  3IT9 A;  2L1M A;  4BBV A;  1FCM A;  2WAE A;  2PT7 A;  2EWV A;  5F68 A;  1H5X A;  4Z1W A;  5KZH A;  4QPR A;  5E43 A;  1MKM A;  2EWW A;  3VSL A;  2EXB A;  1ES3 A;  2Y55 A;  3LIF A;  3CUE C;  5HL6 A;  1IFQ A;  1FR6 A;  1TVF A;  4PPR A;  3V50 A;  3ZHH A;  1OTB A;  3Q7Z A;  1YSQ A;  3IBR A;  1XPB A;  4DE0 A;  4EET B;  2WYX A;  1H0M A;  1ES2 A;  4LV0 A;  3W4P A;  3A3D A;  1XX2 A;  2RCX A;  3CI6 A;  3F1O A;  4L9F A;  1YKD A;  4KZ7 A;  2VLG A;  4QHC A;  4Y2F A;  3SH8 A;  1IYO A;  3S4X A;  3FZC A;  5FI6 A;  2HDU A;  1Y54 A;  4XT2 A;  1GSW A;  4PM5 A;  2YKH A;  1JVJ A;  1IEL A;  2WAD A;  1PFL A;  3HBR A;  3BEC A;  1JTG A;  2V0W A;  4QB8 A;  1Z6F A;  4GCZ A;  5DTT A;  4KZA A;  3H82 B;  4S2L A;  3M6H A;  1GA9 A;  5CGW A;  3UE0 A;  2O99 A;  2Y2M A;  3T4Q A;  3C7V A;  4ARZ B;  2GDN A;  3UE1 A;  5HAP A;  2Z2L B;  1SDN A;  1SKO B;  3U4L P;  5EOO A;  4KUK A;  3QP8 A;  2BAS A;  3VP4 A;  4KZ5 A;  4M3K A;  5CHU A;  4ZAM A;  1KE4 A;  3C38 A;  5KSH A;  4UAA A;  1NY0 A;  4B88 A;  3F1N A;  5BOH A;  3LI8 A;  3C4O A;  2IA2 A;  1GHP A;  3NOU C;  5EVI C;  3NC8 A;  5HDC A;  3IF6 B;  3HLE A;  2X02 A;  4N92 A;  5DJT A;  4OOL A;  4E3J A;  1S4R A;  5DFX A;  5HWT A;  3VSK A;  2DRW A;  3LID A;  1YT4 A;  2WKE A;  4S2J A;  1PI4 A;  3BY9 A;  5CHM A;  4OQ0 A;  1NRF A;  1K6S A;  4XUX A;  4N1X A;  3QP5 A;  5CX7 A;  3KSG A;  4MLL A;  5IT5 A;  1I2S A;  4GN2 A;  2VKS A;  3HCY A;  3GV9 A;  3MJQ A;  3ZG8 B;  1MPL A;  4JGP A;  1KDW A;  2VX8 A;  4OPR A;  3CHW P;  2OV5 A;  1J9M A;  1ZG6 A;  2XR0 A;  5FAP A;  2HZ5 A;  3RTY A;  3H9W A;  4G3W A;  5FDH A;  1DRM A;  2OSU A;  4GOG A;  2VGJ A;  3D4F A;  2EXA A;  2I9V A;  3RXW A;  5HW3 A;  2JKR I;  5FQ9 A;  5DFY A;  1HVB A;  4I3I A;  3ITB A;  3E4Q A;  3IHA A;  2XFS A;  4P87 A;  4HQA A;  3LGO A;  3OPH A;  2XDM A;  1T19 A;  1XA1 A;  3LIE A;  4OQH A;  1QME A;  1MWU A;  4JGR A;  2Y79 A;  4DDY A;  2PBD P;  5FAQ A;  1XJ6 A;  3T1S A;  3W4Q A; 
#chains in the Genus database with same CATH homology
 2W3E A;  4HP4 A;  3LIA A;  4L9E A;  4CLC D;  5DKL A;  1TS7 A;  1T1B A;  5A8B A;  1XFN A;  3BQA A;  4AFI A;  3NOP C;  3LR4 A;  3T4T A;  2O0Y A;  1N9N A;  2VGL M;  5HPF A;  3MQQ A;  5AVE A;  3TJZ C;  4H6J B;  3TRC A;  4EQ1 A;  4UQI M;  3LI9 A;  3PR6 A;  4Y3I A;  5TJJ A;  5G4Y A;  4CLC A;  1MC0 A;  4LRX C;  4UEY A;  1F98 A;  1OJ5 A;  4NXB A;  1TF1 A;  3S7N A;  4WN5 A;  3T4S A;  1JNU A;  5J7E A;  3PBS A;  4MMN A;  2JN7 A;  1OT6 A;  5HSQ A;  4Q0J A;  3MMH A;  2OAP 1;  2KLI A;  4LLO B;  4R70 A;  3LR0 A;  2PR5 A;  3ICY A;  4GHI B;  1V9Y A;  2KDK A;  4HY8 A;  3BW6 A;  4NXF A;  4E04 A;  2GNX A;  2XA7 M;  3IS2 A;  3LUQ A;  5I5L A;  2W1T B;  5HDD A;  2O9C A;  1XJ2 A;  2JKT I;  2OWJ A;  2GJ3 A;  2W3F A;  3LFV A;  5FL3 A;  4CLC C;  3EQU A;  2VGL S;  2VJW A;  2W3D A;  3D72 A;  1D7E A;  4B9O A;  4YWZ A;  2VZW A;  3CWF A;  4WEK A;  1ZTU A;  4UQI S;  2QHK A;  3P01 A;  3PXP A;  5TBM B;  2PHY A;  5AJG A;  1UWN X;  4Y5F A;  4DJ3 A;  1P9R A;  4K08 A;  3U2A A;  2D01 A;  4CQH A;  3K3D A;  3MF0 A;  2G7U A;  4NXG A;  3A0R A;  2P08 A;  1GSX A;  1P97 A;  2PYP A;  3ZQ5 A;  1MZU A;  3EGD C;  3T4K A;  4FSF A;  5HWW A;  2INW A;  2A24 B;  1TS6 A;  4H6J A;  2HJE A;  1GSV A;  4HIA A;  2J80 A;  4YNR A;  2XA7 S;  2V9A A;  4EEU A;  1NRJ A;  4HHD A;  5J3W A;  1H3Q A;  2OOL A;  4I39 A;  3UMD A;  1ZHH B;  1OTI A;  4R6L A;  4RQ9 A;  1XJ4 A;  3UB8 A;  3OLO A;  2XRO A;  5KIZ A;  1W63 M;  1T18 A;  3PBT A;  3D3O A;  4GHI A;  4BJP A;  2XRN A;  4OOM A;  1EW0 A;  3EEH A;  4Q0H A;  3UE6 A;  4EUV A;  1D06 A;  1F5M A;  2WKP A;  4G3V A;  4NKP A;  1VB6 A;  3VOL A;  3ZYT A;  1P9W A;  4JGO A;  4MN5 A;  1OJG A;  2PYR A;  3E0Y A;  2P04 A;  2JKT M;  1S4S A;  3S7P A;  3FC7 A;  2D02 A;  3MR0 A;  5TBM A;  3B33 A;  3EEA A;  4F3L B;  3S7Q A;  2O9B A;  2HGV A;  4DJ2 A;  1F9I A;  4KUO A;  4HJ3 A;  4HJ4 A;  4Q0I A;  4HOI A;  1DP8 A;  3KYZ A;  3JVU A;  2H28 A;  4HJ6 A;  4LPZ A;  3CLO A;  3HJI A;  2A24 A;  1YAX A;  4KQD A;  2JHE A;  3K3C A;  4R38 A;  4DMZ A;  4PAU A;  1ODV A;  4WUJ A;  5IS1 A;  4EEP A;  2VV8 A;  3A0V A;  2YKF A;  3LIB A;  5DF9 A;  4WLA A;  1W63 Q;  2ZMV A;  3GDI A;  3JVV A;  2Z6C A;  4MDZ A;  5AVF A;  1OTE A;  4HNB A;  4GLQ A;  3R7W B;  2QKP A;  3S7O A;  1OT9 A;  2EA9 A;  4MCW A;  3E4O A;  3OOV A;  3IBJ A;  3PBO A;  3EQV A;  2XSS A;  2Z6D A;  2ZMF A;  3HJK A;  2Y8H A;  2R78 A;  4ME4 A;  3LYX A;  4IUK A;  3F1O B;  3A0S A;  2V0U A;  3LR3 A;  3OBF A;  3G6O A;  3O5Y A;  4WL9 A;  3OC2 A;  3PBN A;  4HP9 A;  3T50 A;  2HF6 A;  5F5Y A;  3BQ8 A;  3F1P B;  4PKY G;  3P7N A;  4HI4 A;  3TW8 A;  2V1A A;  3CUE A;  4JGQ A;  4XT2 B;  3KSI A;  2M1C A;  3H7W A;  3CIT A;  5DJU A;  5HDS A;  1LT0 A;  5HPI A;  1TS0 A;  3EOI A;  3FG8 A;  4F3L A;  3SW1 A;  3ULF A;  3EWK A;  1N9O A;  5MC7 A;  2K31 A;  3NOT C;  2NUP C;  2K7S A;  1OTD A;  4PKY A;  1N9L A;  2HV1 A;  4O0P A;  2GZA A;  4IJG A;  2B18 A;  2L1M A;  4BBV A;  2PT7 A;  2EWV A;  1IOU A;  5F68 A;  4Z1W A;  4KQO A;  3EGX C;  2W0N A;  4QPR A;  5F69 A;  1MKM A;  4EW7 A;  2J3W A;  3UE3 A;  2EWW A;  3C30 A;  1OTA A;  3UB9 A;  3LIF A;  3CUE C;  5HL6 A;  4YOF A;  1IFQ A;  1NWZ A;  2QJ7 A;  3PHY A;  1DP6 A;  4PHT A;  3BWL A;  3CAX A;  1G6O A;  1OTB A;  1YSQ A;  2OAQ 1;  3IBR A;  2OWH A;  2DMW A;  4R3A A;  3R7W A;  4EET B;  5L8M A;  3F1N B;  3R4K A;  4IHQ A;  1P0Z A;  5G4Z A;  4ETX A;  4I3J A;  1G28 A;  3CI6 A;  3F1O A;  4L9F A;  4I38 A;  3FPV A;  3NHQ A;  1YKD A;  2QYB A;  2PDR A;  2VLG A;  3KSH A;  4Y2F A;  1YSP A;  3FPW A;  4BMW A;  5K5B A;  1LSV A;  4CLC E;  5IU1 A;  2MJ6 A;  3F1P A;  1DP9 A;  3H7W B;  2J3T D;  3KSF A;  3LR5 A;  4GJ4 A;  3T4L A;  5HWV A;  2NUT C;  4XT2 A;  1GSW A;  3BJN A;  3B42 A;  2YKH A;  3PBR A;  4NXE A;  1OPX A;  2ZOH A;  3E98 A;  3GEC A;  1T1A A;  1LSW A;  2W3G A;  2V0W A;  2QJ5 A;  4GCZ A;  4P6Z M;  4IUH A;  4EER A;  3H82 B;  4O8G A;  2O99 A;  3T4Q A;  2B02 A;  1KOU A;  2LB5 A;  4DN0 A;  2QWS A;  4ARZ B;  5HD3 A;  3VE4 A;  5F6A A;  1NLZ A;  2W1R A;  4WF0 A;  3UB6 A;  5HD5 A;  2K2N A;  1S67 L;  4EES A;  4WEJ A;  3B47 A;  1T1C A;  4BBT A;  4EU0 A;  2HJ9 C;  4KUK A;  1LSX A;  2WKR A;  4FOF A;  2BAS A;  5DKK A;  2KX6 A;  3C38 A;  2P7J A;  3KO6 A;  5KSH A;  2J3T C;  2PR6 A;  3OCN A;  4NEE D;  3RH8 B;  3C2W A;  3F1N A;  1S1Y A;  4GW9 A;  3LI8 A;  3MQO A;  2IA2 A;  4MN7 A;  4BBU A;  3NOU C;  4P6Z S;  4O01 A;  4WEL A;  5HDC A;  1TD5 A;  2FZ0 A;  5DJT A;  2W27 A;  4GS9 B;  1V9Z A;  4OOL A;  5LBR A;  4M4X A;  1S4R A;  1WA9 A;  2VA0 A;  5DFX A;  5HWT A;  4MN6 A;  1Y28 A;  2V1B A;  3T4O A;  2L0W A;  2FH5 A;  2VEA A;  3LID A;  2JKR M;  4L0L A;  3OCL A;  3VV4 A;  3PYP A;  1S66 L;  3DBA A;  2KOI A;  4LRZ E;  1STZ A;  3MXQ A;  3BY9 A;  3H82 A;  4ZRR A;  2W3H A;  4G3K A;  1LL8 A;  1NLY A;  1VHM A;  5CX7 A;  3RFB A;  3LIC A;  3KSG A;  4HH2 A;  4ARZ A;  4BWI A;  2O9A A;  5IT5 A;  2ZOI A;  2VKS A;  3HCY A;  3MJQ A;  2ZBB A;  2WKQ A;  4JGP A;  2VX8 A;  3MQ0 A;  1UWP X;  2VV7 A;  2CMN A;  2LB9 A;  3K2N A;  4CLC B;  2M7V A;  3T4J A;  1XJ3 A;  3RTY A;  3VE3 A;  3H9W A;  4G3W A;  3TE8 A;  4HH3 A;  4I5S A;  1DRM A;  3BY8 A;  2A2L A;  2L4R A;  2I9V A;  4B93 A;  1H8M A;  3PBQ A;  3UB7 A;  2JKR I;  3W2Z A;  5J4E A;  5DFY A;  4ETZ A;  3KYQ A;  1S1Z A;  1BYW A;  3IS2 B;  3KX0 X;  4GS9 A;  4I3I A;  3V67 A;  4II7 A;  2PD7 A;  3E4Q A;  3NJA A;  5HZH A;  4L9G A;  2W1T A;  5C5K A;  3E4P A;  3UME A;  4HQA A;  3MFX A;  4EXO A;  1XFQ A;  1T19 A;  3LIE A;  2GX5 A;  5EFW A;  2M7U A;  1TS8 A;  4JGR A;  2Y79 A;  4I3A A;  1X0O A;  1UGU A;  3C8C A;  4LRY C;  2PD8 A;  1XJ6 A;  2VV6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...