The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
66
|
sequence length |
208
|
structure length |
208
|
Chain Sequence |
HHSSGLVPRGSHMQKVVLATGNVGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKVTALPAIADASGLAVDVLGGAPGIYSARYSGEDATDQKNLQKLLETMKDVPDDQRQARFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAELTREEKSAISHRGQALKLLLDALRN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Hydrolase
|
molecule keywords |
Inosine Triphosphate Pyrophosphatase RdgB
|
publication title |
Molecular basis of the antimutagenic activity of the house-cleaning inosine triphosphate pyrophosphatase RdgB from Escherichia coli.
pubmed doi rcsb |
source organism |
Escherichia coli
|
total genus |
66
|
structure length |
208
|
sequence length |
208
|
ec nomenclature |
ec
3.6.1.66: XTP/dITP diphosphatase. |
pdb deposition date | 2007-05-16 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01725 | Ham1p_like | Ham1 family |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Alpha-Beta Complex | Maf protein | Maf protein |
#chains in the Genus database with same CATH superfamily 1K7K A; 1VP2 A; 4HEB A; 4P0U A; 2J4E A; 4P0E A; 3TQU A; 2AMH A; 4BNQ A; 2DVO A; 2CAR A; 4OO0 A; 1ZNO A; 1EXC A; 1U14 A; 4LU1 A; 2I5D A; 2DVP A; 4F95 A; 1ZWY A; 3S86 A; 1B78 A; 2P5X A; 2DVN A; 2Q16 A; 2MJP A; 4JHC A; 1EX2 A; 1V7R A; 2E5X A; 2PYU A; 2ZTI A; 1U5W A; #chains in the Genus database with same CATH topology 2A9S A; 1K7K A; 1VP2 A; 4HEB A; 4P0U A; 4CT9 A; 2J4E A; 4P0E A; 3TQU A; 2AMH A; 4BNQ A; 2DVO A; 2CAR A; 4OO0 A; 1ZNO A; 1EXC A; 4CTA A; 1U14 A; 4UUX A; 4LU1 A; 2I5D A; 5KVK A; 2DVP A; 4F95 A; 1ZWY A; 4UUW A; 3S86 A; 4UOC A; 1B78 A; 4CTA B; 4CT8 A; 2P5X A; 2DVN A; 2Q16 A; 2MJP A; 4JHC A; 1EX2 A; 5KOL A; 1V7R A; 2E5X A; 2PYU A; 2ZTI A; 1U5W A; #chains in the Genus database with same CATH homology 1K7K A; 1VP2 A; 4HEB A; 4P0U A; 2J4E A; 4P0E A; 3TQU A; 2AMH A; 4BNQ A; 2DVO A; 2CAR A; 4OO0 A; 1ZNO A; 1EXC A; 1U14 A; 4LU1 A; 2I5D A; 2DVP A; 4F95 A; 1ZWY A; 3S86 A; 1B78 A; 2P5X A; 2DVN A; 2Q16 A; 2MJP A; 4JHC A; 1EX2 A; 1V7R A; 2E5X A; 2PYU A; 2ZTI A; 1U5W A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...